BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780201|ref|YP_003064614.1| hypothetical protein
CLIBASIA_00430 [Candidatus Liberibacter asiaticus str. psy62]
         (394 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039878|gb|ACT56674.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 394

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/394 (100%), Positives = 394/394 (100%)

Query: 1   MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHF 60
           MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHF
Sbjct: 1   MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHF 60

Query: 61  QELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDS 120
           QELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDS
Sbjct: 61  QELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDS 120

Query: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF 180
           EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF
Sbjct: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF 180

Query: 181 VTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ 240
           VTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ
Sbjct: 181 VTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ 240

Query: 241 REGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR 300
           REGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR
Sbjct: 241 REGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR 300

Query: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGA 360
           SEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGA
Sbjct: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGA 360

Query: 361 LEHAVERFFACSVRYTEFSIESVDCVAEYERLLH 394
           LEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
Sbjct: 361 LEHAVERFFACSVRYTEFSIESVDCVAEYERLLH 394


>gi|315122628|ref|YP_004063117.1| hypothetical protein CKC_04400 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496030|gb|ADR52629.1| hypothetical protein CKC_04400 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 399

 Score =  605 bits (1561), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 287/390 (73%), Positives = 335/390 (85%)

Query: 3   KVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQE 62
           K+FRLK K   +E L+ RLDVE KG++  +YIPA++SGYY+LWS S +Q+ITS+DV F+E
Sbjct: 8   KIFRLKIKSETLEKLVFRLDVENKGSVNTLYIPANISGYYMLWSLSKEQKITSEDVFFEE 67

Query: 63  LSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEK 122
           ++ F++ +FWLRSFL FSKYS+LSFPSCRIFFYGSRK++KAF RLNRFMSNSRMPFD +K
Sbjct: 68  VTTFKACLFWLRSFLTFSKYSQLSFPSCRIFFYGSRKDKKAFFRLNRFMSNSRMPFDGKK 127

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT 182
           FLY+KELFEGW +  S   K  + I SKIAIVVHCYYQDTW EISH+LLRLNFDFDLF+T
Sbjct: 128 FLYIKELFEGWKNLSSLDNKGKIKINSKIAIVVHCYYQDTWDEISHLLLRLNFDFDLFIT 187

Query: 183 VVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
            V+ NKDFEQDVLK FPSA+LYVMENKGRDV PFL LLELGVF  YDYLCKIHGKKS R 
Sbjct: 188 TVKKNKDFEQDVLKNFPSARLYVMENKGRDVLPFLCLLELGVFYDYDYLCKIHGKKSARR 247

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSE 302
            YHP EGI+WRRW+FFDLLGFSDIA+RIIN FEQNP +GMIGS R+RRYK++SFF KRS+
Sbjct: 248 NYHPFEGILWRRWIFFDLLGFSDIALRIINKFEQNPSIGMIGSGRFRRYKKYSFFKKRSK 307

Query: 303 VYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALE 362
           VY+RV+DLA+R  FP + L LDFFNGTMFWV+PKCLEPLRN+HL GEFEEE NL+DGALE
Sbjct: 308 VYKRVVDLARRIDFPVEELDLDFFNGTMFWVRPKCLEPLRNIHLTGEFEEECNLEDGALE 367

Query: 363 HAVERFFACSVRYTEFSIESVDCVAEYERL 392
           HAVERFF  SV+   FS+ESVDCVAEY++L
Sbjct: 368 HAVERFFPLSVQRAGFSLESVDCVAEYDQL 397


>gi|315122651|ref|YP_004063140.1| hypothetical protein CKC_04515 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496053|gb|ADR52652.1| hypothetical protein CKC_04515 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 405

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 162/370 (43%), Positives = 220/370 (59%), Gaps = 9/370 (2%)

Query: 23  VEEKGNMQAIYIPAHVS--GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFS 80
           V  K    +I++P      GY +  S        S  +  +++S F  F FW+RS   F 
Sbjct: 27  VSSKNRKLSIFLPVSGCRKGYLLFVSRRENWNFDSNHLVIRKVSFFLGFFFWIRSLFLFK 86

Query: 81  KYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSP 140
           +Y  L +   RI  YGSR  +K F   N+ M    +PFD EK      L  GW D PSS 
Sbjct: 87  RYQTLRYDENRIIAYGSRIGKKFFACSNKDMLARGVPFDGEKIHRFPRLLHGW-DSPSSE 145

Query: 141 KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS 200
           K + + I+S++AIVVH YY D W EI+++L  LNF FDL +T+V      + ++LK FP+
Sbjct: 146 KIASVKIQSRVAIVVHIYYADLWAEIANLLSGLNFSFDLHITLVTEIASIKSEILKRFPN 205

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A +YVMEN GRD+R FL LLE G  D YDY+CKIHGKKS+R G+   +G +WRRWLFFDL
Sbjct: 206 AHIYVMENYGRDIRSFLKLLEGGKLDSYDYVCKIHGKKSKRNGHVWWDGDLWRRWLFFDL 265

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG   IA+ II TFE+ P +GMIGSR YR  ++ S    R      V  +A + G   + 
Sbjct: 266 LGAPGIALEIIKTFEKYPKIGMIGSRTYRYDQKISLGNNR----EFVCAIANKMGVSFED 321

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLK--DGALEHAVERFFACSVRYTEF 378
             +DFF GTMFWV+P+ L+P++NL L   F+ + ++   DG LEHA+ER F+ SV    F
Sbjct: 322 TKIDFFGGTMFWVRPQALDPIKNLALTQYFKSKVDMVGLDGCLEHAIERCFSISVEKANF 381

Query: 379 SIESVDCVAE 388
            +  VDC++E
Sbjct: 382 DLAYVDCLSE 391


>gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040600|gb|ACT57396.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 365

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 212/356 (59%), Gaps = 4/356 (1%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           GY++  S        S   + ++++++  F FW  + L + +  KL +    +  YGSR 
Sbjct: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT-LFYKRSKKLCYDENYVVAYGSRS 67

Query: 100 EQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYY 159
            +K F + N +M    + FD ++  +  +L  GW + P+  K   + IK+KIAIVVH YY
Sbjct: 68  GKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGW-ESPAMGKVMQIAIKAKIAIVVHLYY 126

Query: 160 QDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYL 219
            D WIEI+++L  L+  FDL VT+V  +   + ++LK FP+A++++MEN GRDV PFL L
Sbjct: 127 IDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLIL 186

Query: 220 LELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPC 279
           LE      YDY+CKIHGKKS+R+GY   EG +WRRWLF+DLLG   +  +II TF+ +  
Sbjct: 187 LETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRD 246

Query: 280 LGMIGSRRYRRYKRWSFFAKRSEVYRRVI-DLAKRAGFPTKRLHLDFFNGTMFWVKPKCL 338
           +GMIGSR YR   ++  +       R +I  LA R G   +   LDFF GTMFWV+ + L
Sbjct: 247 IGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEAL 306

Query: 339 EPLRNLHLIGEFEEE-RNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLL 393
           +P++NL L   FE +     DG +EHAVER F+ SV+   F I  VDC+  Y + L
Sbjct: 307 DPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSL 362


>gi|13474020|ref|NP_105588.1| hypothetical protein mll4799 [Mesorhizobium loti MAFF303099]
 gi|14024772|dbj|BAB51374.1| mll4799 [Mesorhizobium loti MAFF303099]
          Length = 386

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 95/227 (41%), Positives = 128/227 (56%), Gaps = 3/227 (1%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYV 205
           T++ KIA+ +H +Y D W E   +L      F LF+T+   +    Q V   FP A++ V
Sbjct: 136 TVEPKIAVALHLHYPDLWPEFEALLEATGRQFQLFLTLTRPDAALAQRVQARFPGAEITV 195

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
            EN+GRDV PF+ LL  G FD +D +CK+HGKKS + G   + G IWR+   FDL+G   
Sbjct: 196 YENRGRDVGPFIQLLREGKFDPFDLICKLHGKKSGQSGPRMVLGEIWRQVSAFDLIGSRG 255

Query: 266 IAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR-SEVYRRVIDLAKRAGFPTKRLHLD 324
           +  RII  FE++P   MIGSRR+R    W        E     ++L +  G P+    LD
Sbjct: 256 VVDRIIANFERSPDTQMIGSRRFRLPNEWKGEKSAWGENRAMALNLLETMGMPSSS-RLD 314

Query: 325 FFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA 370
           FF GTMFWV+   LEPLR L L +  F EE   +DG L+HA+ER   
Sbjct: 315 FFAGTMFWVRRGALEPLRRLDLPLAAFPEETGQQDGTLQHALERVLG 361


>gi|299133415|ref|ZP_07026610.1| Rhamnan synthesis F [Afipia sp. 1NLS2]
 gi|298593552|gb|EFI53752.1| Rhamnan synthesis F [Afipia sp. 1NLS2]
          Length = 408

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 92/236 (38%), Positives = 130/236 (55%), Gaps = 5/236 (2%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK 196
           P +PK   L  +    I+VH +Y D W +    L  L   F L VT+ E+N DF   V  
Sbjct: 153 PGAPKPLQLNGRIATGIIVHLHYCDVWPDFEKRLRNLTCPFSLIVTLNESNPDFAARVAG 212

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
            FP+A++ V  N+GRDV PF+ LL  G  D ++ +CK+HGKK+   G   I G IWRR L
Sbjct: 213 QFPNAKVLVYPNRGRDVGPFIQLLREGHLDDFELICKLHGKKTVSLGPRMIFGEIWRRLL 272

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
             DL+G  ++   I+  F   P LG++GS  +R     ++           ++LAKR G 
Sbjct: 273 LNDLVGSDELVRAILQRFISQPGLGLVGSSHFRG----NYLGTWPRNAALTLELAKRLGC 328

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFAC 371
           P +R  LDFF GTMFWV+ + L+ L++L+L   +F  E    DG L+HA+ER F  
Sbjct: 329 PEERFKLDFFAGTMFWVRRELLDLLKSLNLSQDDFPVEAGQTDGTLQHALERIFGA 384


>gi|218455307|gb|AAX19610.2| WxocB [Xanthomonas oryzae pv. oryzicola]
 gi|218455309|gb|AAX19612.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 120/240 (50%), Gaps = 19/240 (7%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS----A 201
           ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V   +    +  ++YF      A
Sbjct: 314 SLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISD--RRMAVRYFQEHKIRA 371

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS    YH   G  WR  L   LL
Sbjct: 372 SVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSV---YHD-GGGQWRDDLMKALL 427

Query: 262 GFSDIAIRIINTFEQNPCLGMIG--SRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           G S   +R++  F+ +P  G++G  S      + W    +R  V      LA   G   K
Sbjct: 428 GSSFDVLRVLRAFDDHPACGIVGPESAYLSNARFWGGNEERLRV------LAAETGIEEK 481

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
           R+ L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F
Sbjct: 482 RIRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGF 541


>gi|218455296|gb|AAV67426.2| glycosyltransferase [Xanthomonas oryzae pv. oryzicola]
 gi|218455299|gb|AAX19602.2| WxocB [Xanthomonas oryzae pv. oryzicola]
 gi|218455301|gb|AAX19604.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 120/240 (50%), Gaps = 19/240 (7%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS----A 201
           ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V   +    +  ++YF      A
Sbjct: 314 SLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISD--RRMAVRYFQEHKIRA 371

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS    YH   G  WR  L   LL
Sbjct: 372 SVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSV---YHD-GGGQWRDDLMKALL 427

Query: 262 GFSDIAIRIINTFEQNPCLGMIG--SRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           G S   +R++  F+ +P  G++G  S      + W    +R  V      LA   G   K
Sbjct: 428 GSSFDVLRVLRAFDDHPACGIVGPESAYLSNARFWGGNEERLRV------LAAETGIEEK 481

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
           R+ L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F
Sbjct: 482 RIRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGF 541


>gi|166713474|ref|ZP_02244681.1| hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 568

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 120/240 (50%), Gaps = 19/240 (7%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS----A 201
           ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V   +    +  ++YF      A
Sbjct: 314 SLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISD--RRMAVRYFQEHKIRA 371

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS    YH   G  WR  L   LL
Sbjct: 372 SVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSV---YHD-GGGQWRDDLMKALL 427

Query: 262 GFSDIAIRIINTFEQNPCLGMIG--SRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           G S   +R++  F+ +P  G++G  S      + W    +R  V      LA   G   K
Sbjct: 428 GSSFDVLRVLRAFDDHPACGIVGPESAYLSNARFWGGNEERLRV------LAAETGIEEK 481

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
           R+ L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F
Sbjct: 482 RIRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGF 541


>gi|218455303|gb|AAX19606.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 121/241 (50%), Gaps = 21/241 (8%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS----A 201
           ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V   +    +  ++YF      A
Sbjct: 314 SLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISD--RRMAVRYFQEHKIRA 371

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ-REGYHPIEGIIWRRWLFFDL 260
            +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS  R+G     G  WR  L   L
Sbjct: 372 SVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSVYRDG-----GGQWRDDLMKAL 426

Query: 261 LGFSDIAIRIINTFEQNPCLGMIG--SRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT 318
           LG S   +R++  F+ +P  G++G  S      + W    +R  V      LA   G   
Sbjct: 427 LGSSFDVLRVLRAFDDHPACGIVGPESAYLSNARFWGGNEERLRV------LAAETGIEE 480

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTE 377
           KR+ L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    
Sbjct: 481 KRIRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAG 540

Query: 378 F 378
           F
Sbjct: 541 F 541


>gi|218455305|gb|AAX19608.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 120/240 (50%), Gaps = 19/240 (7%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS----A 201
           ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V   +    +  ++YF      A
Sbjct: 314 SLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISD--RRMAVRYFQEHKIRA 371

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            +++  N GRDV PF+ LL  G+ DRYD +CK+H KKS    YH   G  WR  L   LL
Sbjct: 372 SVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKVHSKKSV---YHD-GGGQWRDDLMKALL 427

Query: 262 GFSDIAIRIINTFEQNPCLGMIG--SRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           G S   +R++  F+ +P  G++G  S      + W    +R  V      LA   G   K
Sbjct: 428 GSSFNVLRVLRAFDDHPACGIVGPESAYLSNARFWGGNEERLRV------LAAETGIEEK 481

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
           R+ L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F
Sbjct: 482 RIRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGF 541


>gi|190572676|ref|YP_001970521.1| putative glycosyltransferase, fusion protein [Stenotrophomonas
           maltophilia K279a]
 gi|190010598|emb|CAQ44207.1| putative glycosyltransferase, fusion protein [Stenotrophomonas
           maltophilia K279a]
          Length = 566

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 114/230 (49%), Gaps = 19/230 (8%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE------ANKDFEQDVLKYFPS 200
           +KS+ AIV+H Y+ D    I   +  +  D DLFV+V        A + FE+  ++ F  
Sbjct: 313 LKSRFAIVLHLYHLDLIESIQGYMKNMIVDHDLFVSVKSVADRRVAVRFFEERKVRAF-- 370

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
             ++V  N GRDV PF+ LL  G+ DRYD +CKIH KKS    YH   G  WR  L   L
Sbjct: 371 --VFVHPNIGRDVGPFVSLLNTGLLDRYDAVCKIHSKKSV---YHD-GGGQWRDELMKSL 424

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG S   ++I+  F  +   G++G   +       F+    E  RR   LA   G    R
Sbjct: 425 LGSSHTVLKILRAFRHDSSCGIVGP-EHAYVSNARFWGGNEERLRR---LAAETGIDDAR 480

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
           + L FF GTMFW +P  L  LR   L + EF+ E    D  L H +ER F
Sbjct: 481 IRLGFFAGTMFWFRPAALYALRERALALSEFDPEAGQLDATLAHVIERLF 530


>gi|84501312|ref|ZP_00999517.1| hypothetical protein OB2597_13143 [Oceanicola batsensis HTCC2597]
 gi|84390603|gb|EAQ03091.1| hypothetical protein OB2597_13143 [Oceanicola batsensis HTCC2597]
          Length = 741

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 116/229 (50%), Gaps = 15/229 (6%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE--QDVLK-YFPSAQLY 204
           +++ AI +H YY D W E S  L RL+  FDL+VT+     + E   D+++   P AQ++
Sbjct: 127 RARFAIHLHLYYPDLWPEFSERLDRLDLSFDLYVTLTWRGPETEWLADIIREAHPRAQVF 186

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
            + N+GRD+ PFL LL  G FD Y+ +CK+HGKKS     H  +G  WRR L   +L   
Sbjct: 187 PVANRGRDILPFLRLLNAGAFDGYEAICKLHGKKSP----HRDDGDAWRRHLVDGVLPGK 242

Query: 265 DIAIRIINTF-EQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
            +   +     +++  L +   +RY   K W     R++   R ++L +           
Sbjct: 243 ALWTSLSAFLADEDAALWVADGQRYSVRKWWGSNRARTDALLRRVELDR------SDTDF 296

Query: 324 DFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFAC 371
           DF  G+M+W+KP  L  +R L L  + FE E    DG L HA ER    
Sbjct: 297 DFPAGSMYWMKPLLLGMIRALDLTEDLFEPESGQTDGTLAHAFERAIGA 345


>gi|192359986|ref|YP_001983898.1| Capsule polysaccharide biosynthesis protein family [Cellvibrio
           japonicus Ueda107]
 gi|190686151|gb|ACE83829.1| Capsule polysaccharide biosynthesis protein family [Cellvibrio
           japonicus Ueda107]
          Length = 872

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 109/233 (46%), Gaps = 24/233 (10%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE-ANKDFEQDVLKYFPSAQLYVM 206
           + +IA+V H YY+D   EI   L  +   FDL VT+ +   +  EQ V + +P A  Y  
Sbjct: 600 QKRIAVVAHLYYRDLVPEILSALETIPEAFDLIVTLPDWGTRHIEQMVREAYPEAVFYRA 659

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYH------PIEGIIWRRWLFFDL 260
            N+GRD+ PF+ LL L     YD L KI  K+    GY+      P  G +WR   F  L
Sbjct: 660 VNRGRDIGPFVDLLPLITEKNYDALLKIQTKR----GYYRSGRLLPQFGQLWRSETFRAL 715

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA-GFPTK 319
           LG       I+     +P L M+G   Y       F +     Y    DLA+     PT 
Sbjct: 716 LGNKSRVTDILEALRTDPSLNMVGPSPY-------FLSLTKYPYHDQGDLAQTILNNPTG 768

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNL-HL-IGEFEEERNLKDGALEHAVERFFA 370
                FF GTMFWV+P CL PL    HL I  FE E    DGA  H +ER F+
Sbjct: 769 N---GFFAGTMFWVRPSCLRPLTEPEHLSITAFEPESGANDGATAHLIERLFS 818


>gi|221634566|ref|YP_002523254.1| Lipopolysaccharide biosynthesis protein-like protein [Rhodobacter
           sphaeroides KD131]
 gi|221163439|gb|ACM04401.1| Lipopolysaccharide biosynthesis protein-like protein [Rhodobacter
           sphaeroides KD131]
          Length = 755

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/227 (33%), Positives = 113/227 (49%), Gaps = 15/227 (6%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV---EANKDFEQDVLKYFPSAQLYV 205
           +  A+ VH YY D W E +  L RL   FDL+VT+    E      Q++   FP A +  
Sbjct: 136 APYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVTLTYRGEETDALAQEIRADFPGAFVTP 195

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
           M N+GRD+ PF+ LL  G FD Y  +CK H KKS     H  +G +WR+ L   +L  + 
Sbjct: 196 MPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKSP----HRQDGDLWRKHLIEGILPETG 251

Query: 266 IAIRIINTFEQNPCLGM-IGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLD 324
           +  + +  F + P  G  +   ++    +W  +    E  R ++   +R   P  R  L 
Sbjct: 252 LEEK-LEAFVEAPEAGFWVADGQHYTGTQW--WGSNVEATRHLL---QRIEIPLDREALS 305

Query: 325 FFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA 370
           F  G+++WVKP  L  LR+L L + +F+ E    DG L HA+ER   
Sbjct: 306 FPAGSIYWVKPLVLGLLRSLQLRLEDFDIEEGQVDGTLAHAIERVLG 352


>gi|125654691|ref|YP_001033885.1| hypothetical protein RSP_3918 [Rhodobacter sphaeroides 2.4.1]
 gi|77386351|gb|ABA81780.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 751

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 113/227 (49%), Gaps = 15/227 (6%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV---EANKDFEQDVLKYFPSAQLYV 205
           +  A+ VH YY D W E +  L RL   FDL+VT+    E      +++   FP A +  
Sbjct: 132 APYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVTLTYRGEETDALAEEIRADFPGAFVTP 191

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
           M N+GRD+ PF+ LL  G FD Y  +CK H KKS     H  +G +WR+ L   +L  + 
Sbjct: 192 MPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKSP----HRQDGDLWRKHLIEGILPETG 247

Query: 266 IAIRIINTFEQNPCLGM-IGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLD 324
           +  + +  F + P  G  +   ++    +W  +    E  R ++   +R   P  R  L 
Sbjct: 248 LEEK-LEAFVEAPEAGFWVADGQHYTGTQW--WGSNVEATRHLL---QRIEIPLDREALS 301

Query: 325 FFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA 370
           F  G+++WVKP  L  LR+L L + +F+ E    DG L HA+ER   
Sbjct: 302 FPAGSIYWVKPLVLGLLRSLQLRLEDFDLEEGQVDGTLAHAIERVLG 348


>gi|259414984|ref|ZP_05738907.1| glycosyl transferase, group 1 [Silicibacter sp. TrichCH4B]
 gi|259349435|gb|EEW61182.1| glycosyl transferase, group 1 [Silicibacter sp. TrichCH4B]
          Length = 680

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 116/237 (48%), Gaps = 15/237 (6%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD---VL 195
           +P +     ++  A+V+H YY D W E    L    F FDL+VT+ E   + E+    + 
Sbjct: 62  APLRGAGINQNLQAVVIHLYYTDLWDEFRDRLRSARFTFDLYVTLTEQGPETEETRARIA 121

Query: 196 KYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRW 255
           + +P A++ V+ N+GRD+ PFL+LL  G  D Y  +CK+H KKS     H  +G +WR  
Sbjct: 122 EDWPEARVLVLPNRGRDIYPFLHLLNAGWLDHYRAVCKLHSKKSP----HRQDGDVWRTH 177

Query: 256 LFFDLLGFSDIAIRIINTFEQNPC-LGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
           L   +L   + A  +        C L +   + Y   + W    +R       ++LA  A
Sbjct: 178 LTEGILPEGETAELLERFLAAEDCGLWVADGQHYEGARWWGSNLERCRNLLARLELAASA 237

Query: 315 GFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA 370
                   LDF  G+++W+KP  L+ LR L L   +F+ E+   DG L HA+ER   
Sbjct: 238 DT------LDFPAGSIYWLKPAILDMLRGLALGFDDFDIEQGQTDGTLAHALERALG 288


>gi|126464825|ref|YP_001041801.1| lipopolysaccharide biosynthesis protein-like [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126106640|gb|ABN79165.1| Lipopolysaccharide biosynthesis protein-like [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 751

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 113/227 (49%), Gaps = 15/227 (6%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV---EANKDFEQDVLKYFPSAQLYV 205
           +  A+ VH YY D W E +  L RL   FDL+VT+    E      +++   FP A +  
Sbjct: 132 APYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVTLTYRGEETDALAEEIRADFPGAFVTP 191

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
           M N+GRD+ PF+ LL  G FD Y  +CK H KKS     H  +G +WR+ L   +L  + 
Sbjct: 192 MPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKSP----HRQDGDLWRKHLIEGILPETG 247

