BLAST/PSIBLAST alignment of GI: 254780201 and GI: 254780923 at iteration 1
>gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62] Length = 365
>gi|254040600|gb|ACT57396.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter asiaticus str. psy62] Length = 365
 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 212/356 (59%), Gaps = 4/356 (1%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           GY++  S        S   + ++++++  F FW  + L + +  KL +    +  YGSR 
Sbjct: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT-LFYKRSKKLCYDENYVVAYGSRS 67

Query: 100 EQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYY 159
            +K F + N +M    + FD ++  +  +L  GW + P+  K   + IK+KIAIVVH YY
Sbjct: 68  GKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGW-ESPAMGKVMQIAIKAKIAIVVHLYY 126

Query: 160 QDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYL 219
            D WIEI+++L  L+  FDL VT+V  +   + ++LK FP+A++++MEN GRDV PFL L
Sbjct: 127 IDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLIL 186

Query: 220 LELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPC 279
           LE      YDY+CKIHGKKS+R+GY   EG +WRRWLF+DLLG   +  +II TF+ +  
Sbjct: 187 LETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRD 246

Query: 280 LGMIGSRRYRRYKRWSFFAKRSEVYRRVI-DLAKRAGFPTKRLHLDFFNGTMFWVKPKCL 338
           +GMIGSR YR   ++  +       R +I  LA R G   +   LDFF GTMFWV+ + L
Sbjct: 247 IGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEAL 306

Query: 339 EPLRNLHLIGEFEEE-RNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLL 393
           +P++NL L   FE +     DG +EHAVER F+ SV+   F I  VDC+  Y + L
Sbjct: 307 DPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSL 362