BLAST/PSIBLAST alignment of GI: 254780201 and GI: 315122651 at iteration 1
>gi|315122651|ref|YP_004063140.1| hypothetical protein CKC_04515 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 405
>gi|313496053|gb|ADR52652.1| hypothetical protein CKC_04515 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 405
 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 162/370 (43%), Positives = 220/370 (59%), Gaps = 9/370 (2%)

Query: 23  VEEKGNMQAIYIPAHVS--GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFS 80
           V  K    +I++P      GY +  S        S  +  +++S F  F FW+RS   F 
Sbjct: 27  VSSKNRKLSIFLPVSGCRKGYLLFVSRRENWNFDSNHLVIRKVSFFLGFFFWIRSLFLFK 86

Query: 81  KYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSP 140
           +Y  L +   RI  YGSR  +K F   N+ M    +PFD EK      L  GW D PSS 
Sbjct: 87  RYQTLRYDENRIIAYGSRIGKKFFACSNKDMLARGVPFDGEKIHRFPRLLHGW-DSPSSE 145

Query: 141 KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS 200
           K + + I+S++AIVVH YY D W EI+++L  LNF FDL +T+V      + ++LK FP+
Sbjct: 146 KIASVKIQSRVAIVVHIYYADLWAEIANLLSGLNFSFDLHITLVTEIASIKSEILKRFPN 205

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A +YVMEN GRD+R FL LLE G  D YDY+CKIHGKKS+R G+   +G +WRRWLFFDL
Sbjct: 206 AHIYVMENYGRDIRSFLKLLEGGKLDSYDYVCKIHGKKSKRNGHVWWDGDLWRRWLFFDL 265

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG   IA+ II TFE+ P +GMIGSR YR  ++ S    R      V  +A + G   + 
Sbjct: 266 LGAPGIALEIIKTFEKYPKIGMIGSRTYRYDQKISLGNNR----EFVCAIANKMGVSFED 321

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLK--DGALEHAVERFFACSVRYTEF 378
             +DFF GTMFWV+P+ L+P++NL L   F+ + ++   DG LEHA+ER F+ SV    F
Sbjct: 322 TKIDFFGGTMFWVRPQALDPIKNLALTQYFKSKVDMVGLDGCLEHAIERCFSISVEKANF 381

Query: 379 SIESVDCVAE 388
            +  VDC++E
Sbjct: 382 DLAYVDCLSE 391