Query: 266 IAIRIINTFEQNPCLGM-IGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLD 324
           +  + +  F + P  G  +   ++    +W  +    E  R ++   +R   P  R  L 
Sbjct: 248 LEEK-LEAFVEAPEAGFWVADGQHYTGTQW--WGSNVEATRHLL---QRIEIPLDREALS 301

Query: 325 FFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA 370
           F  G+++WVKP  L  LR+L L + +F+ E    DG L HA+ER   
Sbjct: 302 FPAGSIYWVKPLVLGLLRSLQLRLEDFDIEEGQVDGTLAHAIERVLG 348


>gi|145588508|ref|YP_001155105.1| methyltransferase type 11 [Polynucleobacter necessarius subsp.
            asymbioticus QLW-P1DMWA-1]
 gi|145046914|gb|ABP33541.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
            asymbioticus QLW-P1DMWA-1]
          Length = 1082

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 75/229 (32%), Positives = 120/229 (52%), Gaps = 21/229 (9%)

Query: 148  KSKIAIVVHCYYQDTWIEISHILLRL--NFDFDLFVTVVEANKDFEQDVLKYFPSAQLYV 205
            ++ IAIVVH +Y DTW +I  I+ ++    D D+++T+   N +  Q +   FPSA + +
Sbjct: 856  ENSIAIVVHIHYMDTWEDIKKIIKKILSVHDSDIYITI--TNLEQYQSIKNDFPSANIEL 913

Query: 206  MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
            +EN+GRD+ PF+ +L+  +   Y  +CKIH KKS+       +G + R+ L+F L+    
Sbjct: 914  VENRGRDILPFINVLKKIIHKNYVAICKIHSKKSEYRS----DGEVIRKELYFSLINNEI 969

Query: 266  IAIRIINTFEQNPCLGMIGSRRY-RRYKRWSFFAKRSEVYR--RVIDLA-KRAGFPTKRL 321
               +I   FE N  LGM+   +Y  ++   + +  R  + +   VI +  K + FP    
Sbjct: 970  TLEKIPKFFEVNKKLGMLVPGKYFLQHNDINMYFNRENISKVCSVIGVNFKESKFPA--- 1026

Query: 322  HLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
                  G+MFW +P  L+ L  L     F+ E  L DG + HAVER F 
Sbjct: 1027 ------GSMFWARPAALQKLLKLESGELFDVEEGLADGTVAHAVERLFG 1069


>gi|289668432|ref|ZP_06489507.1| hypothetical protein XcampmN_08015 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 945

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 14/241 (5%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQ----DVLKYFPSAQ 202
           ++ K+ ++VH +Y D   E +  L ++   +DL V+V++   + +       L+      
Sbjct: 81  LQVKVGVMVHVFYPDLIDEFAQSLQQMPVGYDLLVSVMDNAAEAQARDRFSKLQQIEKLD 140

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           + ++ N+GRD+ P L      +    D +  +H KKS   G    E   WRR+L   L+G
Sbjct: 141 IRIVPNRGRDIAPLLVTFREQIL-ALDVVGHLHTKKSLYTGS---EQGQWRRYLVSSLMG 196

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVYRRVIDLAKRAGFP-TKR 320
            ++     +  F+  P LGM+    Y R   W+  +    EV R    LA+R GF     
Sbjct: 197 SAERIAWQLGMFQAEPRLGMLYPESYERVPLWAHTWLSNFEVCR---TLAQRLGFDINAS 253

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
            ++DF  G+MFW K   L PL  L+L + +F EE    DG L HA+ER F   VR+  + 
Sbjct: 254 EYIDFPAGSMFWAKVDALRPLYALNLELKDFPEEHGQIDGTLHHAMERMFVAVVRHQHYR 313

Query: 380 I 380
           I
Sbjct: 314 I 314


>gi|289662624|ref|ZP_06484205.1| hypothetical protein XcampvN_05932 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 945

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 14/241 (5%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQ----DVLKYFPSAQ 202
           ++ K+ ++VH +Y D   E +  L ++   +DL V+V++   + +       L+      
Sbjct: 81  LQLKVGVMVHVFYPDLIDEFAQSLQQMPVGYDLLVSVMDNAAEAQARDRFSKLQQIEKLD 140

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           + ++ N+GRD+ P L      +    D +  +H KKS   G    E   WRR+L   L+G
Sbjct: 141 IRIVPNRGRDIAPLLVTFREQIL-ALDVVGHLHTKKSLYTGS---EQGQWRRYLVSSLMG 196

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVYRRVIDLAKRAGFP-TKR 320
            ++     +  F+  P LGM+    Y R   W+  +    EV R    LA+R GF     
Sbjct: 197 SAERIAWQLGMFQAEPRLGMLYPESYERVPLWAHTWLSNFEVCR---TLAQRLGFDINAS 253

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
            ++DF  G+MFW K   L PL  L+L + +F EE    DG L HA+ER F   VR+  + 
Sbjct: 254 EYIDFPAGSMFWAKVDALRPLYALNLELKDFPEEHGQIDGTLHHAMERMFVAVVRHQHYR 313

Query: 380 I 380
           I
Sbjct: 314 I 314


>gi|312962408|ref|ZP_07776899.1| lipopolysaccharide biosynthesis protein-like protein [Pseudomonas
            fluorescens WH6]
 gi|311283335|gb|EFQ61925.1| lipopolysaccharide biosynthesis protein-like protein [Pseudomonas
            fluorescens WH6]
          Length = 1308

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 120/237 (50%), Gaps = 13/237 (5%)

Query: 148  KSKIAIVVHCYYQDTWIEISHILLRLN-FDFDLFVTVVEANKDFEQDVLKYFPSAQLYVM 206
            ++  A+V+H +Y D W +I   L      ++DL+VTV  ++      V + +P A + ++
Sbjct: 1084 QADYAVVLHLHYDDLWDDIKSYLDSFGQLEYDLYVTVTSSSAGVR--VAQEYPKAHIQLV 1141

Query: 207  ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            EN+GRDV PFL +L++     Y  +CKIH K+S     +  +G   R  L   LLG  + 
Sbjct: 1142 ENRGRDVLPFLKILQVIKDMGYVAVCKIHSKRS----LYRDDGDKIRGELIGSLLGSKET 1197

Query: 267  AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFF 326
             + +++ FE+   +G+I   +Y              +   V +L+ + GF     + +F 
Sbjct: 1198 ILSVVDRFERQKDIGVIVPVKYLIPHTDHNMTYCGAI---VTELSSKLGFNFS--YCEFI 1252

Query: 327  NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESV 383
             G+MFW +PK LE L ++     FE E  L DG + H +ER     V+   +++E++
Sbjct: 1253 AGSMFWFRPKALEALLSIDE-SSFEVEDGLADGTIAHGIERVLCNVVKKANYTVETI 1308


>gi|269219069|ref|ZP_06162923.1| glycosyl transferase, group 2 family [Actinomyces sp. oral taxon
           848 str. F0332]
 gi|269211216|gb|EEZ77556.1| glycosyl transferase, group 2 family [Actinomyces sp. oral taxon
           848 str. F0332]
          Length = 687

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 109/227 (48%), Gaps = 9/227 (3%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMEN 208
           S+IA+V+HC+Y D   E+   L  L  DFDLFVT            L+    + +  +EN
Sbjct: 75  SRIAVVIHCFYADLMPELFDRLRNLPTDFDLFVTNASGADVAVPKDLERMRHSVVVEVEN 134

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ-REGYHPIE--GIIWRRWLFFDLLGFSD 265
            GRD+ P + L+  G+ D YD + K+H KKS  RE +  ++  G  W+     DL+G  +
Sbjct: 135 HGRDIFPTVQLVNSGILDPYDLILKLHTKKSPWREEHADLDGSGAAWKDQFLSDLVGSRE 194

Query: 266 IAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDF 325
               I+N F  +P LG++ +      K   F+     +   V  L  R         L+F
Sbjct: 195 KVEEILNAFAADPTLGLVTAADSIVGK--EFWGGDQRI---VEQLMLRIEMSIDPDELEF 249

Query: 326 FNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFAC 371
            +G+M+W +   L+ LR  +L   +F+EE+   D    HA+ER    
Sbjct: 250 ASGSMYWTRAFVLQGLRAFNLTSADFDEEKGQVDATTAHAIERIVGI 296


>gi|148927812|ref|ZP_01811237.1| Lipopolysaccharide biosynthesis protein-like protein [candidate
           division TM7 genomosp. GTL1]
 gi|147886838|gb|EDK72383.1| Lipopolysaccharide biosynthesis protein-like protein [candidate
           division TM7 genomosp. GTL1]
          Length = 498

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 110/237 (46%), Gaps = 9/237 (3%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVME 207
           ++A+VVH +Y +   EI  ++  +   FDL +T     A  +          S  + + E
Sbjct: 240 RLAVVVHIFYPELANEIYDVIKNIVEPFDLIITTPHEGAVSELIDTFAPLASSVAIALSE 299

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N+GRDV PFL +   G+ +RYD + K+H KKS         G  W++ LF  L G S I 
Sbjct: 300 NRGRDVGPFLAVHRSGLLERYDAVLKLHSKKSTYSD----SGQQWQQSLFRQLCGNSQIV 355

Query: 268 IRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN 327
            R +         GM+G   Y       + A R  V++ +  L        + + L FF 
Sbjct: 356 RRSVALLRDGKT-GMVGPHDYYLTHPHYWGANRPAVHKLLQSLTATP-LKEEDVPLRFFA 413

Query: 328 GTMFWVKPKCLEPLRNL-HLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESV 383
           GTMFW  PK +  L ++   +  FE E   +DG L HA+ER F    +   +++ S+
Sbjct: 414 GTMFWFAPKAIVALHDIPEALLNFESENGKQDGTLAHALERLFGIVPQLGGYNVTSL 470


>gi|83950907|ref|ZP_00959640.1| hypothetical protein ISM_07395 [Roseovarius nubinhibens ISM]
 gi|83838806|gb|EAP78102.1| hypothetical protein ISM_07395 [Roseovarius nubinhibens ISM]
          Length = 752

 Score = 99.4 bits (246), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 107/227 (47%), Gaps = 19/227 (8%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV---EANKDFEQDVLKYFPSAQLY 204
           K++ A+  H YY D W E +     +    DL++T+    E  +    ++ + FP A + 
Sbjct: 130 KARFALHAHIYYPDLWPEFATRFDEIGDGIDLYITLTWRGEETRWLADEITERFPRAFVT 189

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
            + N+GRD+ PFL L   G FD YD LCKIH KKS     H  +G  WRR L   +L  +
Sbjct: 190 PVPNRGRDILPFLLLANAGAFDGYDALCKIHTKKSP----HRDDGDQWRRHLIDGVLPAT 245

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA--KRSEVYRRV-IDLAKRAGFPTKRL 321
            +  R+ +    +     +   +    + W      K + V RRV +D    A       
Sbjct: 246 GLQERLQHFLADDAAAFWVADGQAYAARDWWGINRDKTAAVLRRVELDPLLDA------- 298

Query: 322 HLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVER 367
            L F  G+++W+KP  L  ++ L L    FE E+   DG L HAVER
Sbjct: 299 -LRFPAGSIYWMKPLMLGMIKALDLDAPMFEPEKGQVDGTLAHAVER 344


>gi|325915787|ref|ZP_08178089.1| Putative glycosyltransferase [Xanthomonas vesicatoria ATCC 35937]
 gi|325538051|gb|EGD09745.1| Putative glycosyltransferase [Xanthomonas vesicatoria ATCC 35937]
          Length = 695

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 119/245 (48%), Gaps = 23/245 (9%)

Query: 150 KIAIVVHCYYQDTWIEI------SHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQL 203
           +  +VVH +Y D   EI      S  +LRL    DL + V +     +Q  ++    A++
Sbjct: 447 RACVVVHAWYLDVLDEILDALAPSVAMLRLIVTTDLTL-VGQVRGRLQQHGIE----AEV 501

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
              EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WRR +   LLG 
Sbjct: 502 EGFENRGRDILPFLHIANRLLDEGEQLVVKLHTKKST----HRHDGDAWRREMLAALLGG 557

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAKRAGFPTKRLH 322
             +   I+N F  +P LG+    ++       F    ++     +D LA R G  T   H
Sbjct: 558 GRVDA-IVNAFVADPQLGLAAPAQHLLAVT-DFIGGNADA----LDYLAVRTGTGTVTEH 611

Query: 323 LDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSIE 381
             F +G+MFW K   L PL + HL  G+FE E+   DG L HA+ERF   +V ++   I 
Sbjct: 612 DRFASGSMFWAKLDALRPLLDAHLQPGDFEGEQGQIDGTLAHAIERFLGHAVLHSGHRIA 671

Query: 382 SVDCV 386
           ++D +
Sbjct: 672 TIDGL 676


>gi|296135664|ref|YP_003642906.1| glycosyl transferase family 2 [Thiomonas intermedia K12]
 gi|295795786|gb|ADG30576.1| glycosyl transferase family 2 [Thiomonas intermedia K12]
          Length = 1414

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 85/255 (33%), Positives = 120/255 (47%), Gaps = 21/255 (8%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK 196
           PS    +G    +  A+++H YY D W E    L  L    D++V++ E  ++   D+++
Sbjct: 266 PSPVLHAGRPHGNGTAVLLHLYYPDLWPEFLAHLKTLPAPCDVYVSLSEGREELLTDIVR 325

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS----QREGYH-PI---- 247
             P A +    NKGRD+ P L LL L     Y  L  +HGKKS    + E  H P     
Sbjct: 326 DLPDAVVMRHPNKGRDIAPRLALLRLARAHNYKQLLFLHGKKSPHLKEVENIHIPFLQHK 385

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEV-YRR 306
           +G  WRR L   LL   D + + I  F Q P LG+IG   +       +   R +  + R
Sbjct: 386 DGDRWRRELLAALL---DASEKTIAAFAQQPKLGLIGPHGF-------WLGLRGDANFPR 435

Query: 307 VIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAV 365
           +   A+R G         +F G+MFW +P+ L+PL  L L   +FE+E    DG L H V
Sbjct: 436 LSAQAQRMGITPDPARHGYFAGSMFWCRPQALDPLLALDLKDADFEDETGQTDGTLAHVV 495

Query: 366 ERFFACSVRYTEFSI 380
           ER FA S     F I
Sbjct: 496 ERLFALSAEKAGFQI 510


>gi|325928558|ref|ZP_08189746.1| Lipopolysaccharide biosynthesis protein/putative glycosyl
           transferase [Xanthomonas perforans 91-118]
 gi|325541097|gb|EGD12651.1| Lipopolysaccharide biosynthesis protein/putative glycosyl
           transferase [Xanthomonas perforans 91-118]
          Length = 695

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 116/243 (47%), Gaps = 19/243 (7%)

Query: 148 KSKIAIVVHCYYQDTWIE----ISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQL 203
           +  + +V+H +Y D   E    I+H  L L       +T+VE      Q + +    AQ+
Sbjct: 445 QRDVCVVLHAWYLDVLDEALEAIAHCGLSLRLVITTDITMVE---QVRQRLQQRGVQAQV 501

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
              EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +F  LL  
Sbjct: 502 EGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRREMFSALLAP 557

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAKRAGFPTKRLH 322
             +   I+  F  +P LG+    ++       F    ++     +D LA R G      H
Sbjct: 558 QHVDA-IMRGFADDPLLGLAAPAQHL-LPVTDFIGGNADA----LDYLAVRTGTDAINEH 611

Query: 323 LDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSIE 381
             F +G+MFWVK + L PL + HL   EFE+E+   DG L HA+ERF A +V +    + 
Sbjct: 612 SMFASGSMFWVKLEALRPLLDAHLHPSEFEDEQGQIDGTLAHAIERFLAVAVGHCGHHVA 671

Query: 382 SVD 384
           +V+
Sbjct: 672 TVE 674


>gi|122879048|ref|YP_199439.6| hypothetical protein XOO0800 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 546

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 144/322 (44%), Gaps = 38/322 (11%)

Query: 74  RSFLAFSKYSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKEL 129
           R +L  +  ++L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+
Sbjct: 231 RDWLMLTVRNRLKNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEV 290

Query: 130 FEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VV 184
                       +SG   +    +V+H +Y D   E    L        L VT     V 
Sbjct: 291 V----------TRSG---QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVT 337

Query: 185 EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGY 244
           +  +  +Q  L+    AQ+   EN+GRD+ PFL +    + +    + K+H KKS     
Sbjct: 338 QVRQCLQQRGLQ----AQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST---- 389

Query: 245 HPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVY 304
           H  +G  WRR +   LL    +A  I+  F ++P LG++   ++       F    ++  
Sbjct: 390 HREDGDTWRRDMLSGLLAPQHVAA-IVRGFAEDPLLGLVAPAQHL-LPVTDFMGGNADA- 446

Query: 305 RRVID-LAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALE 362
              +D L  R G      H  F +G+MFWVK + L PL + HL   EFE E+   DG L 
Sbjct: 447 ---LDYLTVRTGTDAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLA 503

Query: 363 HAVERFFACSVRYTEFSIESVD 384
           HA+ERF A +V ++   + +++
Sbjct: 504 HAIERFLAVAVAHSGQRVATIE 525


>gi|166713445|ref|ZP_02244652.1| hypothetical protein Xoryp_18900 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 695

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 83/310 (26%), Positives = 138/310 (44%), Gaps = 36/310 (11%)

Query: 84  KLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPK 141
           K + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+            
Sbjct: 392 KNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEVV----------T 441

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VVEANKDFEQDVLK 196
           +SG   +    +V+H +Y D   E    L        L VT     V +  +  +Q  L+
Sbjct: 442 RSG---QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQRGLQ 498

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ+   EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +
Sbjct: 499 ----AQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDM 550

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAKRAG 315
              LL    +A  I+  F ++P LG++   ++       F    ++     +D L  R G
Sbjct: 551 LSGLLAPQHVAA-IVRGFAEDPLLGLVAPAQHL-LPVTDFIGGNADA----LDYLTVRTG 604

Query: 316 FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVR 374
                 H  F +G+MFWVK + L PL + HL   EFE E+   DG L HA+ERF A +V 
Sbjct: 605 TDAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVA 664

Query: 375 YTEFSIESVD 384
           ++   + +++
Sbjct: 665 HSGQRVATIE 674


>gi|84622385|ref|YP_449757.1| hypothetical protein XOO_0728 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578640|ref|YP_001915569.1| hypothetical protein PXO_03177 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84366325|dbj|BAE67483.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523092|gb|ACD61037.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 695

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 144/322 (44%), Gaps = 38/322 (11%)

Query: 74  RSFLAFSKYSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKEL 129
           R +L  +  ++L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+
Sbjct: 380 RDWLMLTVRNRLKNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEV 439

Query: 130 FEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VV 184
                       +SG   +    +V+H +Y D   E    L        L VT     V 
Sbjct: 440 V----------TRSG---QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVT 486

Query: 185 EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGY 244
           +  +  +Q  L+    AQ+   EN+GRD+ PFL +    + +    + K+H KKS     
Sbjct: 487 QVRQCLQQRGLQ----AQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST---- 538

Query: 245 HPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVY 304
           H  +G  WRR +   LL    +A  I+  F ++P LG++   ++       F    ++  
Sbjct: 539 HREDGDTWRRDMLSGLLAPQHVAA-IVRGFAEDPLLGLVAPAQHL-LPVTDFMGGNADA- 595

Query: 305 RRVID-LAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALE 362
              +D L  R G      H  F +G+MFWVK + L PL + HL   EFE E+   DG L 
Sbjct: 596 ---LDYLTVRTGTDAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLA 652

Query: 363 HAVERFFACSVRYTEFSIESVD 384
           HA+ERF A +V ++   + +++
Sbjct: 653 HAIERFLAVAVAHSGQRVATIE 674


>gi|58425017|gb|AAW74054.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 727

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 144/322 (44%), Gaps = 38/322 (11%)

Query: 74  RSFLAFSKYSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKEL 129
           R +L  +  ++L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+
Sbjct: 412 RDWLMLTVRNRLKNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEV 471

Query: 130 FEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VV 184
                       +SG   +    +V+H +Y D   E    L        L VT     V 
Sbjct: 472 V----------TRSG---QHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVT 518

Query: 185 EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGY 244
           +  +  +Q  L+    AQ+   EN+GRD+ PFL +    + +    + K+H KKS     
Sbjct: 519 QVRQCLQQRGLQ----AQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST---- 570

Query: 245 HPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVY 304
           H  +G  WRR +   LL    +A  I+  F ++P LG++   ++       F    ++  
Sbjct: 571 HREDGDTWRRDMLSGLLAPQHVAA-IVRGFAEDPLLGLVAPAQHL-LPVTDFMGGNADA- 627

Query: 305 RRVID-LAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALE 362
              +D L  R G      H  F +G+MFWVK + L PL + HL   EFE E+   DG L 
Sbjct: 628 ---LDYLTVRTGTDAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLA 684

Query: 363 HAVERFFACSVRYTEFSIESVD 384
           HA+ERF A +V ++   + +++
Sbjct: 685 HAIERFLAVAVAHSGQRVATIE 706


>gi|21109952|gb|AAM38419.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 296

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 107/235 (45%), Gaps = 13/235 (5%)

Query: 153 IVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSAQLYVMENKGR 211
           +V+H +Y D   E    +        L VT  +   +   Q + +    AQ+   EN+GR
Sbjct: 51  VVLHAWYLDVLDEALDAIADCGLSLRLVVTTDITMVEQVRQRLQQRGVQAQVDGFENRGR 110

Query: 212 DVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRII 271
           D+ PFL +    + +    + K+H KKS     H  +G  WRR +F  LL     A  I+
Sbjct: 111 DILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDAWRREMFSALL-TPQHADAIM 165

Query: 272 NTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMF 331
             F  +P LG+    ++       F    ++       LA R G      H  F +G+MF
Sbjct: 166 RGFTDDPLLGLAAPAQHL-LPVTDFIGGNADALDY---LAVRTGTDAIDEHSVFASGSMF 221

Query: 332 WVKPKCLEPL--RNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVD 384
           WVK + L PL   NLH   EFE E+   DG L HA+ERF A +V +    + ++D
Sbjct: 222 WVKLEALRPLLDANLH-PSEFENEQGQIDGTLAHAIERFLAVAVSHCGHHVATID 275


>gi|285019449|ref|YP_003377160.1| hypothetical protein XALc_2689 [Xanthomonas albilineans GPE PC73]
 gi|283474667|emb|CBA17166.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 686

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 110/235 (46%), Gaps = 16/235 (6%)

Query: 154 VVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK--YFPSAQLYVMENKGR 211
           +VH +Y +   E+ + L      + L VT         Q  L+   FP  ++ V+EN+GR
Sbjct: 442 IVHAWYPNVLPELLNPLAASALPWRLLVTTSPDQASAVQAQLRDCSFPY-EVMVLENRGR 500

Query: 212 DVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRII 271
           D+ PFL+  E  + D  D + K+H K+S     H   G  WR  L   L G +D A RI+
Sbjct: 501 DILPFLHAGERLLQDGVDVVLKLHTKRST----HLHNGDAWRSELLQRLAG-ADRAARIL 555

Query: 272 NTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAKRAGFPTKRL-HLDFFNGT 329
             F Q+P LG++    +       F+       R   D L +R G+    L    F +G+
Sbjct: 556 EAFAQDPMLGLVAPEGH-LLPLADFWGGN----RMAADYLLRRTGYTDVCLDEAHFISGS 610

Query: 330 MFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRYTEFSIESV 383
           MFWV+   L PL + HL   EFE E+   DG L HA ER  A   ++  + + + 
Sbjct: 611 MFWVRLHALRPLLDSHLCPSEFEPEQGQIDGTLAHAAERVTALLAQHRGYRVATA 665


>gi|258591058|emb|CBE67353.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 1460

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 71/245 (28%), Positives = 114/245 (46%), Gaps = 26/245 (10%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYFPSAQLYV 205
           I S+IA+  H YY D   E++  L  + F FDLFV+V  +  +D  +      P A+  +
Sbjct: 589 ISSRIAVHAHAYYPDLTKELASYLKNMPFAFDLFVSVSNDEARDVCRQAFAGLPQARRVI 648

Query: 206 ME---NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           ++   N+GRD+ P +     G    YDY+C +H KKS       ++G  W  +L   L+G
Sbjct: 649 VDVVANRGRDIAPMVCHFG-GRLATYDYICHLHTKKSMY-AQGKMDG--WLEYLLRQLMG 704

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRW-----SFFAKRSEVYRRVIDLAKRAGFP 317
             D   RI + F+ +P  G+I  + Y     W     S  A  +++ R++       G+ 
Sbjct: 705 SEDQVRRIFSMFQSDPRAGIIYPQNYEYLPYWGNTWLSNKALGAQMCRQMGITDVPEGY- 763

Query: 318 TKRLHLDFFNGTMFWVKPKCLEPLRNLH----LIGEFEEERNLKDGALEHAVERFFACSV 373
                 D+  G+MFW +    E +RNL      + +F EE    DG+L H +ER      
Sbjct: 764 -----FDYPAGSMFWARS---EAIRNLFSADIRLTDFPEEAGQTDGSLAHCIERLLVLVA 815

Query: 374 RYTEF 378
           R+  +
Sbjct: 816 RHAGY 820


>gi|315657309|ref|ZP_07910191.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|315491781|gb|EFU81390.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 680

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 110/241 (45%), Gaps = 16/241 (6%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN--KDFEQDVLKYFPSAQLYVM- 206
           ++A+V+H YY D   EI   L  +  +FD+F+T           Q + +  P  +  V+ 
Sbjct: 51  RLAVVMHVYYSDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHLVVV 110

Query: 207 --ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI---EGIIWRRWLFFDLL 261
             EN GRD+ P + L+  G  D Y  + K+H KKS     HP     G  W+      LL
Sbjct: 111 PVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRESHPDLEGSGAQWKDEFLDALL 170

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRL 321
           G  D   +I++ F  +P LG++ +       +  F+     +     +L +R     K  
Sbjct: 171 GSKDSVEKIMSAFGSDPWLGLVTAPGNIVGPQ--FWGGDQAL---TAELLRRLEMQLKPS 225

Query: 322 HLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
            L F  G+M+WV+   ++ LR+L L   +FE E    D    HA+ER  A  +  TE  +
Sbjct: 226 KLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALER--AIGILTTEAGL 283

Query: 381 E 381
           +
Sbjct: 284 K 284


>gi|315654770|ref|ZP_07907675.1| group 2 glycosyl transferase [Mobiluncus curtisii ATCC 51333]
 gi|315490731|gb|EFU80351.1| group 2 glycosyl transferase [Mobiluncus curtisii ATCC 51333]
          Length = 680

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 110/241 (45%), Gaps = 16/241 (6%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN--KDFEQDVLKYFPSAQLYVM- 206
           ++A+V+H YY D   EI   L  +  +FD+F+T           Q + +  P  +  V+ 
Sbjct: 51  RLAVVMHVYYPDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHLVVV 110

Query: 207 --ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI---EGIIWRRWLFFDLL 261
             EN GRD+ P + L+  G  D Y  + K+H KKS     HP     G  W+      LL
Sbjct: 111 PVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRESHPDLEGSGAQWKDEFLDALL 170

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRL 321
           G  D   +I++ F  +P LG++ +       +  F+     +     +L +R     K  
Sbjct: 171 GSKDSVEKIMSAFGSDPWLGLVTAPGNIVGPQ--FWGGDQAL---TAELLRRLEMQLKPS 225

Query: 322 HLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
            L F  G+M+WV+   ++ LR+L L   +FE E    D    HA+ER  A  +  TE  +
Sbjct: 226 KLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALER--AIGILTTEAGL 283

Query: 381 E 381
           +
Sbjct: 284 K 284


>gi|298346187|ref|YP_003718874.1| hypothetical protein HMPREF0573_11061 [Mobiluncus curtisii ATCC
           43063]
 gi|304390053|ref|ZP_07372007.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|298236248|gb|ADI67380.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 43063]
 gi|304326535|gb|EFL93779.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 680

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/241 (28%), Positives = 110/241 (45%), Gaps = 16/241 (6%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN--KDFEQDVLKYFPSAQLYVM- 206
           ++A+V+H YY D   EI   L  +  +FD+F+T           Q + +  P  +  V+ 
Sbjct: 51  RLAVVMHVYYPDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHLVVV 110

Query: 207 --ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI---EGIIWRRWLFFDLL 261
             EN GRD+ P + L+  G  D Y  + K+H KKS     HP     G  W+      LL
Sbjct: 111 PVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRENHPDLEGSGAQWKDEFLDALL 170

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRL 321
           G  D   +I++ F  +P LG++ +       +  F+     +     +L +R     K  
Sbjct: 171 GSKDSVEKIMSAFGADPWLGLVTAPGNIVGPQ--FWGGDQAL---TAELLRRLEMQLKPS 225

Query: 322 HLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
            L F  G+M+WV+   ++ LR+L L   +FE E    D    HA+ER  A  +  TE  +
Sbjct: 226 KLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALER--AIGILTTEAGL 283

Query: 381 E 381
           +
Sbjct: 284 K 284


>gi|323138318|ref|ZP_08073389.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
 gi|322396401|gb|EFX98931.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
          Length = 754

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 111/234 (47%), Gaps = 25/234 (10%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP--SA 201
           + +   +A +VH +Y D    I   L  +    DL+++   A K +    V++ +   S 
Sbjct: 365 INMDKPVAAIVHAFYPDLLEHILGYLENIPCAVDLYISTDSAEKAEIIGKVVRNWSKGST 424

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG---YHPIEGIIWRRWLFF 258
            + +MEN+GRD+ P +      VF ++D    +H K+S   G   YH      WR +L  
Sbjct: 425 DVRIMENRGRDIAPMIVGFR-DVFAKHDIFLHVHTKRSPHAGDLLYH------WRDYLLN 477

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRY---RRYKRWSFFAKRSEVYRRVIDLAKRAG 315
            L G  DIA  +++ F  +P +G++  + +   RR   W F       Y    +L  R G
Sbjct: 478 TLFGTGDIARSVLSLF-NDPKIGVVFPQHFFEVRRMLNWGF------DYDLARNLLARVG 530

Query: 316 FP-TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER 367
               K L L+F +G+MFW +   + PL +L L   +F EE    DG L HA+ER
Sbjct: 531 VQLNKDLVLEFPSGSMFWGRTDAIRPLLDLDLQFSDFPEEAGQIDGTLAHAIER 584


>gi|77748730|ref|NP_643883.2| hypothetical protein XAC3576 [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 546

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 109/236 (46%), Gaps = 15/236 (6%)

Query: 153 IVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSAQLYVMENKGR 211
           +V+H +Y D   E    +        L VT  +   +   Q + +    AQ+   EN+GR
Sbjct: 301 VVLHAWYLDVLDEALDAIADCGLSLRLVVTTDITMVEQVRQRLQQRGVQAQVDGFENRGR 360

Query: 212 DVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRII 271
           D+ PFL +    + +    + K+H KKS     H  +G  WRR +F  LL     A  I+
Sbjct: 361 DILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDAWRREMFSALL-TPQHADAIM 415

Query: 272 NTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAKRAGFPTKRLHLDFFNGTM 330
             F  +P LG+    ++       F    ++     +D LA R G      H  F +G+M
Sbjct: 416 RGFTDDPLLGLAAPAQHL-LPVTDFIGGNADA----LDYLAVRTGTDAIDEHSVFASGSM 470

Query: 331 FWVKPKCLEPL--RNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVD 384
           FWVK + L PL   NLH   EFE E+   DG L HA+ERF A +V +    + ++D
Sbjct: 471 FWVKLEALRPLLDANLH-PSEFENEQGQIDGTLAHAIERFLAVAVSHCGHHVATID 525


>gi|297538440|ref|YP_003674209.1| Rhamnan synthesis F [Methylotenera sp. 301]
 gi|297257787|gb|ADI29632.1| Rhamnan synthesis F [Methylotenera sp. 301]
          Length = 782

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 109/230 (47%), Gaps = 19/230 (8%)

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVME--- 207
           +A++ H +Y     +    L  + F+FD+++T     +D +  + K F   Q   +E   
Sbjct: 512 LAVICHLFYHQMCEDYKVYLSNIPFNFDIYITT--DTEDKKAYIEKSFSGWQRGKVEVRL 569

Query: 208 --NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N+GRD+ P L      ++  Y+Y+  IH K S     H      WR ++   LLG   
Sbjct: 570 AVNQGRDIAPKLIACR-DIYSAYEYILHIHSKNSPYSSIH----TGWRDYILDTLLGSQK 624

Query: 266 IAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFP-TKRLHLD 324
               I   F+ N  LG+I  + ++  K    + +  ++ ++   LA R GF  +++  +D
Sbjct: 625 TVSSIFEAFQLNSNLGIIAPQHFKALKLDIGWDRNFKIAKK---LAGRMGFDISRKAPID 681

Query: 325 FFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER--FFAC 371
           F +G+MFW +   L PL N  L + +F  E   KDG   H++ER  FF C
Sbjct: 682 FPSGSMFWARSAALLPLLNCSLSLQDFPREDGQKDGTTAHSIERLYFFIC 731


>gi|21111631|gb|AAM39945.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575237|gb|AAY50647.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 296

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 112/252 (44%), Gaps = 19/252 (7%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VVEANKDFEQD 193
           +P  +         +V+H +Y D   E+   ++       + +T     V+E  K  ++ 
Sbjct: 37  APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQRR 96

Query: 194 VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
            ++    A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR
Sbjct: 97  GIQ----AEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWR 148

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKR 313
             +   LLG   +   I+N F  +P  G+     +       F    ++       L  R
Sbjct: 149 GEMLTALLGPQRVDA-IVNAFSTDPLAGLAAPEDHL-LPVTEFIGGNADALDY---LTVR 203

Query: 314 AGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACS 372
            G      +  F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   +
Sbjct: 204 TGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGLA 263

Query: 373 VRYTEFSIESVD 384
           V ++   + +V+
Sbjct: 264 VTHSGHRVTTVE 275


>gi|188993121|ref|YP_001905131.1| conserved protein involved in carbohydrate biosynthesis
           [Xanthomonas campestris pv. campestris str. B100]
 gi|189030067|sp|B0RVK2|WXCX_XANCB RecName: Full=Uncharacterized protein wxcX
 gi|167734881|emb|CAP53093.1| conserved protein involved in carbohydrate biosynthesis
           [Xanthomonas campestris pv. campestris]
          Length = 695

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 115/253 (45%), Gaps = 21/253 (8%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VVEANKDFEQD 193
           +P  +         +V+H +Y D   E+   ++       + +T     V+E  K  ++ 
Sbjct: 436 APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQRR 495

Query: 194 VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
            ++    A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR
Sbjct: 496 GIQ----AEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWR 547

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAK 312
             +   LLG   +   I+N F  +P +G+     +       F    ++     +D L  
Sbjct: 548 GEMLTALLGPQRVDA-IVNAFSTDPLVGLAAPEDHL-LPVTEFIGGNADA----LDYLTV 601

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFAC 371
           R G      +  F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   
Sbjct: 602 RTGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGL 661

Query: 372 SVRYTEFSIESVD 384
           +V ++   + +V+
Sbjct: 662 AVTHSGHRVTTVE 674


>gi|77747764|ref|NP_636021.2| hypothetical protein XCC0629 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|77761299|ref|YP_244667.2| hypothetical protein XC_3605 [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 546

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 114/253 (45%), Gaps = 21/253 (8%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VVEANKDFEQD 193
           +P  +         +V+H +Y D   E+   ++       + +T     V+E  K  ++ 
Sbjct: 287 APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQRR 346

Query: 194 VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
            ++    A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR
Sbjct: 347 GIQ----AEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWR 398

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAK 312
             +   LLG   +   I+N F  +P  G+     +       F    ++     +D L  
Sbjct: 399 GEMLTALLGPQRVDA-IVNAFSTDPLAGLAAPEDHL-LPVTEFIGGNADA----LDYLTV 452

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFAC 371
           R G      +  F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   
Sbjct: 453 RTGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGL 512

Query: 372 SVRYTEFSIESVD 384
           +V ++   + +V+
Sbjct: 513 AVTHSGHRVTTVE 525


>gi|325921211|ref|ZP_08183074.1| lipopolysaccharide biosynthesis protein [Xanthomonas gardneri ATCC
           19865]
 gi|325548310|gb|EGD19301.1| lipopolysaccharide biosynthesis protein [Xanthomonas gardneri ATCC
           19865]
          Length = 706

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 117/251 (46%), Gaps = 31/251 (12%)

Query: 150 KIAIVVHCYYQDTWIE----ISH--ILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQL 203
           ++ +V+H +Y D   E    ++H  I  RL    DL + VVE     +Q  ++    A++
Sbjct: 440 RVCVVLHAWYLDVLDEMLDAVAHCAISPRLVITTDLTM-VVEVRHRVQQRGMQ----AEV 494

Query: 204 YVMENKGRDVRPFLY----LLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
              EN+GRD+ PFL+    LL+ GV      + K+H KKS     H  +G  WR  +   
Sbjct: 495 EGFENRGRDILPFLHVANRLLDEGVC----LVVKLHTKKST----HRSDGDTWRHEMLSA 546

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAKRAGFPT 318
           LL   + A  I+N F  +P LG+     +       F    ++     +D L  R G  T
Sbjct: 547 LLA-PERADAIVNAFSSDPLLGLAAPDGHL-LPVADFIGGNTDA----LDYLGARTGTET 600

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTE 377
                 F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   S   + 
Sbjct: 601 AIEQGMFASGSMFWARLEALRPLLDAHLHPSEFETEQGQIDGTLAHAIERFMGISAIQSG 660

Query: 378 FSIESVDCVAE 388
           + I ++    E
Sbjct: 661 YRIATIGQALE 671


>gi|221634514|ref|YP_002523202.1| hypothetical protein RSKD131_4489 [Rhodobacter sphaeroides KD131]
 gi|221163387|gb|ACM04349.1| Hypothetical Protein RSKD131_4489 [Rhodobacter sphaeroides KD131]
          Length = 1042

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 102/224 (45%), Gaps = 13/224 (5%)

Query: 152 AIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD-VLKYFPSAQLYVMENKG 210
           A ++H ++ D   +++  L  L+   D FVT+  + +  ++D V   FP A +  +EN+G
Sbjct: 8   AAIIHVWHLDVLDDLTEALEHLHGSADQFVTLPSSFRQEQRDRVTAAFPKATIVEVENRG 67

Query: 211 RDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRI 270
           +D+     L++     RYD++CKIH KK       P E   WRR L   +LG       I
Sbjct: 68  QDIGALFQLMQKVNLGRYDFICKIHTKKGPN---MPEE---WRRALLDGVLGSKRQVTHI 121

Query: 271 INTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG-FPTKRLHLDFFNGT 329
           + +F  +P + + G+R+   Y          +V     D A   G F  +     F  GT
Sbjct: 122 VESFRADPKVMLAGARQLFVYGPAYLEPNADKVAE---DYASLIGDFDVRSEDWGFIAGT 178

Query: 330 MFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
            FW++   L+ +    +  +F     + DGA  HA ER F   V
Sbjct: 179 CFWIRTSILQEMAACAV--DFLPADYVTDGAPAHAAERMFGLCV 220


>gi|189030068|sp|P0C7J1|WXCX_XANCP RecName: Full=Uncharacterized protein wxcX
          Length = 695

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/253 (25%), Positives = 114/253 (45%), Gaps = 21/253 (8%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VVEANKDFEQD 193
           +P  +         +V+H +Y D   E+   ++       + +T     V+E  K  ++ 
Sbjct: 436 APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQRR 495

Query: 194 VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
            ++    A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR
Sbjct: 496 GIQ----AEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWR 547

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID-LAK 312
             +   LLG   +   I+N F  +P  G+     +       F    ++     +D L  
Sbjct: 548 GEMLTALLGPQRVDA-IVNAFSTDPLAGLAAPEDHL-LPVTEFIGGNADA----LDYLTV 601

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFAC 371
           R G      +  F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   
Sbjct: 602 RTGSDAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGL 661

Query: 372 SVRYTEFSIESVD 384
           +V ++   + +V+
Sbjct: 662 AVTHSGHRVTTVE 674


>gi|209524107|ref|ZP_03272658.1| glycosyl transferase family 2 [Arthrospira maxima CS-328]
 gi|209495482|gb|EDZ95786.1| glycosyl transferase family 2 [Arthrospira maxima CS-328]
          Length = 2819

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 114/241 (47%), Gaps = 17/241 (7%)

Query: 150  KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL-KYFPSAQLYVMEN 208
            KIA+V+H YY +   E+   L  L+ D+DLFVT+ E   D     L KY  + Q+ +++N
Sbjct: 1738 KIAVVLHAYYPELLPELFSKLDNLS-DYDLFVTIPENVVDSVTSALDKYTKNYQVSIVKN 1796

Query: 209  KGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
             G D+ PFL ++ EL     Y Y+CKIH K+      HP  G +WR  L   +LG  +I 
Sbjct: 1797 IGYDILPFLEVISELDTLG-YKYVCKIHTKRD-----HPDFGSLWRECLLDAVLGDKNIT 1850

Query: 268  IRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLH-LDFF 326
             +II  F+ NP L ++G          + +    ++ + + D  +    P   +    FF
Sbjct: 1851 EQIITAFDNNPSLQIVGPALLYMSMLGTIYDGHEKMKKMIHDFME----PLNLIEDWGFF 1906

Query: 327  NGTMFWVKPKCLEPLRNLHLIGEFEEERN---LKDGALEHAVERFFACSVRYTEFSIESV 383
             G+MFW +   L+ + +  L+   + + +   L  G   H VER         E  +  V
Sbjct: 1907 GGSMFWSRITPLKYIADQILLKPIDWQASKSWLTTGFYYHIVERLLGLVSYINEGQVGLV 1966

Query: 384  D 384
            D
Sbjct: 1967 D 1967


>gi|220924211|ref|YP_002499513.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium nodulans ORS 2060]
 gi|219948818|gb|ACL59210.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium nodulans ORS 2060]
          Length = 1366

 Score = 86.3 bits (212), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 113/237 (47%), Gaps = 18/237 (7%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDV--- 194
           SS    GL +  ++A++ H +Y D   E+S  L R+    DLF++     +D  Q +   
Sbjct: 690 SSIGDVGLELPERVAVIAHVFYTDFCSELSAYLARIPTQADLFIST--DTEDKRQQIAFA 747

Query: 195 LKYFPSAQLY--VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIW 252
           L+ +   +L   VM N GRD+ P L   +  VF+ Y+Y   IH KKS  +   P  G  W
Sbjct: 748 LQSYNMGKLTVRVMPNIGRDIAPMLVGFD-DVFNSYEYFLHIHSKKSPHD---PAFG-SW 802

Query: 253 RRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAK 312
           R +L  +LLG  DI IR I         G++ S+ +   +    F    E  +    L  
Sbjct: 803 REFLLENLLGSEDI-IRSILYLLHAHKTGIVFSQHFEPVRHLLNFGYNFETMK---GLLG 858

Query: 313 RAGFP-TKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVER 367
           R G   +  L L+F + + FW +   L+PL +L+L   +F  E    DG L HA+ER
Sbjct: 859 RCGIKISNDLVLEFPSSSFFWGRSSALKPLLDLNLDWSDFAAEAGQIDGTLAHAIER 915


>gi|310816773|ref|YP_003964737.1| lipopolysaccharide biosynthesis protein-like protein
           [Ketogulonicigenium vulgare Y25]
 gi|308755508|gb|ADO43437.1| lipopolysaccharide biosynthesis protein-like protein
           [Ketogulonicigenium vulgare Y25]
          Length = 726

 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 108/245 (44%), Gaps = 26/245 (10%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFP 199
           P++        I + +H YYQ+     +  L ++     L+V+   A K  +  + +  P
Sbjct: 456 PRREAPAPARPIGVFLHLYYQELAPVFAKRLAQIPLPLSLYVSTDTAEKAAQ--IERALP 513

Query: 200 SAQLYVMENKGRDVRPFLYLLELGVFDRY---DYLCKIHGKKSQREGYHPIEGIIWRRWL 256
            AQ+ V+ N+GRD+ P LY    G  D Y   D +  +HGKKS       +   +   WL
Sbjct: 514 QAQVRVLPNRGRDIFPKLY----GFGDAYADHDIVLHLHGKKS-------LHSSMLDEWL 562

Query: 257 --FFD-LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKR 313
               D LLG      RI++ F+  P LG++    +R     + +    ++     +LA R
Sbjct: 563 SHILDCLLGDPADVNRILSLFDSVPRLGIVMPVVHRSVLNAAHWGFNRDIG---AELAYR 619

Query: 314 AGFPT---KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
            G  T   +   L F  G+MFW +   L+P+ +L L    F  E    DG L HAVER  
Sbjct: 620 MGMATPLPENDALQFPAGSMFWARTAALQPILDLALEASHFPPEAGQVDGTLAHAVERML 679

Query: 370 ACSVR 374
               R
Sbjct: 680 GVVCR 684


>gi|269978088|ref|ZP_06185038.1| lipopolysaccharide biosynthesis protein [Mobiluncus mulieris 28-1]
 gi|306818459|ref|ZP_07452182.1| rhamnan synthesis protein F [Mobiluncus mulieris ATCC 35239]
 gi|307700705|ref|ZP_07637730.1| rhamnan synthesis protein F [Mobiluncus mulieris FB024-16]
 gi|269933597|gb|EEZ90181.1| lipopolysaccharide biosynthesis protein [Mobiluncus mulieris 28-1]
 gi|304648632|gb|EFM45934.1| rhamnan synthesis protein F [Mobiluncus mulieris ATCC 35239]
 gi|307613700|gb|EFN92944.1| rhamnan synthesis protein F [Mobiluncus mulieris FB024-16]
          Length = 613

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 114/242 (47%), Gaps = 30/242 (12%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
           K +IA V H +Y D   EI      L     +F+T     K    EQ +      A++ +
Sbjct: 295 KLRIAGVAHVFYADMTAEIMKRFSYLGDHAQIFLTTSTPEKKTQIEQQLQTMGRQAEVRI 354

Query: 206 ME-NKGRDVRPFLY----LLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           +E N+GRDV  FL     +LE G   R+D + KIH KKS ++ Y+  E  +++R LF +L
Sbjct: 355 VESNRGRDVSAFLVTCADVLEPG---RFDVVAKIHSKKSAQDAYNAAE--LFKRHLFENL 409

Query: 261 LGFSDIAIRIINTFEQNPCLGMI----GSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
           L        +++ F   P LGM+     S  Y      ++FA +    +  + L +R G 
Sbjct: 410 LPSPGYTANLLHLFATEPYLGMVFPPAVSLGYPTLGH-AWFANK----KPALALCERLGI 464

Query: 317 PTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFA 370
              +L  D        G+MF+ +P+ L PL   H    +F EE    DG+L H +ER F+
Sbjct: 465 ---KLPFDDTTPLSPYGSMFFARPEALLPLTKAHFTFNDFPEEGQYSDGSLAHVIERIFS 521

Query: 371 CS 372
            S
Sbjct: 522 YS 523


>gi|32455988|ref|NP_861990.1| rb115 [Ruegeria sp. PR1b]
 gi|22726340|gb|AAN05136.1| RB115 [Ruegeria sp. PR1b]
          Length = 963

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 123/279 (44%), Gaps = 29/279 (10%)

Query: 107 LNRF-MSNSRMPFDSEKFLY--VKELFEGWNDR-PSSPKKSGLTIKSKIAIVVHCYYQDT 162
           L RF  +  R P ++    Y  V+ +    +DR P  PK        ++ + +H YY D 
Sbjct: 116 LRRFGCARQRGPLETTPVEYGPVRHVLRFESDRQPPLPK-------GRLVVQLHLYYVDM 168

Query: 163 WIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA-------QLYVMENKGRDVRP 215
             E+  +L RL   F+L +++ E     +++++  F +         L  + N+GRDV P
Sbjct: 169 AAEMIALLARLPVTFELLLSLPETAVVADEEMISLFRAGLERLGAITLRRVPNRGRDVAP 228

Query: 216 FL--YLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINT 273
           ++  +  EL      D +  +H KKS    YH    + W R+L   LLG + +A +++  
Sbjct: 229 WMVSFRSELRALADRDLVLHLHSKKSPHGNYH----VGWGRYLGHSLLGSTAVAAQMLGL 284

Query: 274 FEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFP-TKRLHLDFFNGTMFW 332
           F ++P LG++    +   +R   + K  ++      L +R G      +  DF  G+ F 
Sbjct: 285 FAEDPELGLVAPAYWPALRRAPNYGKVGDL---CAHLFRRMGLGEVDPICADFPAGSFFC 341

Query: 333 VKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFA 370
            +   L P   L L   +F  E     G L HAVER   
Sbjct: 342 ARAAVLRPFLTLGLEARDFPAEAGQICGTLAHAVERLLG 380


>gi|158422520|ref|YP_001523812.1| putative lipopolysaccharide biosynthesis protein [Azorhizobium
           caulinodans ORS 571]
 gi|158329409|dbj|BAF86894.1| putative lipopolysaccharide biosynthesis protein [Azorhizobium
           caulinodans ORS 571]
          Length = 661

 Score = 84.0 bits (206), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 118/257 (45%), Gaps = 12/257 (4%)

Query: 136 RPSSPKKSGLTIKS-KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDV 194
           RP++   +   +++  +A VVH YY+D    +  ++  L+       T  E  +     +
Sbjct: 384 RPAAAPVTPRPVRTGSLASVVHGYYEDL---LPGLIAGLDPAHLFVTTPPEKAEAVRAVL 440

Query: 195 LKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRR 254
            +  P+A+L V+EN+GRDVRPFL LL     + YD + K+H K+S  +G    EG  W +
Sbjct: 441 ARAAPAARLRVVENRGRDVRPFLSLLPELEAEGYDLVLKVHTKRSPHQGK---EGSDWLQ 497

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
            L   LL  +  + R+   FE +P +G++G+  +         +  +  + R +      
Sbjct: 498 RLSGPLLKLAR-SERLAPVFEAHPQMGLLGAAGHVLDGALYAGSAGNAAWMRRLAAELGT 556

Query: 315 GFPTKRLHLDFFNGTMFWVKPKCLEPLRNL-HLIGEFEEERNLKDGALEHAVERFFACSV 373
           G P   L   +  GTMF  +     PLR    L+  F+ +  LKDG L HA ERFF    
Sbjct: 557 GAP---LTSPYVAGTMFVARLGIFAPLRGASELLDLFDTDMGLKDGTLAHAFERFFGVLA 613

Query: 374 RYTEFSIESVDCVAEYE 390
                S+  V      E
Sbjct: 614 AEAGLSVGEVAADGHVE 630


>gi|134297301|ref|YP_001121036.1| lipopolysaccharide biosynthesis protein-like protein [Burkholderia
            vietnamiensis G4]
 gi|134140458|gb|ABO56201.1| Lipopolysaccharide biosynthesis protein-like protein [Burkholderia
            vietnamiensis G4]
          Length = 1231

 Score = 84.0 bits (206), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 115/243 (47%), Gaps = 12/243 (4%)

Query: 148  KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSAQLYVM 206
            K++ A+V H YY D   E+  ++ R N + D F+T+ V  +++   ++L    +  +  +
Sbjct: 994  KNENALVAHLYYFDLLPELLSLIER-NVNLDAFITIPVHFSREQVGEILASLDNVYVLRV 1052

Query: 207  ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            +N+GRD+ PFL +  +     Y  L K+H KKS +      +G + R+    +LL  S I
Sbjct: 1053 QNRGRDILPFLNIYPIIKSYSYANLVKVHSKKSPQRA----DGALLRKRALLELLDPS-I 1107

Query: 267  AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLA-KRAGFPTKRLHLDF 325
               ++     +P +G+I           S +   +   R+ ++    R G     L+ +F
Sbjct: 1108 VPGVLRALNTDPKIGLIAPSNSLCSLSNSDYLINN---RKQLNYCLSRLGLVDSSLNFEF 1164

Query: 326  FNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESVD 384
              G+MFW +   L  L +L L  E FEEE    DG L HA+ER F    ++  +    VD
Sbjct: 1165 IAGSMFWARVDALRMLSDLSLREEDFEEELGQLDGTLAHAIERLFCFLGKHVGYRTLPVD 1224

Query: 385  CVA 387
             + 
Sbjct: 1225 QIG 1227


>gi|227875198|ref|ZP_03993340.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Mobiluncus mulieris
           ATCC 35243]
 gi|227844103|gb|EEJ54270.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Mobiluncus mulieris
           ATCC 35243]
          Length = 613

 Score = 84.0 bits (206), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 113/242 (46%), Gaps = 30/242 (12%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
           K +IA V H +Y D   EI      L     +F+T     K    EQ +      A++ +
Sbjct: 295 KLRIAGVAHVFYADMTAEIMKRFSYLGDHAQIFLTTSTPEKKTQIEQQLQTMGRQAEVRI 354

Query: 206 ME-NKGRDVRPFLY----LLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           +E N+GRDV  FL     +LE G FD    + KIH KKS ++ Y+  E  +++R LF +L
Sbjct: 355 VESNRGRDVSAFLVTCADVLEPGCFD---VVAKIHSKKSAQDAYNAAE--LFKRHLFENL 409

Query: 261 LGFSDIAIRIINTFEQNPCLGMI----GSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
           L        +++ F   P LGM+     S  Y      ++FA +    +  + L +R G 
Sbjct: 410 LPSPGYTANLLHLFATEPYLGMVFPPAVSLGYPTLGH-AWFANK----KPALALCERLGI 464

Query: 317 PTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFA 370
              +L  D        G+MF+ +P+ L PL   H    +F EE    DG+L H +ER F+
Sbjct: 465 ---KLPFDDTTPLSPYGSMFFARPEALLPLTKAHFTFNDFPEEGQYSDGSLAHVIERIFS 521

Query: 371 CS 372
            S
Sbjct: 522 YS 523


>gi|163853098|ref|YP_001641141.1| lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium extorquens PA1]
 gi|163664703|gb|ABY32070.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium extorquens PA1]
          Length = 916

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 115/232 (49%), Gaps = 27/232 (11%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQ--DVLKYFPSAQLYV-- 205
           K A +VH +Y +   EI   L + NF  D++V+  ++ K  EQ   + K + + QL V  
Sbjct: 250 KAAAIVHGFYPELMEEILIYLGKSNFPIDIYVSTDDSKKA-EQIISMGKKYHNGQLDVRI 308

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGI-IWRRWLFFDLLGFS 264
           + N+GRD+ P L      VFD Y+    IH KKS   G    +G+  WR +LF +L+G +
Sbjct: 309 ISNRGRDIGPMLTGFS-DVFDNYEAFLHIHTKKSPHGG----DGLSSWRDYLFKNLIGSA 363

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEV-----YRRVIDLAKRAGFP-T 318
           +I          +  L ++G+R          +A R  +     +  V  L +R G   +
Sbjct: 364 EII---------DSNLHILGTRNVGFVYPQHLYALRGILNWGYNFDTVSSLLRRVGVRLS 414

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
           K + L+F +G+MFW +   L  L +L L + +F+ E    DG L HA+ER F
Sbjct: 415 KDMVLEFPSGSMFWARTAALHGLLSLDLKLEDFDNEAGQVDGTLGHAIERSF 466


>gi|302337197|ref|YP_003802403.1| glycosyl transferase family 2 [Spirochaeta smaragdinae DSM 11293]
 gi|301634382|gb|ADK79809.1| glycosyl transferase family 2 [Spirochaeta smaragdinae DSM 11293]
          Length = 1100

 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 98/226 (43%), Gaps = 20/226 (8%)

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSAQLYVMENK 209
           I +V H Y++D        +  + + FDL VT  +E N D    V   +P A++   +N 
Sbjct: 187 IVVVFHIYHEDLVGSCLQYISHIPYPFDLIVTTPLEENNDAILQVKSLYPDAEIVRSKNA 246

Query: 210 GRDVRPFLYLLELGVFDR---YDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
           GRD+ PF     L V+DR   YD  CK+H KK     Y      IWR      +L   D 
Sbjct: 247 GRDIGPF-----LQVWDRVLQYDLCCKVHTKKGN-SAYSE----IWRDLSLRGILETVDT 296

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLD-F 325
              I+  FEQ   L + G+     Y  + F   +++       L K    P      + F
Sbjct: 297 VHGILRMFEQEDSLALAGAELL--YGSYQFLLGKNKDLSN--SLIKDYNIPVNSYSNNGF 352

Query: 326 FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFAC 371
           F GTMFW++ K    L NL  + +F  E    DG  EHA+ER    
Sbjct: 353 FMGTMFWMRVKKFIFLSNLKQL-QFPIEDGKNDGKYEHALERLLGS 397


>gi|13476280|ref|NP_107850.1| hypothetical protein mlr7559 [Mesorhizobium loti MAFF303099]
 gi|14027041|dbj|BAB53995.1| mlr7559 [Mesorhizobium loti MAFF303099]
          Length = 644

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 112/252 (44%), Gaps = 14/252 (5%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLKYFPSAQLYVM- 206
            KIA+  H YY D   EI  +   +   +D   T     K  E +  L   P  +  ++ 
Sbjct: 297 GKIAVCAHIYYTDMLDEILGLTGNIPVPYDFIATTNTPEKKAEIETALANRPGVKNVIVR 356

Query: 207 ---ENKGRDVRP-FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
              +N+GRD+   F+ L +L V DRYD +C++H KKS +       G +++R +  +LL 
Sbjct: 357 VVEQNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQ--VQSSMGNLFKRHMVDNLLN 414

Query: 263 FSDIAIRIINTFEQNPCLGM-IGSRRYRRYKRWSF--FAKRSEVYRRVIDLAKRAGFPTK 319
                  +++ F  NP +G+ I    +  Y    F  FA + +V      L     F   
Sbjct: 415 SRGYVHNVLDMFHDNPSVGLAIPPIFHISYPTMGFSWFANKPKVEETARLLNINVKFDEN 474

Query: 320 RLHLDFFNGTMFWVKPKCLEPL-RNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
                +  GTMFW +P+ L  +  +     EF  E +  DG   HA+ER  A +V+   +
Sbjct: 475 TPVAAY--GTMFWFRPRALRKMFEHKWKWEEFNAEPDHVDGGFAHALERLIAYAVQNAGY 532

Query: 379 SIESVDCVAEYE 390
           + + + C  + E
Sbjct: 533 TTQHIMCAHQAE 544


>gi|317047360|ref|YP_004115008.1| family 2 glycosyl transferase [Pantoea sp. At-9b]
 gi|316948977|gb|ADU68452.1| glycosyl transferase family 2 [Pantoea sp. At-9b]
          Length = 1419

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 109/252 (43%), Gaps = 22/252 (8%)

Query: 132 GWNDRP---SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK 188
           G   RP    +P +        I + +H YY D   E    L  +   FDLF+++     
Sbjct: 577 GAKGRPLLIDAPVQLNEGFARTIGVHLHLYYVDLADEFIKHLNTIPTGFDLFISLPRGKH 636

Query: 189 DFEQ------DVLKYFPSAQLYVMENKGRDVRPFLYLLELGV-FDRYDYLCKIHGKKSQR 241
           + E+        +K      +   ENKGRD+ PF+  +E G     Y+ +  IH KKS +
Sbjct: 637 NVEECERKFRSGIKTLKKLVVRETENKGRDIYPFI--VEFGAELLSYELILHIHSKKSPQ 694

Query: 242 EGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRS 301
                     WRR+L    LG   I  +I+N+F+ +P LG++    +    R   +    
Sbjct: 695 ALSKG-----WRRFLLHYTLGTESITTQILNSFDNDPKLGVLFPAYFYGVTRQPNWGGNR 749

Query: 302 EVYRRVIDLAKRAGFPTKRLHL-DFFNGTMFWVKPKCLEPLRN-LHLIGEFEEERNLKDG 359
           E+ ++ +    R GF     +  D+  G+ FW +   L PL N  + + +F+EE    DG
Sbjct: 750 EIVKQQL---ARLGFSYDMTYCPDYPAGSFFWSRSDALRPLLNGEYRLEDFDEEAGQYDG 806

Query: 360 ALEHAVERFFAC 371
            L H  ER F  
Sbjct: 807 TLAHGFERLFGT 818


>gi|148556902|ref|YP_001264484.1| glycosyl transferase family protein [Sphingomonas wittichii RW1]
 gi|148502092|gb|ABQ70346.1| glycosyl transferase, family 2 [Sphingomonas wittichii RW1]
          Length = 1301

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 104/223 (46%), Gaps = 12/223 (5%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFP-SAQLYVMEN 208
           K A+V+H +Y +  +E+   +  +    D+FVT   A  +     L   P  A++  + N
Sbjct: 2   KAALVLHLFYPEVAVELIDRVAAIGASVDIFVTHSVALDETVLAALDRLPRKAEVVTVAN 61

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAI 268
           +G D+ P   LL L     YD + K+H KK    GY P     WRR  +  ++G   +  
Sbjct: 62  RGWDIGPLFELLPLLAERGYDLIGKLHSKKGG-SGYAP----EWRRLAYDGMIGSPALVA 116

Query: 269 RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT-KRLHLDFFN 327
            I+  F+ +P L ++G++   +      F + +E+   + DLA R   P        FF 
Sbjct: 117 DIVAAFDAHPDLSLLGAKPLYKSVASHLF-RNAEL---LSDLAPRLTAPAYPPADWGFFA 172

Query: 328 GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           GT FW +   LE +  L    +    ++ +DGAL HAVER F 
Sbjct: 173 GTFFWARRTLLEKVAALADFRDAAPNQD-RDGALGHAVERLFG 214


>gi|325928537|ref|ZP_08189725.1| Lipopolysaccharide biosynthesis protein [Xanthomonas perforans
            91-118]
 gi|325541076|gb|EGD12630.1| Lipopolysaccharide biosynthesis protein [Xanthomonas perforans
            91-118]
          Length = 1415

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 118/260 (45%), Gaps = 38/260 (14%)

Query: 136  RPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL 195
            RP  P+        ++A+V+H +Y +   E+   L   +  + L ++ V    D   +V 
Sbjct: 1159 RPVMPR-----TPERVAVVIHAFYPEILPEMLKELQSWDVPYFLIISTVADKAD---EVR 1210

Query: 196  KYFPS----AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGII 251
             Y       A + V EN+GRD+ PFL +++  +  R   + K+H K+S     H  +G  
Sbjct: 1211 GYLADLSVVADVRVFENRGRDILPFLEIMK-DLRGRESLVLKLHTKRS----LHRQDGES 1265

Query: 252  WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLA 311
            WRR +   LL    +A  I   F +   LG+     +       + A    V+R      
Sbjct: 1266 WRRDMLEKLLA-PKVASEIFAAFREQERLGLAAPEGHILSMTTYWGANADTVHRL----- 1319

Query: 312  KRAGFPTKRLHLDFFN--------GTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALE 362
                  +K++H+D  N        G+MF+V+P+ ++ + +L L  E FE E    DG L 
Sbjct: 1320 ------SKQMHVDPVNPVTAMFAAGSMFYVRPEAIDSIMDLDLRREDFEPEAGQVDGTLA 1373

Query: 363  HAVERFFACSVRYTEFSIES 382
            HA+ER F+ +V  T + I S
Sbjct: 1374 HAIERCFSLAVCSTGYYIAS 1393


>gi|325276923|ref|ZP_08142610.1| hypothetical protein G1E_25356 [Pseudomonas sp. TJI-51]
 gi|324097938|gb|EGB96097.1| hypothetical protein G1E_25356 [Pseudomonas sp. TJI-51]
          Length = 758

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 99/239 (41%), Gaps = 19/239 (7%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF 198
           +PK S      KIAI +H YY D     +  L     + DL +T+  AN+ F     + F
Sbjct: 243 TPKASN----QKIAICLHIYYDDYIERFAEALYTFPTEVDLLITI--ANESFRDRAYQTF 296

Query: 199 PSAQ------LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIW 252
              Q      +  + N+GR+  P L      +   YD LC +H KKS   G    E   W
Sbjct: 297 SKIQAVKKVTIKSVPNRGRNFGPLLVEFAQELL-TYDLLCHLHSKKSLYSGR---EQTQW 352

Query: 253 RRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAK 312
             +L   LL    +  R++N F  NP  G+     +     W      ++ + R  +L  
Sbjct: 353 ADYLSEYLLNDCSVVKRVLNAFSDNPQFGVYYPTTFWMMPSWVNHVTMNKPHMR--NLQT 410

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCL-EPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
             GF      L +  G MFW +PK L + L   +   +F  E    DG++ HA+ER   
Sbjct: 411 ALGFGHFDDFLSYPAGGMFWARPKALVDILNKTYTYDDFPNEPLPNDGSMLHALERVIG 469


>gi|310829395|ref|YP_003961752.1| hypothetical protein ELI_3842 [Eubacterium limosum KIST612]
 gi|308741129|gb|ADO38789.1| hypothetical protein ELI_3842 [Eubacterium limosum KIST612]
          Length = 627

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 110/243 (45%), Gaps = 12/243 (4%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSAQL 203
           +  + +IA + H Y++D   E    L  +  + D+++T   E  K   Q+  K F     
Sbjct: 307 ILCEKRIAAIFHLYFEDLIDETYRYLSSMPEEADIYITTDTEPKKKLIQEKFKDFSCRNF 366

Query: 204 YVM--ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            V+  +N+GRDV   L   +  + + YDY+C  H KK  +   + I G    +  F + L
Sbjct: 367 KVILIQNRGRDVSALLVATKAFIMN-YDYVCFAHDKKVTQTKPYSIGGAFAYK-CFENTL 424

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK----RSEVYRRVID-LAKRAGF 316
              +  + IIN FE+NP LGM+          +           EV + +ID L  +   
Sbjct: 425 QNKNFVLNIINAFEKNPRLGMLMPAPPNNGPYYPTLGNEWMCNYEVTKNLIDELGIKVPM 484

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRY 375
              +  +    GTMFW +PK L+ L + +    +F EE N  DG L HA+ER +   V+ 
Sbjct: 485 DPGKEPISPL-GTMFWFRPKALKVLFDKNWEYSDFPEEPNKVDGTLLHAIERAYGLIVQS 543

Query: 376 TEF 378
             F
Sbjct: 544 EGF 546


>gi|225350704|ref|YP_002720664.1| putative glycosyl transferase, group 1 [Brachyspira hyodysenteriae
           WA1]
 gi|225216388|gb|ACN85121.1| putative glycosyl transferase, group 1 [Brachyspira hyodysenteriae
           WA1]
          Length = 342

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 106/229 (46%), Gaps = 12/229 (5%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYFP---SAQL 203
           K KI I +H YY D        L     +FDLF+T   E NKD   +     P   +  +
Sbjct: 24  KLKIGIHIHLYYIDMMDMFIKYLKDSPIEFDLFITTSKEENKDICLNAFNKLPKLKNITI 83

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
           +++EN GRD+ P+L      + + YD  C +H KKS    +  I    W  +L  +L+  
Sbjct: 84  FIVENIGRDIAPWLIECN-NIQNNYDLFCHLHTKKSLH--WESINE--WGEYLIENLISE 138

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAK-RAGFPTKRLH 322
             I   I++ F  +  +G+I    Y     +  +  + +++   + L K    F  K  +
Sbjct: 139 EAIN-NILSNFILDNNIGIISPHIYYYLFPYILYIDKDDMHHIKLLLNKLNINFEPKPEN 197

Query: 323 LDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA 370
             F  G+M W +PK L+PL +L+L   +F +E   K G + HA+ER   
Sbjct: 198 FVFPVGSMLWYRPKVLKPLFDLNLKYSDFPQEPIPKTGTIAHAIERIIG 246


>gi|331086190|ref|ZP_08335272.1| hypothetical protein HMPREF0987_01575 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406349|gb|EGG85863.1| hypothetical protein HMPREF0987_01575 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 592

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 110/243 (45%), Gaps = 22/243 (9%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSAQLY 204
           T ++KIA+V+H Y++D   E  H +  +    D+++T   E  K   + V    P  +L 
Sbjct: 253 TTENKIALVMHLYFEDLLEESYHYVSAMPEKADIYLTTDTEKKKAAIEKVFAKLPCNKLE 312

Query: 205 --VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
             V++N+GRDV   L  ++  + D YD +C  H KK+ +     I G  +    F + L 
Sbjct: 313 VRVIKNRGRDVSSLLVGVKDVIMD-YDLVCFAHDKKTAQVKPGTI-GASFAYKCFENTLS 370

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA-KRSEVYRRVIDLAKRAGF----- 316
                  +INTF  NP +G++          ++    +    +    DLAK+ G      
Sbjct: 371 NKAYVGNVINTFVNNPRMGLLCPPEPNHSTFFTTIGFEWGPNFNITRDLAKKLGLTVPIS 430

Query: 317 ----PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFAC 371
               P   L      GTMFW +PK ++PL N     E F  E N  DG L HA+ER +  
Sbjct: 431 VASPPVAPL------GTMFWFRPKAMKPLYNKDWKYEDFPAEPNKIDGTLLHAIERIYPF 484

Query: 372 SVR 374
            V+
Sbjct: 485 IVQ 487


>gi|293189412|ref|ZP_06608132.1| rhamnan synthesis protein F [Actinomyces odontolyticus F0309]
 gi|292821502|gb|EFF80441.1| rhamnan synthesis protein F [Actinomyces odontolyticus F0309]
          Length = 620

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 114/252 (45%), Gaps = 26/252 (10%)

Query: 139 SPKKSGLTIKS----KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDF-EQ 192
           SP+    T+ +    K+  V H +Y D   EI   L  L   + L  T   E NK   E 
Sbjct: 283 SPRADQATLDAAASLKVLAVAHIFYADMADEILDRLSVLPAGYHLVATTSNEENKALIEA 342

Query: 193 DVLKYFPSAQLYVME-NKGRDVRPFLY----LLELGVFDRYDYLCKIHGKKSQREGYHPI 247
              +    A + V+  N+GRD+  FL     +L  G    YD + KIH KKS ++ Y+  
Sbjct: 343 HAQERGVDADVRVVSSNRGRDIGAFLVDCNDVLTSG---EYDIVVKIHSKKSVQDDYNAA 399

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGM-IGSRRYRRYKRW--SFFAKRSEVY 304
           +  +++  L+ +LL  SD    I+  F  +P LGM I    +  Y     ++FA R+   
Sbjct: 400 Q--LFKEHLYDNLLASSDHVASILAKFAAHPGLGMVIAPMPHMGYPTMGHAWFANRAPAR 457

Query: 305 RRVIDLAKRAGF--PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGAL 361
               D AK+ G   P          G+MF  +P+ L  L    L+ E F EE   KDG+L
Sbjct: 458 ----DFAKKVGITVPFDDHQPLAPYGSMFIARPEALSLLTGAGLVPEDFPEEGGYKDGSL 513

Query: 362 EHAVERFFACSV 373
            H +ER  + +V
Sbjct: 514 AHVIERLLSYAV 525


>gi|154509526|ref|ZP_02045168.1| hypothetical protein ACTODO_02058 [Actinomyces odontolyticus ATCC
           17982]
 gi|153799160|gb|EDN81580.1| hypothetical protein ACTODO_02058 [Actinomyces odontolyticus ATCC
           17982]
          Length = 620

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 114/252 (45%), Gaps = 26/252 (10%)

Query: 139 SPKKSGLTIKS----KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDF-EQ 192
           SP+    T+ +    KI  V H +Y D   EI   L  L   + L  T   E NK   E 
Sbjct: 283 SPRADQATLDAAASLKILAVAHIFYADMADEILDRLSVLPAGYHLVATTSNEENKALIEA 342

Query: 193 DVLKYFPSAQLYVME-NKGRDVRPFLY----LLELGVFDRYDYLCKIHGKKSQREGYHPI 247
              +    A + V+  N+GRD+  FL     +L  G    YD + KIH KKS ++ Y+  
Sbjct: 343 RAQERGVDADVRVVSSNRGRDIGAFLVDCNDVLTSG---EYDIVVKIHSKKSVQDDYNAA 399

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGM-IGSRRYRRYKRW--SFFAKRSEVY 304
           +  +++  L+ +LL  SD    I+  F  +P LGM I    +  Y     ++FA R+   
Sbjct: 400 Q--LFKEHLYDNLLASSDHVASILAEFAAHPGLGMVIAPMPHMGYPTMGHAWFANRAPAR 457

Query: 305 RRVIDLAKRAGF--PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGAL 361
               D AK+ G   P          G+MF  +P+ L  L    L+ E F EE   KDG+L
Sbjct: 458 ----DFAKKVGITVPFDDHQPLAPYGSMFIARPEALSLLTGAGLVPEDFPEEGGYKDGSL 513

Query: 362 EHAVERFFACSV 373
            H +ER  + +V
Sbjct: 514 AHVIERLLSYAV 525


>gi|194364297|ref|YP_002026907.1| hypothetical protein Smal_0519 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347101|gb|ACF50224.1| conserved hypothetical protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 686

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 106/252 (42%), Gaps = 17/252 (6%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK 196
           PS P  S      +  +V+H ++ D   E+   +        L +T     +   Q + +
Sbjct: 432 PSQPAPS------RPCVVIHAWHLDALPELLSAVKDSGLPARLVITTTSDRQAQVQSITE 485

Query: 197 -YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRW 255
            +   A+++  +N GRD+ PFL+  +  +      + K+H K+S     H   G  WRR 
Sbjct: 486 SHGLPAEIWAYDNHGRDILPFLHAADRLLQQNESLVLKLHTKRST----HRDNGDQWRRE 541

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG 315
           +   LLG +  A  + +  + +P LG++    +       +    ++   R+       G
Sbjct: 542 MVDALLGPAQAAANLAH-LQADPRLGLMAPAGH-LLNVADYIGGNAQRMERLWAQLGLDG 599

Query: 316 FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVR 374
            P       F +G+MFWV+ + L PL + HL+   FE E    DG L HA+ER       
Sbjct: 600 APGDG---QFASGSMFWVRLQALRPLLDAHLLPSMFEVEAGQIDGTLAHAIERATGAVAT 656

Query: 375 YTEFSIESVDCV 386
              FS+     V
Sbjct: 657 CAGFSVGDTSQV 668


>gi|13476281|ref|NP_107851.1| hypothetical protein mlr7560 [Mesorhizobium loti MAFF303099]
 gi|14027042|dbj|BAB53996.1| mlr7560 [Mesorhizobium loti MAFF303099]
          Length = 637

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 110/252 (43%), Gaps = 18/252 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLKYFPSAQLYVM- 206
            KIA+  H YY D   EI  +   +   +D   T    +K  E +  L   P  +  ++ 
Sbjct: 297 GKIAVCAHIYYTDMLEEILALTGNIPVPYDFIATTDTPDKKAEIEATLAKRPGVKNVIVR 356

Query: 207 ---ENKGRDVRP-FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
              +N+GRD+   F+ L +L V DRYD +C++H KKS +         +++R +  +LL 
Sbjct: 357 VVEKNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQ--VQASRSNLFKRHMLENLLN 414

Query: 263 FSDIAIRIINTFEQNPCLGM-IGSRRYRRYKR----WSFFAKRSEVYRRVIDLAKRAGFP 317
                  +++ F  NP +G+ +    +  Y      W F   + E   R++++  +    
Sbjct: 415 TRGYVHNVLDMFHDNPSVGLAVPPVVHISYPTMGHAWFFNRPKVEETARLLNIKVKFDHD 474

Query: 318 TKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYT 376
           T         GTMFW +P+ L  +       E F  E N  DG L H +ER  A + +  
Sbjct: 475 TPVAAY----GTMFWFRPRALRKMFEHKWKWEDFNAEPNHVDGGLAHVLERLIAYAAQDA 530

Query: 377 EFSIESVDCVAE 388
            ++   + C  +
Sbjct: 531 GYTTRHIMCAHQ 542


>gi|116628171|ref|YP_820790.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           LMD-9]
 gi|116101448|gb|ABJ66594.1| Lipopolysaccharide biosynthesis protein [Streptococcus thermophilus
           LMD-9]
          Length = 581

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 111/256 (43%), Gaps = 28/256 (10%)

Query: 135 DRPSSP--------KKSGLT--IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-- 182
           DRP  P        K   LT     K+A+ +H +Y D   E        +F +DL++T  
Sbjct: 260 DRPDYPYLLSRKYLKNQELTGDFDKKVAVHLHVFYVDLLEEFLDAFQDFHFAYDLWITTD 319

Query: 183 VVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
           V E  ++ EQ + +    A + V  N GRDV P L L E     RYDY+   H KKS+  
Sbjct: 320 VEEKKQEIEQILSRRSQDATIVVTGNIGRDVLPMLLLKE--KLSRYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGM-IGS-RRYRRYKRWSFFAKR 300
            +   E   WR+ L   L+  +D   +I+   E NP +G+ IG    Y RY R       
Sbjct: 378 DFWAGES--WRKELIDMLVKPAD---QILANMEANPKVGITIGDIPTYFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFN------GTMFWVKPKCLEPLRNLHLIGEFEEER 354
           + +   +  L +R G  TK +     N      GT  W K   L+PL +L+L        
Sbjct: 433 ALISPEMNKLWQRMG-ATKNIDFKNLNTFVMSYGTFVWFKYDALKPLFDLNLTVSDVPAE 491

Query: 355 NLKDGALEHAVERFFA 370
            L   ++ HA+ER   
Sbjct: 492 PLPQNSILHAIERLLV 507


>gi|55823377|ref|YP_141818.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           CNRZ1066]
 gi|55739362|gb|AAV63003.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           CNRZ1066]
          Length = 581

 Score = 76.6 bits (187), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 111/256 (43%), Gaps = 28/256 (10%)

Query: 135 DRPSSP--------KKSGLT--IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-- 182
           DRP  P        K   LT     K+A+ +H +Y D   E        +F +DL++T  
Sbjct: 260 DRPDYPYLLSRKYLKNQELTGDFDKKVAVHLHVFYVDLLEEFLDAFQDFHFAYDLWITTD 319

Query: 183 VVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
           + E  ++ EQ + +    A + V  N GRDV P L L E     RYDY+   H KKS+  
Sbjct: 320 IEEKKQEIEQILSRRSQDATIVVTGNIGRDVLPMLLLKE--KLSRYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGM-IGS-RRYRRYKRWSFFAKR 300
            +   E   WR+ L   L+  +D   +I+   E NP +G+ IG    Y RY R       
Sbjct: 378 DFWAGES--WRKELIDMLVKPAD---QILANMEANPKVGITIGDIPTYFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFN------GTMFWVKPKCLEPLRNLHLIGEFEEER 354
           + +   +  L +R G  TK +     N      GT  W K   L+PL +L+L        
Sbjct: 433 ALISPEMNKLWQRMG-ATKNIDFKNLNTFVMSYGTFVWFKYDALKPLFDLNLTVSDVPAE 491

Query: 355 NLKDGALEHAVERFFA 370
            L   ++ HA+ER   
Sbjct: 492 PLPQNSILHAIERLLV 507


>gi|33862360|ref|NP_893920.1| glycosyltransferase [Prochlorococcus marinus str. MIT 9313]
 gi|33640473|emb|CAE20262.1| glycosyltransferase [Prochlorococcus marinus str. MIT 9313]
          Length = 738

 Score = 76.3 bits (186), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 106/231 (45%), Gaps = 21/231 (9%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFD---FDLFVTVVEANKDFEQDVLKYFPSAQL- 203
           ++ IA+ VH +Y +    +  IL  LN++    DLF++        E        +  L 
Sbjct: 499 ETTIALHVHVHYPEL---LDTILNALNYNKIRPDLFLSCTNHENHSEIQCKSAGANCTLK 555

Query: 204 --YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
                 N+GRD+ P L  +   +  +Y+    +H KKS        +G  WR +L  +L+
Sbjct: 556 SIITTPNRGRDIGPLLTEIGKELDTKYEIYGHLHTKKSALLPGK--QGCSWRDFLISNLV 613

Query: 262 GFSDIAI--RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           G  DIA+  RI+   ++NP LG++ +        WS   K +++    ++L      P  
Sbjct: 614 GMQDIAMADRIVTALKKNPKLGLVFADDPTCVG-WSGNRKHADILANKLNLG-----PLP 667

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFF 369
           R   DF  GTMFW K   L  L NL+L  E + +E    DG + HA+ER  
Sbjct: 668 RC-FDFPVGTMFWAKKGALTELYNLNLGWEDYPQEPLGYDGTILHAIERLL 717


>gi|296876714|ref|ZP_06900762.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           parasanguinis ATCC 15912]
 gi|296432216|gb|EFH18015.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           parasanguinis ATCC 15912]
          Length = 582

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 111/255 (43%), Gaps = 28/255 (10%)

Query: 135 DRPSSP--------KKSGLT--IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-- 182
           DRP  P        KK  L      K+A+ +H +Y D   E        +FD+DL++T  
Sbjct: 260 DRPDFPYLLSRKYLKKQELAGDFDKKVAVHLHVFYVDLLEEFLDAFRDFHFDYDLWITTD 319

Query: 183 VVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
           V E  +  EQ +      A++ V  N GRDV P L L E     +YDY+   H KKS+  
Sbjct: 320 VEEKKQAIEQILSNRAQDARVVVTGNIGRDVLPMLLLKEQ--LSKYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKR 300
            +   E   WR+ L   L+  +D   +I+   E NP +G+  +    + RY R       
Sbjct: 378 DFWAGES--WRKELIEMLVKPAD---QILANMEANPKVGITIADIPTFFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFN------GTMFWVKPKCLEPLRNLHLIGEFEEER 354
           + +   +  L +R G  TK +  +  N      GT  W K   L+PL +L+L        
Sbjct: 433 ALISPEMNKLWQRMG-ATKTIDFEKINTFVMSYGTFVWFKYDALKPLFDLNLTAADVPAE 491

Query: 355 NLKDGALEHAVERFF 369
            L   ++ HA+ER  
Sbjct: 492 PLPQNSILHAIERLL 506


>gi|16124886|ref|NP_419450.1| hypothetical protein CC_0633 [Caulobacter crescentus CB15]
 gi|221233606|ref|YP_002516042.1| hypothetical protein CCNA_00669 [Caulobacter crescentus NA1000]
 gi|13421844|gb|AAK22618.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|51039815|tpg|DAA00361.1| TPA_exp: conserved hypothetical protein [Caulobacter vibrioides]
 gi|220962778|gb|ACL94134.1| hypothetical protein CCNA_00669 [Caulobacter crescentus NA1000]
          Length = 818

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 102/238 (42%), Gaps = 18/238 (7%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKY---F 198
           +S    ++    ++H +Y +     +  L       DL +TV E     E D+ +    F
Sbjct: 582 QSQFAKRADAVTLLHLFYPELIDWFAERLAATADVLDLMITVPETWS--EADLARARAAF 639

Query: 199 PSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFF 258
           P+A L + EN+GRD+RPF+  L       Y   CK+H K+S     H  +G  WR  L  
Sbjct: 640 PTAHLAIAENRGRDIRPFVETLRRARALGYSVFCKLHSKRSP----HQAKGDQWRTTLVE 695

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGS--RRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
            LLG  + A   +  F Q+P LG++ +   R R          R+E  R    L+   G 
Sbjct: 696 GLLG-GEAAALALRAFAQDPKLGLLAAAGARMRIGDPDVMDNNRAEADR----LSAHMGL 750

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSV 373
              R    F  G+MFW + +   PL +L      F  E    DG   HA+ER  A  V
Sbjct: 751 -KPRPETPFAAGSMFWGRTEAFAPLTDLSDDEIAFGPELGRVDGTTAHAIERLTAAIV 807


>gi|190572709|ref|YP_001970554.1| putative glycosyltransferase protein [Stenotrophomonas maltophilia
           K279a]
 gi|190010631|emb|CAQ44240.1| putative glycosyltransferase protein [Stenotrophomonas maltophilia
           K279a]
          Length = 707

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 104/243 (42%), Gaps = 11/243 (4%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFP-SAQLY 204
              S+  IV+H +Y D   E+   +        L +T     +   Q ++     +A+++
Sbjct: 456 AAPSRPCIVIHAWYLDALPELLQAVKDSGLQARLVITTTGERQAQVQSIIDAEGLTAEIW 515

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
           V +N GRDV PFL+  +  +      + K+H K+S     H   G  WRR +   LLG +
Sbjct: 516 VYDNHGRDVLPFLHAADRLLQQNESLVLKLHTKRST----HRDNGDQWRREMVDALLG-T 570

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLD 324
             A   +     NP +G++    +   K   +    ++   R+  L    G  +      
Sbjct: 571 AQAAANLAHLLANPSIGLMAPAGH-LLKVADYIGGNAQRMERLWAL---LGLDSAPGDGQ 626

Query: 325 FFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESV 383
           F +G+MFWV+   L PL + HL+   F+ E    DG L HA+ER     V    F++   
Sbjct: 627 FASGSMFWVRLPALRPLLDAHLLPSMFDTEAGQIDGTLAHAIERATGAVVSAAGFTVADT 686

Query: 384 DCV 386
             V
Sbjct: 687 SEV 689


>gi|329116186|ref|ZP_08244903.1| rhamnan synthesis protein F [Streptococcus parauberis NCFD 2020]
 gi|326906591|gb|EGE53505.1| rhamnan synthesis protein F [Streptococcus parauberis NCFD 2020]
          Length = 589

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 110/234 (47%), Gaps = 19/234 (8%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVL-KYFPSAQL 203
            I  K+AI +H +Y D   E        +FD+DLF+T  +E  K   ++VL +    A++
Sbjct: 287 VINKKVAIHLHTFYVDLLQEFLSAFENFHFDYDLFITTDIEEKKTQIENVLNENNQKAEV 346

Query: 204 YVMENKGRDVRPFLYLLE-LGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           +V  N GRDV P L L E L V   YDY+   H KKS+   +   E   WR+ L   L+ 
Sbjct: 347 FVTGNIGRDVLPMLLLKEKLSV---YDYIGHFHTKKSKEADFWAGES--WRKELIKMLVL 401

Query: 263 FSDIAIRIINTFEQNPCLGMIGSR-RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRL 321
            +D    I+ T E+N    +I     Y RY +       + +   + +L K+ G  TK +
Sbjct: 402 PAD---SILATLEKNKVGIVIADMPTYFRYNKIVTAWNENLIAPEMNELWKKMGL-TKSI 457

Query: 322 ---HLDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
              HL  F    GT  W K   L+PL +L+L  E      L   ++ HA+ER  
Sbjct: 458 DFNHLHTFVMSYGTFVWFKYDALKPLFDLNLTVEDVPAEPLPQNSILHAIERLL 511


>gi|260890973|ref|ZP_05902236.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
 gi|260859000|gb|EEX73500.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
          Length = 319

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 119/248 (47%), Gaps = 34/248 (13%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK---YFPSAQL 203
           +K K+ ++ H Y++D   E  H +  +    DL +T        + +       F + ++
Sbjct: 4   LKYKVLLIFHIYFEDLLDESIHYMKSMPETSDLLITTPRKELKEKIEEKVRGLNFRNIEV 63

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS-QREGYHPIEGIIWRRWLFFDLLG 262
            V+EN+GRDV   L   +  V + YDY+C +H KK+ Q + Y   +G  +R   + + L 
Sbjct: 64  RVIENRGRDVSSLLVGAKDAVMN-YDYVCFMHDKKTAQLKPYSSGQG--FRYKCYENNLA 120

Query: 263 FSDIAIRIINTFEQNPCLGMI-------GSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG 315
                  +I TF++NP LGM+       G+  +     WS   K++E       L K+ G
Sbjct: 121 TKKYVKNLIGTFKENPRLGMLMPPPPNHGNFFHIIGNEWSSNFKKTE------KLIKKLG 174

Query: 316 FPTKRLHLDF-FN-------GTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVE 366
                L++DF +N       GTMFW +P+ L+ L +      +F EE N  DG + HAVE
Sbjct: 175 -----LNVDFHWNLEPISPLGTMFWFRPRALKKLFDYGWEYSDFPEEPNEHDGTILHAVE 229

Query: 367 RFFACSVR 374
           R +  +V+
Sbjct: 230 RVYGFAVQ 237


>gi|30024633|dbj|BAC75688.1| rhamnosyltransferase [Streptococcus mutans]
          Length = 583

 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 107/232 (46%), Gaps = 18/232 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLKYFPS-AQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  E ++VL      AQ++V
Sbjct: 283 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEVLSANSQEAQIFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLK--NYLSTYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G  TK++  
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGM-TKKIDF 454

Query: 324 DFFN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           + F+      GT  W K   L+PL +L+L  +   E  L   ++ HA+ER  
Sbjct: 455 NAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLL 506


>gi|298290915|ref|YP_003692854.1| Rhamnan synthesis F [Starkeya novella DSM 506]
 gi|296927426|gb|ADH88235.1| Rhamnan synthesis F [Starkeya novella DSM 506]
          Length = 633

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/252 (26%), Positives = 114/252 (45%), Gaps = 17/252 (6%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVL 195
           P++P  S L    K+ +  H +Y D   E+   L       DLF+T    A  +  + + 
Sbjct: 386 PAAPVASPL----KVGLHGHFFYPDLLPELLERLAANASRPDLFLTTDTPAKVEQLRALT 441

Query: 196 KYFPS-AQLYVMENKGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
             +P+  ++ V+ N GRD+ PFL  L ++     YD L  +HGKK++  G     G  WR
Sbjct: 442 AAWPAKVRIDVVPNSGRDIGPFLTALRDVLTGGEYDVLLHLHGKKTK--GRRRAIGDPWR 499

Query: 254 RWLFFDLLGFSDIAI-RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAK 312
            +L+ +L+G     +  ++     +P +G++          W+   +  E  RR + L +
Sbjct: 500 NFLWENLIGGDHPMLDAVLAYMAAHPQVGLVYPEDTHLLD-WARNGRVVEELRRDMGLTE 558

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFAC 371
             G      ++DF  G MF V+P  L P+  L L   ++  E    DG + H +ER    
Sbjct: 559 PMG-----TYVDFPVGNMFAVRPAALAPVLALDLKWSDYPVEPIPLDGTVLHGIERLLPT 613

Query: 372 SVRYTEFSIESV 383
            VR   F+  +V
Sbjct: 614 VVRKAGFTTAAV 625


>gi|290580710|ref|YP_003485102.1| rhamnan synthesis protein F [Streptococcus mutans NN2025]
 gi|254997609|dbj|BAH88210.1| RgpFc protein [Streptococcus mutans NN2025]
          Length = 557

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 106/232 (45%), Gaps = 18/232 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 257 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANSQEAQVFV 316

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 317 TGNIGRDVLPMLKLK--NYLSAYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 372

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G  TK++  
Sbjct: 373 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGM-TKKIDF 428

Query: 324 DFFN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           + F+      GT  W K   L+PL +L+L  +   E  L   ++ HA+ER  
Sbjct: 429 NAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLL 480


>gi|30024644|dbj|BAC75698.1| rhamnosyltransferase [Streptococcus mutans]
          Length = 583

 Score = 73.6 bits (179), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 106/232 (45%), Gaps = 18/232 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 283 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANSQEAQVFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLK--NYLSTYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G  TK++  
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGM-TKKIDF 454

Query: 324 DFFN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           + F+      GT  W K   L+PL +L+L  +   E  L   ++ HA+ER  
Sbjct: 455 NAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLL 506


>gi|329944276|ref|ZP_08292535.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328531006|gb|EGF57862.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 636

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 102/230 (44%), Gaps = 15/230 (6%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQLYV 205
           K KIA++ H YY D        +  +    D+F++     K +  +   K  P + ++ +
Sbjct: 307 KQKIALIAHLYYMDLVEPTLKYIRNMPEGIDIFLSTSSPEKVEQVEAACKGLPYNIEVRL 366

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFDLLGFS 264
           +EN+GRDV PFL   +  V D YD +C  H KK +Q   Y   +G  ++   F +LL   
Sbjct: 367 VENRGRDVGPFLVAWKDVVHD-YDVVCYTHDKKVTQLYPYSVGDGFAYK--CFENLLPTR 423

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA-KRSEVYRRVIDLAKRAGF-----PT 318
           D    +I TF+  P LG +          +  F       + R   L +  G      PT
Sbjct: 424 DFVKNVIATFDAEPRLGFLAPTPPNHADYFPVFTYGWGPNFDRTKALLRELGLDVPLDPT 483

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVER 367
           K        G+MFW +P+ L+PL +      EF  E    DG L HA+ER
Sbjct: 484 KEPIAPL--GSMFWFRPQALKPLFDHDWQWEEFPPEPCPIDGTLMHAIER 531


>gi|3399709|dbj|BAA32094.1| rgpFc [Streptococcus mutans]
          Length = 583

 Score = 73.2 bits (178), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 106/232 (45%), Gaps = 18/232 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 283 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANGQEAQVFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLK--NYLSAYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G  TK++  
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGM-TKKIDF 454

Query: 324 DFFN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           + F+      GT  W K   L+PL +L+L  +   E  L   ++ HA+ER  
Sbjct: 455 NAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLL 506


>gi|24379285|ref|NP_721240.1| RgpFc protein [Streptococcus mutans UA159]
 gi|24377204|gb|AAN58546.1|AE014924_6 RgpFc protein [Streptococcus mutans UA159]
          Length = 583

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 105/232 (45%), Gaps = 18/232 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 283 NQKAAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANSQEAQVFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLK--NYLSTYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G  TK++  
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGM-TKKIDF 454

Query: 324 DFFN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           + F+      GT  W K   L+PL +L+L  +   E  L   ++ HA+ER  
Sbjct: 455 NAFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLL 506


>gi|116511036|ref|YP_808252.1| lipopolysaccharide biosynthesis protein [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116106690|gb|ABJ71830.1| Lipopolysaccharide biosynthesis protein [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 588

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 111/233 (47%), Gaps = 24/233 (10%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQL---YVM 206
           KI I +H +Y D   E  +   +   ++DL++T     K   +++LK +P  Q+    V 
Sbjct: 299 KIGIHLHAFYLDLIPEYLNYFDKYVQNYDLYITTDTEEK--YEEILKNYPLPQIKKVIVT 356

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            NKGRDV P++ + EL     YD     H KKS+   +  I G  WRR + + LL   + 
Sbjct: 357 GNKGRDVLPWMQVSEL--MTDYDLCGHFHTKKSKDNDW--IVGESWRRDIEYSLL---EP 409

Query: 267 AIRIINTFEQNPCLGMIGSRR---YRRYKRWSFFAKRS------EVYRRVIDLAKRAGFP 317
           A  I   FE+NP LG+I +     +  +   ++  +R       E++++ ID        
Sbjct: 410 AQAIFQEFEKNPKLGLIIADVPSFFEHFYGPTYITERDIWPDMQEIWQK-IDFENSKELK 468

Query: 318 TKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
            K  ++  + GTM W +P+ L  L N+++  +  EE  L   ++ HA ER   
Sbjct: 469 QKDSYVMSY-GTMIWYRPQALNNLLNVNIQADVPEEP-LPYNSILHAFERLLV 519


>gi|281490695|ref|YP_003352675.1| bifunctional alpha-L-Rha
           alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Lactococcus lactis
           subsp. lactis KF147]
 gi|281374464|gb|ADA63985.1| Alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Lactococcus lactis
           subsp. lactis KF147]
          Length = 589

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 107/239 (44%), Gaps = 25/239 (10%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF---- 198
           S   +   +A+ +H YY +   E        +FD+DL++T    N D +++++K      
Sbjct: 281 SKTVLHQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLT---TNTDEKEEIIKEMLKCK 337

Query: 199 -PSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLF 257
              A+L    N GRD+ PFL L E     +YD +   H K+S    +    G  WR  L 
Sbjct: 338 DARAKLVRTPNHGRDIVPFLALKE--ELKKYDIVGHFHTKRSLEAAF--FAGESWRTELI 393

Query: 258 FDLLGFSDIAIRIINTFEQNPCLGMIGSRR---YRRYKRWSFFAKRSEVYRRVIDLAKRA 314
             L+  +D    I+  FEQ   LG++ +     +R  K  +   +  ++   + D+ KR 
Sbjct: 394 SMLIEPAD---NIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKQIAPIMNDIWKRM 450

Query: 315 GFPTKRLHLDFFN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVER 367
               K+++   FN      GT FW K + LEPL NL ++        L    + HA+ER
Sbjct: 451 KM-NKKVNFHDFNTFTMSYGTFFWAKTEVLEPLFNLEIMDREIPNEPLPQNTILHAIER 508


>gi|320095829|ref|ZP_08027469.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319977239|gb|EFW08942.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 619

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 110/246 (44%), Gaps = 16/246 (6%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVL 195
           ++P+        ++  + H +Y D   EI   L  L   + L  T  +  +    E+ + 
Sbjct: 286 AAPEAREKAASLRVVAIAHIFYADMADEIIDRLSVLPDGWRLVATTADEERKAAIEETMA 345

Query: 196 KYFPSAQLYVM-ENKGRDVRPFLY-LLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
           +     Q+ V+  N+GRD+  FL    ++   D YD + KIH KKS ++  +  +  +++
Sbjct: 346 RRGAVGQVRVVASNRGRDISAFLVDCSDVLAGDDYDVVVKIHSKKSVQDEANAAQ--LFK 403

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGM-IGSRRYRRYKRW--SFFAKRSEVYRRVIDL 310
             L+ +LL   D    I+  F  +P LGM +    +  Y     ++FA R        +L
Sbjct: 404 DHLYENLLDSKDHVANILAEFADHPGLGMALAPMPHMGYPTMGHAWFANRPPAR----EL 459

Query: 311 AKRAGF--PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVER 367
           AKR G   P          G+MF  +P+ L PL    L   +F  E   +DG+L H +ER
Sbjct: 460 AKRIGITVPFDDHQPLAPYGSMFIARPRALRPLVEAGLTHDDFPPEGGYQDGSLAHVIER 519

Query: 368 FFACSV 373
             A +V
Sbjct: 520 LLAYAV 525


>gi|15672189|ref|NP_266363.1| polysaccharide biosynthesis protein [Lactococcus lactis subsp.
           lactis Il1403]
 gi|12723062|gb|AAK04305.1|AE006258_8 polysaccharide biosynthesis protein [Lactococcus lactis subsp.
           lactis Il1403]
          Length = 589

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 107/239 (44%), Gaps = 25/239 (10%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF---- 198
           S   +   +A+ +H YY +   E        +FD+DL++T    N D +++++K      
Sbjct: 281 SKTVLHQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLT---TNTDEKEEIIKEMLKCK 337

Query: 199 -PSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLF 257
              A+L    N GRD+ PFL L E     +YD +   H K+S    +    G  WR  L 
Sbjct: 338 DAKAKLVRTPNHGRDIVPFLALKE--ELKKYDIVGHFHTKRSLEAAF--FAGESWRTELI 393

Query: 258 FDLLGFSDIAIRIINTFEQNPCLGMIGSRR---YRRYKRWSFFAKRSEVYRRVIDLAKRA 314
             L+  +D    I+  FEQ   LG++ +     +R  K  +   +  ++   + D+ KR 
Sbjct: 394 SMLIEPAD---NIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKQIAPIMNDIWKRM 450

Query: 315 GFPTKRLHLDFFN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVER 367
               K+++   FN      GT FW K + LEPL NL ++        L    + HA+ER
Sbjct: 451 KM-NKKVNFHDFNTFTMSYGTFFWAKIEVLEPLFNLEIMDREIPNEPLPQNTILHAIER 508


>gi|322516362|ref|ZP_08069287.1| rhamnosyltransferase [Streptococcus vestibularis ATCC 49124]
 gi|322125095|gb|EFX96488.1| rhamnosyltransferase [Streptococcus vestibularis ATCC 49124]
          Length = 581

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 112/260 (43%), Gaps = 32/260 (12%)

Query: 120 SEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDL 179
           S K+L  +EL E + DR             K+A+ +H +Y D   E        +F +DL
Sbjct: 269 SHKYLKGQELVENF-DR-------------KVAVHLHVFYVDLLEEFLDAFQAFHFIYDL 314

Query: 180 FVT--VVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGK 237
           ++T  V E  +  E+ +      A + V  N GRDV P L L E     RYDY+   H K
Sbjct: 315 WITTDVEEKKQAIEKILSNRVQDATVVVTGNIGRDVLPMLLLKEQ--LSRYDYVGHFHTK 372

Query: 238 KSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWS 295
           KS+   +   E   WR+ L   L+  +D+   I+   E NP +G+  +    + RY R  
Sbjct: 373 KSKEADFWAGES--WRKELIEMLVKPADL---ILANMEANPKVGITIADIPTFFRYNRIV 427

Query: 296 FFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN------GTMFWVKPKCLEPLRNLHLIGE 349
                + +   +  L +R G  TK +     N      GT  W K   L+PL +L+L   
Sbjct: 428 VAWNEALISPEMNKLWQRMG-ATKTIDFKSLNTFVMSYGTFVWFKYDALKPLFDLNLTAA 486

Query: 350 FEEERNLKDGALEHAVERFF 369
                 L   ++ HA+ER  
Sbjct: 487 DVPAEPLPQNSILHAIERLL 506


>gi|157151529|ref|YP_001450315.1| rhamnosyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|157076323|gb|ABV11006.1| rhamnosyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 582

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 107/234 (45%), Gaps = 24/234 (10%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF----PSAQLYV 205
           KIA+ +H +Y D   E  H     +F +DLF+T     K  + ++L         A+++V
Sbjct: 284 KIAVHLHVFYVDLLAEFLHAFESFHFSYDLFITTDSEKK--KNEILGILEGKQAKAEVFV 341

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L       +YDY+   H KKS+   Y   E   WR+ L   L+  +D
Sbjct: 342 TGNVGRDVLPMLKLKRH--LSQYDYIGHFHTKKSKEADYWAGES--WRKELINMLVHPAD 397

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKR----WS---FFAKRSEVYRRVIDLAKRAGF 316
              +I++   Q+ CLG++ +    + R+ R    W+      + ++++ R ++  K   F
Sbjct: 398 ---QIVSQLGQDDCLGLVIADIPSFFRFNRIVVAWNEALISPEMNKLWER-MNCQKEVDF 453

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
                 +  + GT  W K   L PL +L++  E      L   ++ HA+ER   
Sbjct: 454 KQMNTFVMSY-GTFVWFKYDALSPLFDLNMTEEDVPSEPLPQNSILHAIERLLV 506


>gi|222148479|ref|YP_002549436.1| hypothetical protein Avi_2007 [Agrobacterium vitis S4]
 gi|221735467|gb|ACM36430.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 513

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 114/255 (44%), Gaps = 38/255 (14%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYFPSAQ- 202
           + ++  + I VHC+Y + + EI+  L  L   F L VTV  E++    +++L  F   Q 
Sbjct: 251 VALQLSLCIHVHCFYVELFNEIADRLQCLTLPFYLVVTVCNESDAKVVENLLVDFNQRQN 310

Query: 203 --LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
             + V+EN+GRD+ PFL +    ++ + D +  +H KKS     H   G  WRR+LF   
Sbjct: 311 THILVVENRGRDIAPFL-IDASPIWRKSDLVLHLHTKKSP----HITWGDNWRRYLFDQT 365

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           +G+  +   II+ F+    +GM+    +   K ++   K  +  R +           ++
Sbjct: 366 IGYEPLLKGIIDQFQDRDDMGMMYPENFCMIKHFTEEEKNKDAIRYI----------AQK 415

Query: 321 LHLD--------FFNGTMFWVKPKCL------EPLRNLHLIGEFEEERNLKDGALEHAVE 366
           L L+        +  G+M + + K L      + L NL     F  E+   DG   H +E
Sbjct: 416 LRLECSFEALGAYAAGSMAFYRVKALASVLEYDALENL-----FGPEQGQLDGTAAHVLE 470

Query: 367 RFFACSVRYTEFSIE 381
           R     VR   F  +
Sbjct: 471 RLLPEMVRLNGFETQ 485


>gi|319946716|ref|ZP_08020950.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           australis ATCC 700641]
 gi|319746764|gb|EFV99023.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           australis ATCC 700641]
          Length = 581

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 107/256 (41%), Gaps = 28/256 (10%)

Query: 135 DRPSSP----------KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV- 183
           DRP  P          +  G T   K+A+ +H +Y D   E        +F +DL++T  
Sbjct: 260 DRPDYPYLLSRKYLKDQDLGDTFDKKVAVHLHVFYVDLLEEFLDAFQAFHFAYDLWITTD 319

Query: 184 VEANKDFEQDVLKYFPS-AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
           VE  K   +++L      A + V  N GRDV P L L E      YDY+   H KKS+  
Sbjct: 320 VEEKKQAIEEILSNRAQVATVVVTGNIGRDVLPMLLLKEQ--LSHYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKR 300
            +   E   WR+ L   L+  +D   +I+   E NP +G+  +    + RY R       
Sbjct: 378 DFWAGES--WRKELIDMLVKPAD---KILANMEANPKVGITIADIPTFFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFN------GTMFWVKPKCLEPLRNLHLIGEFEEER 354
             +   +  L +R G  TK +     N      GT  W K   L+PL +L+L        
Sbjct: 433 VLISPEMNKLWQRMG-ATKTIDFKNLNTFVMSYGTFVWFKYDALKPLFDLNLKAADVPAE 491

Query: 355 NLKDGALEHAVERFFA 370
            L   ++ HA+ER   
Sbjct: 492 PLPQNSILHAIERLLV 507


>gi|160936495|ref|ZP_02083863.1| hypothetical protein CLOBOL_01386 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440580|gb|EDP18318.1| hypothetical protein CLOBOL_01386 [Clostridium bolteae ATCC
           BAA-613]
          Length = 674

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/256 (27%), Positives = 107/256 (41%), Gaps = 34/256 (13%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS-----AQLY 204
           KIA+V H +Y D   E    L  +  + DL++TV  AN + +  V  YF S      ++ 
Sbjct: 292 KIAVVAHLFYPDLMDETLRYLQNIQENIDLYITV--ANIETKYKVYNYFESIRRSNVKVL 349

Query: 205 VMENKGRDVRPFL-----YLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
           +  N+GRD    L     YL++      Y+YLC +H KK+ R G     G  +    + +
Sbjct: 350 LSGNRGRDAGSLLVACREYLMQ------YEYLCFVHDKKTTRGGGPVTVGKAFMYHAWEN 403

Query: 260 LLGFSDIAIRIINTFEQNPCLGMI--------GSRRYRRYKRWSFFAKRSEVYRRVIDLA 311
            L        II  FE+N  LG++        G         W+   ++++    ++ L 
Sbjct: 404 TLRSGGFVSSIIKLFEKNDRLGILTPPVPALGGYLTELVGNEWTCCYQKTKELAEILSLK 463

Query: 312 KRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER--- 367
                P       F   T FW +P  L+PL        +F EE    DG L HA+ER   
Sbjct: 464 ----VPMSPQKQPFALATAFWCRPAALKPLFEYPWRYEDFPEEPLASDGTLNHAIERIII 519

Query: 368 FFACSVRYTEFSIESV 383
           + A S  Y    +ES 
Sbjct: 520 YVAQSEGYYTAMVESA 535


>gi|82703518|ref|YP_413084.1| glycosyl transferase, group 1 [Nitrosospira multiformis ATCC 25196]
 gi|82411583|gb|ABB75692.1| Glycosyl transferase, group 1 [Nitrosospira multiformis ATCC 25196]
          Length = 828

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 103/230 (44%), Gaps = 13/230 (5%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPS--A 201
           L+   ++A+ +H YY + + EI   L   N   DLF++V  E  ++    +L  +P    
Sbjct: 586 LSSSIRVALHLHVYYSELFPEIMARLKVNNVRPDLFISVPTECTRNEVTGLLNDYPGKVV 645

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            + ++ N+GRD+ P L        D YD +  +H KK+       I G  W  +L  +LL
Sbjct: 646 DIQIVPNRGRDIGPLLTAFGSVFLDDYDAIGHLHTKKTADLSDEMI-GKRWYTFLLENLL 704

Query: 262 GFS-DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           G   ++A  I+     +P +G++       +  W      ++       LA + G    +
Sbjct: 705 GGKRNMADIILGRMTADPAIGIVFPDDPHVFD-WGNNKAHAD------SLASKLGLGKLQ 757

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFF 369
            +  F  GTMFW + + L PL  L L   ++  E    DG + HA+ER  
Sbjct: 758 ENFVFPMGTMFWARTEALRPLFTLDLSWQDYPAEPLPYDGTILHALERLL 807


>gi|306833804|ref|ZP_07466929.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus bovis
           ATCC 700338]
 gi|304423998|gb|EFM27139.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus bovis
           ATCC 700338]
          Length = 586

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 109/232 (46%), Gaps = 20/232 (8%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANK-DFEQDVLKYFPSAQLYVME 207
           K+A+ +H +Y D   E  +     +FD+DLF+T   EA K + E  + K   +AQ+++  
Sbjct: 288 KVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIESILEKNGKTAQVFLTG 347

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N+GRD+ P L L E      YDY+   H KKS    Y    G  WR  L+  L+  +D  
Sbjct: 348 NRGRDIIPMLKLKE--ELSSYDYIGHFHTKKSPEYPY--WVGDSWRNELYQMLIQSAD-- 401

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKR----WS---FFAKRSEVYRRVIDLAKRAGFPT 318
             ++   E N  LG++ +    + RY +    W+   F    +E++ R ++L ++  F  
Sbjct: 402 -NVLANLENNDNLGLVIADIPSFFRYTKIVDPWNENRFADGMNELWER-MNLGRQIDFNN 459

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
               +  + GT  W K   L+PL +L L  +      +    + H++ER   
Sbjct: 460 LSTFIMSY-GTFIWFKHDTLKPLFDLELTDDEIPSEPIPQHTILHSIERILV 510


>gi|295687882|ref|YP_003591575.1| rhamnan synthesis protein F [Caulobacter segnis ATCC 21756]
 gi|295429785|gb|ADG08957.1| Rhamnan synthesis F [Caulobacter segnis ATCC 21756]
          Length = 818

 Score = 70.5 bits (171), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 148/368 (40%), Gaps = 38/368 (10%)

Query: 18  LLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFL 77
           ++R  + E   + A Y+P  + G    W    ++       H  +    ES++ WL   L
Sbjct: 466 VVRHKLSELSRVDAAYVPGVMPG----WDNQARKPWAGHAFHNADP---ESYLTWLSGAL 518

Query: 78  --AFSKYSKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKF-LYVKELFEG 132
             A +++ K       + F  +  E  + A+L  +R+  +  +         Y   L + 
Sbjct: 519 THAVARHPK----GEAMVFVNAWNEWGEGAYLEPDRWFGHGYLHATRAALSAYQPRLTDA 574

Query: 133 WNDRPSSPKKSGLTIKSKIAI-VVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE 191
               P   +     +K   A+ ++H +Y +     +  L       DL +TV E     E
Sbjct: 575 ---HPLVAQAQAAFVKRADAVTLLHLFYPELIDWFAERLAATADVLDLMITVPETWS--E 629

Query: 192 QDVLK---YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIE 248
            D+ +    FP A L + EN+GRD+RPF+  L       Y   CK+H K+S     H  +
Sbjct: 630 ADLARARATFPMAHLAIAENRGRDIRPFVETLRRARTLGYSVFCKLHSKRSP----HRAK 685

Query: 249 GIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS--RRYRRYKRWSFFAKRSEVYRR 306
           G  WR  L   LLG  + A   +  F Q+  LG++ +   R R          R +  R 
Sbjct: 686 GDEWRAELVDGLLG-GEAAALALRAFAQDAKLGLLAAAGSRLRIGDPDVMNNNRQDADR- 743

Query: 307 VIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAV 365
              LA+R G         F  G+MFW + +   PL +L     +F  E    DG   HA+
Sbjct: 744 ---LARRMGLKLAP-ETPFSAGSMFWGRTEAFAPLSDLTDAEIDFGPELGRVDGTTAHAI 799

Query: 366 ERFFACSV 373
           ER  A  V
Sbjct: 800 ERLTAAIV 807


>gi|302337198|ref|YP_003802404.1| Rhamnan synthesis F [Spirochaeta smaragdinae DSM 11293]
 gi|301634383|gb|ADK79810.1| Rhamnan synthesis F [Spirochaeta smaragdinae DSM 11293]
          Length = 1808

 Score = 70.5 bits (171), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 101/238 (42%), Gaps = 17/238 (7%)

Query: 151  IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE---QDVLKYFP---SAQLY 204
            I + +H +Y D   E+   L+ +   F LF++     KD E   + V K  P      + 
Sbjct: 1019 IGVHLHLFYIDLAEELLSSLINIPVCFSLFISTSAGVKDQEYIKKIVNKKLPLCNECTVI 1078

Query: 205  VMENKGRDVRPFLYLLELG-VFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
              EN+GRD+ PF+  +E G    ++D +   H KKS     H       RR+L   +LG 
Sbjct: 1079 QTENRGRDIAPFI--VEFGNSLSQFDLILHFHSKKS----LHSDSLSDARRFLLHYILGN 1132

Query: 264  SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
              I I+ +N F +N  +GM+    +   +    F  +    ++ +   K+ G        
Sbjct: 1133 KAITIQNLNMFFENGSIGMVAPPYHPSLRNMPNFGLQEYETKQFL---KKMGINYSGKCT 1189

Query: 324  DFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
            DF  G+ FW +   +  L   ++    F EE+   DG L H +ER      +   F I
Sbjct: 1190 DFPAGSFFWCRKDAIRQLLTSNIRWNSFPEEKGQIDGTLAHVIERSLGIICKQNNFKI 1247


>gi|13476282|ref|NP_107852.1| hypothetical protein mlr7561 [Mesorhizobium loti MAFF303099]
 gi|14027043|dbj|BAB53997.1| mlr7561 [Mesorhizobium loti MAFF303099]
          Length = 609

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 109/247 (44%), Gaps = 49/247 (19%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVLKYF--PSAQLYV 205
           +IA++ H Y+ D   EI      +   +DL VT   A+K    +Q + K     +A + V
Sbjct: 298 RIAVLAHVYHLDMIDEILGYAENVPKGYDLIVTTDNADKQALIQQAIAKATNASNAVVLV 357

Query: 206 MENKGRDVRPFL-----YLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           + N GRD    L     Y+LE    DRYD +C++H K+S ++G     G +++   F +L
Sbjct: 358 VRNDGRDTSALLVGCRDYVLE----DRYDLICRVHSKRSPQDG---PRGELFKLHTFENL 410

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSR----RYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
           L        ++  F  NP LG++        Y      S+   ++ V +    LA++ G 
Sbjct: 411 LHTPGYVSNLLELFANNPALGLVMPPLVHIGYPTIGN-SWAGNKANVAK----LARQLGL 465

Query: 317 PTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFEEERN--------LKDGALEH 363
               +HLD        G M+W +P  L  L        FEE  N         +DG+L H
Sbjct: 466 ---IVHLDDSTPVAPYGGMYWFRPAALRKL--------FEERWNWNDFANMDYRDGSLVH 514

Query: 364 AVERFFA 370
           A+ER  A
Sbjct: 515 AIERIIA 521


>gi|125623094|ref|YP_001031577.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|124491902|emb|CAL96823.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|300069842|gb|ADJ59242.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris NZ9000]
          Length = 588

 Score = 69.3 bits (168), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 113/244 (46%), Gaps = 28/244 (11%)

Query: 141 KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS 200
           KKS L    KIAI +H +Y D   E      +   ++DLF+T     KD  + ++K +P 
Sbjct: 294 KKSNL----KIAIHLHAFYLDLIPEYLDYFDKYVQNYDLFITT--DTKDKYEQIIKSYPL 347

Query: 201 AQL---YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLF 257
            Q+    V  NKGRDV P++ + EL     YD     H KKS+   +  I G  WRR + 
Sbjct: 348 NQIKKVLVTGNKGRDVLPWMEISELMA--DYDLCGHFHTKKSKDNDW--IVGESWRRDIE 403

Query: 258 FDLLGFSDIAIRIINTFEQNPCLGMIGSRR---YRRYKRWSFFAKRS------EVYRRVI 308
           + LL     A  I   FE+NP LG++ +     +  +   ++  +R       E++++ I
Sbjct: 404 YSLLK---PAQAIFQEFEKNPKLGLMIADVPSFFEHFYGPTYITERDIWPDMEEIWKK-I 459

Query: 309 DLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERF 368
           +     G   K  ++  + GTM W +P+ L  L  + +     EE  L   ++ HA ER 
Sbjct: 460 NFENPRGLKQKDSYVMSY-GTMIWYRPQALNNLLKVDIEAAVPEEP-LPYNSILHAFERL 517

Query: 369 FACS 372
              +
Sbjct: 518 LVYT 521


>gi|306831662|ref|ZP_07464819.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325978600|ref|YP_004288316.1| rhamnosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|304426087|gb|EFM29202.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325178528|emb|CBZ48572.1| rhamnosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 586

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 108/232 (46%), Gaps = 20/232 (8%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANK-DFEQDVLKYFPSAQLYVME 207
           K+A+ +H +Y D   E  +     +FD+DLF+T   EA K + E  + K    AQ+++  
Sbjct: 288 KVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIESILEKNGKIAQVFLTG 347

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N+GRD+ P L L E      YDY+   H KKS    Y    G  WR  L+  L+  +D  
Sbjct: 348 NRGRDIIPMLKLKE--ELSSYDYIGHFHTKKSPEYPY--WVGDSWRNELYQMLIQSAD-- 401

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKR----WS---FFAKRSEVYRRVIDLAKRAGFPT 318
             I+   E N  LG++ +    + RY +    W+   F    +E++ R ++L ++  F  
Sbjct: 402 -NILANLENNDNLGLVIADIPSFFRYTKIVDPWNENRFADGMNELWER-MNLERQIDFNN 459

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
               +  + GT  W K   L+PL +L L  +      +    + H++ER   
Sbjct: 460 LSTFIMSY-GTFIWFKRDTLKPLFDLELTDDEIPSEPIPQHTILHSIERILV 510


>gi|119026520|ref|YP_910365.1| hypothetical protein BAD_1502 [Bifidobacterium adolescentis ATCC
           15703]
 gi|118766104|dbj|BAF40283.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703]
          Length = 647

 Score = 68.6 bits (166), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 101/230 (43%), Gaps = 12/230 (5%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFP-SAQLYVME 207
           +IA+++H YY D   +       +    D   TV  E N    ++  K  P +  + V++
Sbjct: 309 RIALIMHLYYMDLLDKTLEYAKSMPEGCDFIFTVGSEENAKLVRERCKGLPYNVDVRVIQ 368

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFDLLGFSDI 266
           N+GRDV   L         +YDY+C  H KK +Q   Y   +G  ++   F ++LG   +
Sbjct: 369 NRGRDVSALLIGAGKDCL-KYDYVCFAHDKKVTQLSPYSIGDGFAYK--CFENILGSKAL 425

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK----RSEVYRRVIDLAKRAGFPTKRLH 322
              IIN FEQ+P  G++          +  FA       E  +++++       P     
Sbjct: 426 VSNIINHFEQDPHAGLLAPTSPNHADYFGNFASLWGPNFEGTKKMLEETLGVKVPLNPYK 485

Query: 323 LDFFN-GTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFA 370
                 GTMFW +PK L  L ++    E F  E N  DG++ H +ER + 
Sbjct: 486 EPIAPLGTMFWFRPKALHQLFDIDWKYEDFPPEPNKIDGSMLHFIERAYG 535


>gi|90425670|ref|YP_534040.1| glycosyl transferase, group 1 [Rhodopseudomonas palustris BisB18]
 gi|90107684|gb|ABD89721.1| glycosyl transferase, group 1 [Rhodopseudomonas palustris BisB18]
          Length = 846

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 117/251 (46%), Gaps = 21/251 (8%)

Query: 136 RPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDV 194
           RP  P++     + +IAI  H YY D       ++       DLF+T     +  + +  
Sbjct: 583 RPE-PRRESNAARPRIAIHGHFYYPDLLESFLKLIAANASSVDLFLTTSGPEQAAQIRKS 641

Query: 195 LKYF--PSAQLYVMENKGRDVRPFLYLL--ELGVFDRYDYLCKIHGKKSQREGYHPIEGI 250
           L+ F   +A ++ + N+GRD+ PFL  +  +LG    YD +   HGK+S+        G 
Sbjct: 642 LRAFGIQNADVWSVPNRGRDIGPFLKEMPDKLG---SYDIVGHFHGKRSKH--VDSTVGD 696

Query: 251 IWRRWLFFDLLGFSDIAIRII-NTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID 309
            WR + +  L+G +   I +I + F ++  LG++    +      + + +  ++  R+  
Sbjct: 697 QWRDFAWQHLIGDAFPMIDVIADAFAEDAKLGLV----FAEDPYLNGWDENRDLAERLAQ 752

Query: 310 LAK-RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVER 367
             K  A  P    H DF  GTMFW +   L+PL  L+L   ++  E    DG + HA+ER
Sbjct: 753 RMKIEAPLPE---HFDFPIGTMFWARVAALQPLFQLNLDWNDYPHEPLPIDGTILHALER 809

Query: 368 FFACSVRYTEF 378
               +V+ + F
Sbjct: 810 IVPFAVQKSGF 820


>gi|260890969|ref|ZP_05902232.1| O-antigen export system ATP-binding protein RfbB [Leptotrichia
           hofstadii F0254]
 gi|260859295|gb|EEX73795.1| O-antigen export system ATP-binding protein RfbB [Leptotrichia
           hofstadii F0254]
          Length = 709

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 113/247 (45%), Gaps = 34/247 (13%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK---YFPSAQLY 204
           + K+ ++ H Y++D   E  H +  +    DL +T        + +       F + ++ 
Sbjct: 150 EDKVLLIFHIYFEDLLDESIHYMKSMPETSDLLITTPRKELKEKIEEKVRGLNFRNIEVR 209

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS-QREGYHPIEGIIWRRWLFFDLLGF 263
           V+EN+GRDV   L   +  V + YDY+C +H KK+ Q + Y  +  +          L  
Sbjct: 210 VIENRGRDVSSLLVGAKDAVMN-YDYVCFMHDKKTAQLKPYSSLNDVYINYCK--GTLAT 266

Query: 264 SDIAIRIINTFEQNPCLGMI-------GSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
                 +I TF++NP LGM+       G+  +     WS   K++E       L K+ G 
Sbjct: 267 KKYVKNLIGTFKENPRLGMLMPPPPNHGNFFHIIGNEWSSNFKKTE------KLIKKLG- 319

Query: 317 PTKRLHLDF-FN-------GTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER 367
               L++DF +N       GTMFW +P+ L+ L +      +F EE N  DG + HAVER
Sbjct: 320 ----LNVDFHWNLEPISPLGTMFWFRPRALKKLFDYGWEYSDFPEEPNEHDGTILHAVER 375

Query: 368 FFACSVR 374
            +   V+
Sbjct: 376 VYGFVVQ 382


>gi|304309760|ref|YP_003809358.1| hypothetical protein HDN1F_01080 [gamma proteobacterium HdN1]
 gi|301795493|emb|CBL43691.1| hypothetical protein HDN1F_01080 [gamma proteobacterium HdN1]
          Length = 1315

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 60/232 (25%), Positives = 99/232 (42%), Gaps = 16/232 (6%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSAQ-- 202
           T  + IAI +H YY D        L R+   FDL++++ V AN    + V++  P  +  
Sbjct: 440 TSNATIAIHIHLYYADLAPTFVQALSRMERPFDLYISIQVRANPVEIEAVVRKIPCLRGL 499

Query: 203 -LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            +    N GRD+ PF+ +       +YD +  +H KKS    Y+      W  ++   L 
Sbjct: 500 DIRATPNLGRDLYPFVCIFG-EALRKYDIIAHLHSKKSL---YNQGATAGWLEYILDSLF 555

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYR--RYKRWSFFAKRSEVYRRVIDLAKRAGFPT- 318
              +   RI+         G++  + +    Y  +++ A RS    R   +  R G  + 
Sbjct: 556 RSPEDIARILERLSDASQTGIVYPQNFSGLPYMAYTWLANRS----RAQQVQARFGLTSL 611

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
              + D+  G+MFW +   + P     L   +FE E    DG L H +ERF 
Sbjct: 612 PSGYFDYPAGSMFWARADAIAPFFEAQLNEDDFENESGQTDGTLAHTLERFL 663


>gi|227546966|ref|ZP_03977015.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|227212567|gb|EEI80455.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
          Length = 631

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 104/236 (44%), Gaps = 24/236 (10%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFP-SAQLYVME 207
           KIA+ +H YY D      H +  +    D+ +TV  EAN +  ++  K FP +  + V+E
Sbjct: 310 KIALAIHVYYMDLLESTFHYIQSMPEGCDIIITVGSEANAETVREYCKQFPYNFDVRVIE 369

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI-EGIIWRRWLFFDLLGFSDI 266
           N+GRDV   L      +F +YDY+C  H KK  +     I +G  ++   F ++L   + 
Sbjct: 370 NRGRDVSALLVGCGEDLF-QYDYVCFAHDKKVTQLSPQSIGDGFAYK--CFENILASKEY 426

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFF 326
              +I+ FE+NP LG+            S+F   +  +       K     T  +H+   
Sbjct: 427 VSNVIDLFERNPRLGIAMPTPPNHA---SYFPGYTFPWGPNFPGTKDFLEQTLNMHVPLN 483

Query: 327 N--------GTMFWVKPKCLEPLRNLHLIG----EFEEERNLKDGALEHAVERFFA 370
                    GTMFW +P   E  R L   G    +F  E N  DG L H +ER + 
Sbjct: 484 ADKEPVAPMGTMFWFRP---EAFRGLLDHGWEYTDFPPEPNKVDGTLLHFIERAYG 536


>gi|322385732|ref|ZP_08059376.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           cristatus ATCC 51100]
 gi|321270470|gb|EFX53386.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           cristatus ATCC 51100]
          Length = 598

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 113/249 (45%), Gaps = 22/249 (8%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--VLKYFPSAQLYVME 207
           KIA+ +H YY D   +        +F +DLF+T     K  E +  +LK     ++Y+  
Sbjct: 288 KIAVHLHTYYVDLLEDFLKQFENFHFTYDLFLTTDSEKKKLEIEAVLLKRNQLGKIYITG 347

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           NKGRD+ P L L E      YDY+   H KKS    Y    G  WR  LF  LL  +D+ 
Sbjct: 348 NKGRDIIPMLKLRE--ELCTYDYIGHFHTKKSPEYPY--WVGDSWRNELFDMLLKPADL- 402

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKR----WSF--FAKRSEVYRRVIDLAKRAGFPTK 319
             I+ + E +  LG++ +    + RY +    W+   FA    +    +D+ +   F   
Sbjct: 403 --IMASLENDKRLGLVIADIPTFFRYTKIVDPWNENKFADDMNILWERMDINRSIDFNKL 460

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVER---FFACSVRYT 376
              +  + GT  W K   L+PL +L+L  E      L    + H++ER   + A S R+ 
Sbjct: 461 NTFIMSY-GTFIWFKYDALKPLFDLNLQDEDIPSEPLPQHTILHSIERILVYLAWSQRF- 518

Query: 377 EFSIESVDC 385
           +++I   D 
Sbjct: 519 DYAISKNDI 527


>gi|222152862|ref|YP_002562039.1| rhamnan synthesis protein F family protein [Streptococcus uberis
           0140J]
 gi|222113675|emb|CAR41606.1| rhamnan synthesis protein F family protein [Streptococcus uberis
           0140J]
          Length = 585

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 106/229 (46%), Gaps = 19/229 (8%)

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLKYF-PSAQLYVMEN 208
           IA+ +H +Y D   E  H      F FDL++T  ++ K+ E + +L  F  SA++ V  N
Sbjct: 288 IAVHLHVFYVDLLEEFLHAFTSFKFPFDLYITTDKSEKESEIKAILDSFRVSAKIVVTGN 347

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAI 268
            GRDV P L L +     +YDY+   H KKS+   +   E   WR  L   L+     A 
Sbjct: 348 IGRDVLPMLKLKD--ELSQYDYIGHFHTKKSKEADFWAGES--WRNELIDMLIK---PAN 400

Query: 269 RIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFF 326
            IIN FE +P +G+I +    + R+ +         +   +  L ++    +K +  + F
Sbjct: 401 TIINQFE-DPAIGIIIADIPSFFRFNKIVTPLNEHLIAPEMNKLWEKMNL-SKTIDFEQF 458

Query: 327 N------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           +      GT  W K   L+PL +L+L      +  L   ++ HAVER  
Sbjct: 459 DTFVMSYGTFVWFKYDALKPLFDLNLKDGDVPKEPLPQNSILHAVERLL 507


>gi|312867647|ref|ZP_07727853.1| rhamnan synthesis protein F [Streptococcus parasanguinis F0405]
 gi|311096710|gb|EFQ54948.1| rhamnan synthesis protein F [Streptococcus parasanguinis F0405]
          Length = 582

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 101/232 (43%), Gaps = 22/232 (9%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT--VVEANKDFEQDVLKYFPSAQLYVME 207
           K+A+ +H +Y D   E        +F +DL++T  V E  +  E+ +      A + V  
Sbjct: 285 KVAVHLHVFYVDLLEEFLDAFQAFHFVYDLWITTDVEEKKQTIEKILSNRAQDATVVVTG 344

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N GRDV P L L E     +YDY+   H KKS+   +   E   WR+ L   L+  +D  
Sbjct: 345 NIGRDVLPMLLLKEQ--LSQYDYVGHFHTKKSKEADFWAGES--WRKELIEMLVKPAD-- 398

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDF 325
            +I+   E NP +G+  +    + RY R       + +   +  L +R G       +DF
Sbjct: 399 -QILANMEANPKVGITIADIPTFFRYNRIVVAWNEALISPEMNKLWERMGAAKT---IDF 454

Query: 326 FN--------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
            N        GT  W K   L+PL +L+L         L   ++ HA+ER  
Sbjct: 455 KNLNTFVMSYGTFVWFKYDALKPLFDLNLTAANVPAEPLPQNSILHAIERLL 506


>gi|322373386|ref|ZP_08047922.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus sp.
           C150]
 gi|321278428|gb|EFX55497.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus sp.
           C150]
          Length = 594

 Score = 67.8 bits (164), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 119/262 (45%), Gaps = 26/262 (9%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV--VEANKDFEQDVL 195
            SP+    T   KIA+ +H YY D   +        +F +DLF+T    E  K+ +  + 
Sbjct: 278 DSPQDYSDT--KKIAVHLHTYYVDLLDDFLRQFENFHFTYDLFLTTDSEEKKKEIQSILD 335

Query: 196 KYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRW 255
           K+   A++++  N+GRDV P L L +      YDY+   H KKS    Y    G  WR  
Sbjct: 336 KHGKEARIFITGNRGRDVIPMLKLKD--ELSAYDYIGHFHTKKSPEYPY--WVGDSWRNE 391

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKR----WS---FFAKRSEVYRR 306
           LF  L+  +D    II   E +  LG++ +    + RY +    W+   F    ++++ R
Sbjct: 392 LFSMLIQPAD---NIIANLEHDDRLGLVIADIPTFFRYTKIVDPWNENRFAEGMNDLWER 448

Query: 307 VIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVE 366
            +DL +   F      +  + GT  W K   L+PL +L L  E      +    + H++E
Sbjct: 449 -MDLGRDIDFDKMNTFIMSY-GTFIWFKYDTLKPLFDLDLQDEEIPAEPIPQHTILHSIE 506

Query: 367 R---FFACSVRYTEFSIESVDC 385
           R   + A + RY +++I   D 
Sbjct: 507 RILVYLAWARRY-DYAIAKNDI 527


>gi|325067622|ref|ZP_08126295.1| hypothetical protein AoriK_07369 [Actinomyces oris K20]
          Length = 626

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 100/230 (43%), Gaps = 12/230 (5%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQLYVME 207
           KIA++ H YY D        +  +    DL +TV    K +  ++  K  P +  + ++E
Sbjct: 309 KIALIAHLYYMDLLEPTLAYVKSMPEGTDLILTVGSQEKAELVEEACKDLPYNVTVRLIE 368

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFDLLGFSDI 266
           N+GRDV   L   +  + D YD +C  H KK +Q + Y   +G   +   F +LL   D 
Sbjct: 369 NRGRDVSALLVGCKDIIHD-YDLVCFTHDKKVTQVKPYSVGDGFAIK--CFENLLATRDF 425

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA----KRSEVYRRVIDLAKRAGFPTKRLH 322
              +I TF+  P LG++          +  F+       E  + +++       P     
Sbjct: 426 VKNVIATFDAEPRLGLLAPTPPNHGDYFPVFSMGWGPNFERTKTLLEKELNLSVPIDESR 485

Query: 323 LDFFN-GTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFA 370
                 GTMFW +P  L+PL +     E F  E N  DG + HA+ER + 
Sbjct: 486 APIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEPNNIDGTILHAIERAYG 535


>gi|225352528|ref|ZP_03743551.1| hypothetical protein BIFPSEUDO_04151 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156722|gb|EEG70116.1| hypothetical protein BIFPSEUDO_04151 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 648

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 104/237 (43%), Gaps = 12/237 (5%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFP-S 200
           + +    +IA+++H YY D   +       +    D   TV  E N    ++  K  P +
Sbjct: 303 APIPTNKRIALIMHLYYMDLLDKTLEYAKSMPEGCDFIFTVGSEENATIVRERCKDLPYN 362

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFD 259
             + V++N+GRDV   L         +YDY+C  H KK +Q   Y   +G  ++   F +
Sbjct: 363 VDVRVIQNRGRDVSALLVGAGKDCL-QYDYVCFAHDKKVTQLSPYSIGDGFSYK--CFEN 419

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK----RSEVYRRVIDLAKRAG 315
           +LG   +   IIN FE +P  G++          +  FA       E  +++++   +  
Sbjct: 420 VLGSKALVSNIINHFENDPHAGVLAPAPPNHADYFGNFASLWGPNYEGTKKMLEETLQVK 479

Query: 316 FPTKRLHLDFFN-GTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFA 370
            P  +        GTMFW +PK L+   ++    E F  E N  DG++ H VER + 
Sbjct: 480 VPLDKSKEPIAPMGTMFWFRPKALQQFFDIDWKYEDFPPEPNKIDGSMLHFVERAYG 536


>gi|312866008|ref|ZP_07726229.1| rhamnan synthesis protein F [Streptococcus downei F0415]
 gi|311098412|gb|EFQ56635.1| rhamnan synthesis protein F [Streptococcus downei F0415]
          Length = 584

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 105/235 (44%), Gaps = 18/235 (7%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLKYFPS-AQ 202
           L  +SK+A+ +H +Y D   E        +F +DLF+T  +  K  E Q +L+     AQ
Sbjct: 281 LPAESKVAVHLHVFYVDLLQEFLDAFKTFHFAYDLFITTDKEEKRAEIQAILEQNQVLAQ 340

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           ++V  N GRDV P L L +      YDY+   H KKS+   Y    G  WR+ L   L+ 
Sbjct: 341 IFVTGNIGRDVLPMLKLKDQ--LKGYDYIGHFHTKKSKEADYW--AGQSWRQELIAMLVK 396

Query: 263 FSDIAIRIINTFEQNPCLGMIGSR--RYRRYKR----W--SFFAKRSEVYRRVIDLAKRA 314
            ++   +I+    +N  LG++ +    + R+ +    W  +  A   E     + L K  
Sbjct: 397 PAN---QILAQMAKNDRLGIVIADMPSFFRFNKIVVAWNENLIAPEMEELWEKMSLKKSI 453

Query: 315 GFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
            F      +  + GT  W K   L PL +L L  E+     L   ++ HA+ER  
Sbjct: 454 DFKAMDTFVMSY-GTYAWFKYDALSPLFDLDLTDEYVPAEPLPQNSILHAIERLL 507


>gi|261868364|ref|YP_003256286.1| lipopolysaccharide biosynthesis protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|3132260|dbj|BAA28137.1| unnamed protein product [Actinobacillus actinomycetemcomitans]
 gi|261413696|gb|ACX83067.1| lipopolysaccharide biosynthesis protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 632

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 110/254 (43%), Gaps = 33/254 (12%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE---QDVLKYFPSAQL--- 203
           KI +V H YY D   EI      +   +DL +T        E     +LK   +  +   
Sbjct: 295 KILVVAHIYYSDMLDEIISYTQNIPCSYDLLITTANEKSKLEIESNPILKMSGAKGINVK 354

Query: 204 YVMENKGRDVRP-FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
            V +N+GRD+   F+   +  + +RYD++C++H KKS +  ++    I ++  ++ ++L 
Sbjct: 355 VVEQNRGRDMSSLFITCKQEIISERYDWVCRLHSKKSPQNSHN--MSIHFKEMMYLNILK 412

Query: 263 FSDIAIRIINTFEQNPCLG-----MIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFP 317
                 ++IN  ++N  +G     M+          W  F  R       I +A+R G  
Sbjct: 413 DKAYISKVINYLDKNKSIGFAMPSMVHIGHPTLGHAW--FTNRD----LAIKIAERVGIK 466

Query: 318 TKRLHLDFFN--GTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER------- 367
                +  F   GTMFW +P+ L+ L   +    +F +E   +D +L H +ER       
Sbjct: 467 LPFDDISPFAAYGTMFWFRPEALKKLFEYNWKFEDFNKEPMHQDSSLAHILERLLVYAAH 526

Query: 368 ---FFACSVRYTEF 378
              + AC++   E 
Sbjct: 527 DAGYLACNIMSAEM 540


>gi|262282406|ref|ZP_06060174.1| rhamnosyltransferase [Streptococcus sp. 2_1_36FAA]
 gi|262261697|gb|EEY80395.1| rhamnosyltransferase [Streptococcus sp. 2_1_36FAA]
          Length = 582

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 108/232 (46%), Gaps = 20/232 (8%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPS-AQLYVME 207
           KIA+ +H +Y D   E  H     +F +DLF+T   E  K+   D+L+   + A++ V  
Sbjct: 284 KIAVHLHVFYVDLLAEFLHAFESFHFSYDLFITTDSEKKKNEILDILEGKQAKAEVLVTG 343

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N GRDV P L L       +YDY+   H KKS+   Y   E   WR+ L   L+  +D  
Sbjct: 344 NVGRDVLPMLKLKRH--LSQYDYIGHFHTKKSKEADYWAGES--WRKELINMLVHPAD-- 397

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKR----WS---FFAKRSEVYRRVIDLAKRAGFPT 318
            +I++   Q+  LG++ +    + R+ R    W+      + ++++ R ++  K   F  
Sbjct: 398 -QIVSQLGQDDRLGLVIADIPSFFRFNRIVVAWNEALISPEMNKLWER-MNCQKEVDFKQ 455

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
               +  + GT  W K   L PL +L+L  E      L   ++ HA+ER   
Sbjct: 456 MNTFVMSY-GTFVWFKYDALSPLFDLNLTEEDVPSEPLPQNSILHAIERLLV 506


>gi|23009067|ref|ZP_00050256.1| COG3754: Lipopolysaccharide biosynthesis protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 486

 Score = 66.6 bits (161), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 96/223 (43%), Gaps = 13/223 (5%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFPSA--QLY 204
            ++I +  H ++ D    +      + FD  ++VT   A+K DF +           ++ 
Sbjct: 272 NARIGVFAHIFHTDLCEYVLKYTNNIPFDTTVYVTTSSASKADFIRKTFGRLSKHRYEIV 331

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGI-IWRRWLFFDLLGF 263
           +  N+GRD+ P L       F   DY   +H KKS     H   G   WR +LF   LG 
Sbjct: 332 IAPNRGRDIAPMLVGYR-NAFQNCDYAVHVHTKKS----LHYSSGFDAWRDYLFEMNLGS 386

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
           +++   I+N   ++  +G +    Y    +   +    +    ++     +   ++ + L
Sbjct: 387 AELITGIVNVLSRS-NIGAVAPDHYAPIAKLIQWGGNIDAINGLLSFTGLS-VASENV-L 443

Query: 324 DFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAV 365
           DF +G+MFW KP  L  L  +HL    F+ E    DG L HA+
Sbjct: 444 DFPSGSMFWFKPDALSKLMEIHLQSYHFDPELGQVDGTLAHAI 486


>gi|288905572|ref|YP_003430794.1| polysaccharide biosynthesis protein (RgpF) [Streptococcus
           gallolyticus UCN34]
 gi|288732298|emb|CBI13867.1| Putative polysaccharide biosynthesis protein (RgpF) [Streptococcus
           gallolyticus UCN34]
          Length = 586

 Score = 66.6 bits (161), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 104/231 (45%), Gaps = 18/231 (7%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANK-DFEQDVLKYFPSAQLYVME 207
           K+A+ +H +Y D   E  +     +FD+DLF+T   EA K + E  + K    AQ+++  
Sbjct: 288 KVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIESILEKNGKIAQVFLTG 347

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N+GRD+ P L L E      YDY+   H KKS    Y    G  WR  L+  L+  +D  
Sbjct: 348 NRGRDIIPMLKLKE--ELSSYDYIGHFHTKKSPEYPY--WVGDSWRNELYQMLIQSAD-- 401

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKR----WSF--FAKRSEVYRRVIDLAKRAGFPTK 319
             I+   E N  LG++ +    + RY +    W+   FA         ++L ++  F   
Sbjct: 402 -NILANLENNDNLGLVIADIPSFFRYTKIVDPWNENRFADGMNELWECMNLERQIDFNNL 460

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
              +  + GT  W K   L+PL +L L  +      +    + H++ER   
Sbjct: 461 STFIMSY-GTFIWFKRDTLKPLFDLELTDDEIPSEPIPQHTILHSIERILV 510


>gi|55821450|ref|YP_139892.1| polysaccharide biosynthesis protein [Streptococcus thermophilus LMG
           18311]
 gi|55737435|gb|AAV61077.1| polysaccharide biosynthesis protein [Streptococcus thermophilus LMG
           18311]
          Length = 594

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 116/250 (46%), Gaps = 24/250 (9%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVL-KYFPSAQLYVME 207
           KIA+ +H YY D   +        +F +DLF+T    +K  E Q +L K    A++++  
Sbjct: 288 KIAVHLHTYYVDLLEDFLKQFENFHFTYDLFLTTDSEDKKAEIQSILDKNGKVARIFITG 347

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N+GRDV P L L +      YDY+   H KKS    Y    G  WR  LF  L+  +D  
Sbjct: 348 NRGRDVIPMLKLKD--ELSAYDYIGHFHTKKSPEYPY--WVGDSWRNELFSMLIQPAD-- 401

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKR----WS---FFAKRSEVYRRVIDLAKRAGFPT 318
             II   E++  LG++ +    + RY +    W+   F    ++++ R +DL +   F  
Sbjct: 402 -NIIANLERDDRLGLVIADIPSFFRYTKIVDPWNENRFAEGMNDLWER-MDLGRDIDFDK 459

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVER---FFACSVRY 375
               +  + GT  W K   L+PL +L L  E      +    + H++ER   + A + RY
Sbjct: 460 MNTFIMSY-GTFIWFKYDALKPLFDLDLQDEEIPAEPIPQHTILHSIERILVYLAWARRY 518

Query: 376 TEFSIESVDC 385
            +++I   D 
Sbjct: 519 -DYAIAKNDI 527


>gi|258654317|ref|YP_003203473.1| Rhamnan synthesis F [Nakamurella multipartita DSM 44233]
 gi|258557542|gb|ACV80484.1| Rhamnan synthesis F [Nakamurella multipartita DSM 44233]
          Length = 631

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 106/246 (43%), Gaps = 18/246 (7%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVLKY-FPSAQLYVM 206
           +I ++ H +Y+D   E+   +  +   FDL VT   A K    E  +  Y   S ++ ++
Sbjct: 297 RICVLAHIFYEDMTDEMMGWIGNIPVPFDLVVTTTSAAKKEAIESALEAYALKSVEVRLV 356

Query: 207 E-NKGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
           E N+GR    FL    ++     YD + KIH KKS + G +   G +++     +LL   
Sbjct: 357 ESNRGRAESAFLIACRDVLTSGEYDLVLKIHSKKSPQNGAN--LGQLFKHHSVDNLLSSP 414

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYR---RYKRWSFFAKRSEVYRRVIDLAKRAGFPT--K 319
                I+  F+  P LGM+              S+F  R   +    +LA + G  T   
Sbjct: 415 GYVASILGMFQSQPSLGMVFPPVVNIGFPTLGHSWFTNREAAH----ELADQLGIHTIFD 470

Query: 320 RLHLDFFNGTMFWVKPKCLEPL-RNLHLIGEF-EEERNLKDGALEHAVERFFACSVRYTE 377
           R      NGTMFW +P+ L  L R+     +F  E     DG L H +ER +  +V    
Sbjct: 471 RTTPLAPNGTMFWARPESLAKLARHDFDYSQFAAEHEGWSDGMLGHVIERLYGYAVLDAG 530

Query: 378 FSIESV 383
             I+ V
Sbjct: 531 LRIQCV 536


>gi|83582737|ref|YP_425043.1| glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
 gi|83578053|gb|ABC24603.1| Glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
          Length = 1236

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 114/254 (44%), Gaps = 26/254 (10%)

Query: 139  SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD-FEQDVLKY 197
            SP + G     K+ +  H YY D   +    ++  +F  DL +T  + ++  F +  L+ 
Sbjct: 981  SPIEGG-----KVLLHGHFYYVDLIDDFLKKIIINDFSCDLIITTTDEDRAVFLRKKLEE 1035

Query: 198  FP--SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGII--WR 253
            +   S ++ V+ N GRDV  F   L       YD +  IHGKKS     H  +G    WR
Sbjct: 1036 YKNGSVEVRVVPNIGRDVGAFFTGLSDLKNSDYDVVGHIHGKKS----IHLSDGTGNKWR 1091

Query: 254  RWLFFDLLGFSDIAIRI-INTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAK 312
             +L+  L+G    A  I ++   +NP +G++       +    F     +      DLAK
Sbjct: 1092 NFLWEHLIGGEKKAAAIAVSALIRNPDIGLV-------FAEEPFLFGWDKNKELANDLAK 1144

Query: 313  RAGFPTKRLH--LDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFF 369
            + G   K L    D+  GTMFW K K LEP+ +L+L  E +  E     G + HA+ER  
Sbjct: 1145 KMGI-EKSLPRFFDWPIGTMFWAKRKALEPIFDLNLRWEDYPPEPIPVYGTMLHALERLL 1203

Query: 370  ACSVRYTEFSIESV 383
              +V    FS  + 
Sbjct: 1204 PFAVEKAGFSFATT 1217


>gi|171779906|ref|ZP_02920810.1| hypothetical protein STRINF_01693 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281254|gb|EDT46689.1| hypothetical protein STRINF_01693 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 592

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 102/230 (44%), Gaps = 19/230 (8%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYVME 207
           KIA+ +H +Y D   +        +F +DLF+T   A K  + E  +      AQ++V  
Sbjct: 291 KIAVHLHVFYVDLLEDFLDAFENFHFVYDLFITTDNATKKQEIESILRSNGKDAQIFVTG 350

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N GRDV P L L +      YDY+   H KKS+   +   E   WR  L   L+  +D  
Sbjct: 351 NVGRDVLPMLKLKDY--LSDYDYIGHFHTKKSKEADFWAGES--WRNELIDMLIKPAD-- 404

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDF 325
             I+  F+ N  LG++ +    + R+ +         +   + DL ++ G  TK +  + 
Sbjct: 405 -NILANFD-NDKLGIVIADIPTFFRFNKIVDAWNEHLIAPAMNDLWQQMGM-TKAIDFNN 461

Query: 326 FN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           F+      GT  W K   L+PL +L L  E      L   ++ HA+ER  
Sbjct: 462 FHNFVMSYGTYVWFKYDALKPLFDLGLTDEDVPAEPLPQNSILHAIERLL 511


>gi|326772082|ref|ZP_08231367.1| rhamnan synthesis protein F [Actinomyces viscosus C505]
 gi|326638215|gb|EGE39116.1| rhamnan synthesis protein F [Actinomyces viscosus C505]
          Length = 652

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 100/230 (43%), Gaps = 12/230 (5%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQLYVME 207
           K+A++ H YY D           +    D  +TV    K +  ++  K  P +  + ++E
Sbjct: 335 KVALIAHLYYMDLLEPTLAYARSMPEGTDFILTVGSQEKVELVEEACKDLPYNVTVRLIE 394

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFDLLGFSDI 266
           N+GRDV   L   +  V D YD +C IH KK +Q   Y   EG  + R  F +LL   + 
Sbjct: 395 NRGRDVSALLVGCKDIVSD-YDLVCFIHDKKVTQLSPYTVGEG--FARKCFDNLLPTREF 451

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR--SEVYRRVIDLAKRAGFPTK-RLHL 323
              +I+TF+  P LG++          +  ++        R  + L K          H 
Sbjct: 452 VENVISTFDSEPRLGLLSPTPPNHADYFPIYSYSWGPNFDRTKMLLEKELNLSVPLDAHK 511

Query: 324 DFFN--GTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFA 370
           +     GTMFW +P  L+PL +     E F  E N  DG + HA+ER + 
Sbjct: 512 EVIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEPNDIDGTILHAIERAYG 561


>gi|71735705|ref|YP_273244.1| hypothetical protein PSPPH_0972 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556258|gb|AAZ35469.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 1262

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 107/243 (44%), Gaps = 39/243 (16%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-------------VVEANKDFEQDVLK 196
           +I + +H YY D    IS  L  +   FDLF++             V ++  + ++  +K
Sbjct: 211 RIGVYLHLYYTDLLGAISKHLNNIPLAFDLFISTPHELDHKKLRKIVSDSVTNVKEISIK 270

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELG-VFDRYDYLCKIHGKKSQREGYHPIEGII-WRR 254
           + P        N+GRD+ PF  ++E G     YD +C IH KKS+       +G+  W  
Sbjct: 271 HVP--------NRGRDIAPF--IIEFGNELQAYDAICHIHTKKSEH-----TKGLSDWGD 315

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVID---LA 311
            +   LLG  +   +I+   + +  +     + Y   K  + +++  E+ + ++      
Sbjct: 316 DILSSLLGSREDVKKILTLLKGDAKIIYPEGQNY-YMKDPTGWSENHEIAKHILSDHLET 374

Query: 312 KRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFA 370
             + FP      +F  G+MFW + + ++   N+ L  E F EE    DG L HA+ER   
Sbjct: 375 DISNFPKA----EFPEGSMFWARQEGIQSFLNIPLDWEDFPEEPIPTDGTLAHALERIIL 430

Query: 371 CSV 373
            S 
Sbjct: 431 ISA 433


>gi|311063512|ref|YP_003970237.1| lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           PRL2010]
 gi|310865831|gb|ADP35200.1| lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           PRL2010]
          Length = 631

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 102/236 (43%), Gaps = 24/236 (10%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPSA-QLYVME 207
           KIA+ +H YY D        +  +    D+ +TV  EAN +  ++  K FP    + V+E
Sbjct: 310 KIALAIHVYYMDLLESTFRYIQSMPEGCDIIITVGSEANAEIVREYCKQFPYRFDVRVIE 369

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI-EGIIWRRWLFFDLLGFSDI 266
           N+GRDV   L      +F +YDY+C  H KK  +     I +G  ++   + ++L   + 
Sbjct: 370 NRGRDVSSLLVGCGEDLF-QYDYVCFAHDKKVTQLSPQSIGDGFAYK--CYENILASKEY 426

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFF 326
              +I+ FE+NP LG+            S+F   +  +       K     T  +H+   
Sbjct: 427 VSNVIDLFEKNPRLGIAMP---TPPNHASYFPGYTFPWGPNFPGTKDFLEQTLNMHVPLN 483

Query: 327 N--------GTMFWVKPKCLEPLRNLHLIG----EFEEERNLKDGALEHAVERFFA 370
                    GTMFW +P   E  R L   G    +F  E N  DG L H +ER + 
Sbjct: 484 ANKEPVAPMGTMFWFRP---EAFRGLLDHGWKYEDFPPEPNKVDGTLLHFIERAYG 536


>gi|312133751|ref|YP_004001090.1| protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773029|gb|ADQ02517.1| Hypothetical protein BBMN68_1492 [Bifidobacterium longum subsp.
           longum BBMN68]
          Length = 641

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 99/230 (43%), Gaps = 11/230 (4%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD-FEQDVLKYFP-SAQLYV 205
           K ++A+V+H YY D   +I      +    D+ +TV    K    ++  +  P +  + V
Sbjct: 308 KFRVALVLHLYYMDILDQILRYARSMPEGCDVIITVGSEEKACIVKERCEGMPYNIDVRV 367

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
           +EN+GRDV   L      V + YD +C  H KK ++     I G  + +  F + L    
Sbjct: 368 IENRGRDVSALLVGAGKDVLN-YDLVCFAHDKKVRQLRPETI-GDGFAKKCFENTLASKA 425

Query: 266 IAIRIINTFEQNPCLG--MIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK-RLH 322
               IIN F  NP LG  M  +  +  Y  +S+       YR   DL    G       H
Sbjct: 426 YVANIINLFADNPRLGVAMPSAPNHADY-FYSYAFSWGPNYRGTKDLLDGLGIKVPLSPH 484

Query: 323 LDFFN--GTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
            D     GTMFW +PK L  L +      +F  E N  DG+  H VER +
Sbjct: 485 ADVIAPLGTMFWFRPKALHGLIDKSWEYSDFPPEPNPADGSFLHFVERAY 534


>gi|262038042|ref|ZP_06011449.1| lipopolysaccharide biosynthesis protein [Leptotrichia goodfellowii
           F0264]
 gi|261747934|gb|EEY35366.1| lipopolysaccharide biosynthesis protein [Leptotrichia goodfellowii
           F0264]
          Length = 629

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 111/240 (46%), Gaps = 21/240 (8%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL--KYFPSAQLYVME 207
           K+ +  H Y++D   E     L +    D+F+T  +  K  + + +  K      + V++
Sbjct: 304 KVGLFFHIYFEDLIEECYRYALNMPEYADIFITTDKEEKKEKIEKIFSKMKNKIDIKVIQ 363

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP-IEGIIWRRWLFFDLLGFSDI 266
           N+GRDV  FL   +  +  +YDY C  H KK+++    P I+G  ++   F ++LG  ++
Sbjct: 364 NRGRDVSAFLIPNKEEIL-KYDYACFAHDKKTKQ--LQPEIKGEDFKFRCFENILGSKEL 420

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR-----SEVYRRVIDLAKRAGFPTKRL 321
              II  F +NP LG++        + +    +      ++ Y    +L K        +
Sbjct: 421 VENIIGLFIENPRLGLLSPPSPNHAEFYGNLGREWGHSGNDNYEETCNLLKEL---VIEV 477

Query: 322 HLDFFN------GTMFWVKPKCLEP-LRNLHLIGEFEEERNLKDGALEHAVERFFACSVR 374
           ++D         GT+FW +PK LE  L+      +F +E N  DG L HA+ER +   V+
Sbjct: 478 NVDISKAPVAPYGTIFWFRPKSLEKLLKKGWKYEDFPKEPNKVDGTLLHAIERVYPFVVQ 537


>gi|323135560|ref|ZP_08070643.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
 gi|322398651|gb|EFY01170.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
          Length = 812

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 100/225 (44%), Gaps = 19/225 (8%)

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLF-VTVVEANKDFEQDVLKYFPSA--QLYVME 207
           IA +VH +Y +    +   L  +    DLF  T  +  K   +DV + +P    ++ +  
Sbjct: 147 IAAIVHGFYPEIAPLVLEKLKNVTGPVDLFFSTDTQEKKHALEDVCRDWPKGRVEIRICP 206

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N+GRD+    +     V+  YD    +H K+S   G        WR +LF +LLG  +I 
Sbjct: 207 NRGRDIAAKFFGFR-DVYADYDLFIHLHTKRSPHGGAALAR---WRDYLFDNLLGSPEIV 262

Query: 268 IRIINTFEQNPCLGMIGSR---RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT-KRLHL 323
             I++ F+ +P +G++  +     R    W +       Y     L KR G    K L L
Sbjct: 263 NSILSLFD-DPKIGVVFPQHLFELRGILNWGY------DYDHARALMKRMGVEIDKNLVL 315

Query: 324 DFFNGTMFWVKPKCLEP-LRNLHLIGEFEEERNLKDGALEHAVER 367
           +F +G+MFW +     P L       +F +E    DG L HA+ER
Sbjct: 316 EFPSGSMFWGRSAAFRPLLDLDIDFDDFPQEGGQVDGTLAHAIER 360


>gi|320531350|ref|ZP_08032322.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320136441|gb|EFW28417.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 626

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 102/237 (43%), Gaps = 22/237 (9%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQLYV 205
           + K+A++ H Y+ D           +    DL +TV    K +  +   +  P +  + V
Sbjct: 307 QQKVALIAHLYFMDLLDSTLAYARSMPEGTDLILTVGSQEKAELVERACQDLPYNVDVRV 366

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFDLLGFS 264
           +EN+GRDV   L   +  + D YD +C +H KK +Q   Y   EG  + R  F +LL   
Sbjct: 367 IENRGRDVSALLVGCK-DIVDDYDLVCFMHDKKVTQLSPYTVGEG--FARKCFDNLLPTR 423

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLD 324
           +    ++ TF+  P LG++          +  ++     Y    +  +      K L+L+
Sbjct: 424 EFVENVVATFDSEPRLGLLSPTPPNHADYFPIYS-----YSWGPNFDRTKMLLEKELNLN 478

Query: 325 F----------FNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFA 370
                        GTMFW +P  L+PL +     E F  E N  DG + HA+ER + 
Sbjct: 479 VPLDAHKEVIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEPNDIDGTILHAIERAYG 535


>gi|330882679|gb|EGH16828.1| hypothetical protein Pgy4_27710 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 608

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 98/234 (41%), Gaps = 27/234 (11%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF------PSAQL 203
            +AI +H +Y+D   + SH L       D+F+T+   N   ++  +  F       + ++
Sbjct: 100 NVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNH--KKKTIATFGQHPRVKNLKV 157

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
             + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   LL  
Sbjct: 158 SCVPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEYLLRD 213

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRV------IDLAKRAGFP 317
           ++I  R++N F  +  LG+     +     W      ++ +         ID  +  GF 
Sbjct: 214 ANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVTMNKAFMNAWHNEWQIDPCE--GF- 270

Query: 318 TKRLHLDFFNGTMFWVKPKCL-EPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
                L +  G MFW +P+ L E L   +    F +E    DG++ HA+ER   
Sbjct: 271 -----LSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIG 319


>gi|320330331|gb|EFW86314.1| hypothetical protein PsgRace4_09215 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 774

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 98/234 (41%), Gaps = 27/234 (11%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF------PSAQL 203
            +AI +H +Y+D   + SH L       D+F+T+   N   ++  +  F       + ++
Sbjct: 266 NVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNH--KKKTIATFGQHPRVKNLKV 323

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
             + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   LL  
Sbjct: 324 SCVPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEYLLRD 379

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRV------IDLAKRAGFP 317
           ++I  R++N F  +  LG+     +     W      ++ +         ID  +  GF 
Sbjct: 380 ANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVTMNKAFMNAWHNEWQIDPCE--GF- 436

Query: 318 TKRLHLDFFNGTMFWVKPKCL-EPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
                L +  G MFW +P+ L E L   +    F +E    DG++ HA+ER   
Sbjct: 437 -----LSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIG 485


>gi|291520004|emb|CBK75225.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 984

 Score = 63.2 bits (152), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 101/225 (44%), Gaps = 14/225 (6%)

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE-ANKDFEQDVLKYFPSAQLYV---M 206
           +A+ +H +Y D   E       + F FDL+++  E A+    +  +K    A   V   +
Sbjct: 329 VAVHLHLFYVDLLPEFVSYFANIPFRFDLYISCQEGADVSVIKSGVKELKMANKVVIRPL 388

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P LY+       ++DY   +H KKS    Y   E   WR++    LLG  + 
Sbjct: 389 PNRGRDLAP-LYVGFADEIRQHDYFLHVHSKKSL---YSGAEKGGWRQFSLELLLGSPEK 444

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVYRRVIDLAKRAGFPTKRLHLDF 325
              I N F +N   G++    +      ++ +   + + R++ D  +    PT     ++
Sbjct: 445 VNSIFNLF-KNKNAGLVYPDIHEEVPMIAYSWLANAGLGRKLFDEFELGEMPTV---FNY 500

Query: 326 FNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFF 369
             G+ FW +   L P+ N + I E F EE    DG L HA+ER  
Sbjct: 501 PAGSFFWARTDALMPIFNRNYIYEDFPEEAGQTDGTLAHALERII 545


>gi|330899783|gb|EGH31202.1| hypothetical protein PSYJA_20361 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 626

 Score = 62.8 bits (151), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 99/236 (41%), Gaps = 31/236 (13%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFP------SAQL 203
            +A+ +H +Y+D   + SH L       D+F+T+ +A    ++  +  F       + ++
Sbjct: 118 NVAVCLHIFYEDYIEKFSHALANFPTQVDVFITLADAKH--QKKTIAVFSKHPRVKNLKV 175

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
             + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   LL  
Sbjct: 176 RCVPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEYLLRD 231

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRW--------SFFAKRSEVYRRVIDLAKRAG 315
           ++I  R++N F  +  LG+     +     W        SF A     +     +A   G
Sbjct: 232 ANIITRLLNAFADHKDLGLYYPTTFWMMPSWVNHVTMNKSFMA----AWHNEWQIAPCDG 287

Query: 316 FPTKRLHLDFFNGTMFWVKPKCLEP-LRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           F      L +  G MFW +P+ L+  L   +    F +E    DG++ HA+ER   
Sbjct: 288 F------LSYPAGGMFWARPEALKDMLEKEYDYDFFPQEPLPNDGSMLHALERVIG 337


>gi|308235695|ref|ZP_07666432.1| hypothetical protein GvagA14_05663 [Gardnerella vaginalis ATCC
           14018]
 gi|311114292|ref|YP_003985513.1| rhamnan synthesis protein F [Gardnerella vaginalis ATCC 14019]
 gi|310945786|gb|ADP38490.1| rhamnan synthesis protein F [Gardnerella vaginalis ATCC 14019]
          Length = 637

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 108/251 (43%), Gaps = 14/251 (5%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLK 196
           SS   S  T K K+A+ +H YY D   +  H +  +    D+ +TV  + N+   +  ++
Sbjct: 303 SSTATSESTAKPKVALCMHLYYMDLLDKSLHYIQSMPQGCDVILTVGSKENQQIVKQRVE 362

Query: 197 YFP-SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI-EGIIWRR 254
           + P    + ++EN+GRDV  FL      +  +YDY+C  H KK  +     I +G  ++ 
Sbjct: 363 HLPYDVDVRLIENRGRDVSAFLVGGGADLM-KYDYVCFAHDKKVTQLSPRSIGDGFAYK- 420

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFF----AKRSEVYRRVIDL 310
             F ++L   +    +IN FE +P LGM           +  F        E  ++ ++ 
Sbjct: 421 -CFENILASKEYVQNVINLFETHPRLGMAMPTPPNHADYFPGFTYTWGPNFEGTKKFLEK 479

Query: 311 AKRAGFPTKRLHLDFFN--GTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVER 367
                 P    + D     GTMFW + K +  L +     E F  E    DG L H +ER
Sbjct: 480 TLGISVPLDE-NKDAIAPLGTMFWFRTKAMRGLLDRKWTYEDFPAEPLKIDGTLLHFIER 538

Query: 368 FFACSVRYTEF 378
            +    +Y  +
Sbjct: 539 AYGYVPQYNGY 549


>gi|227497960|ref|ZP_03928140.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
 gi|226832618|gb|EEH65001.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
          Length = 626

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 97/233 (41%), Gaps = 17/233 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYV-- 205
           +SKIA+V+H Y+ D   ++ H    +    DL  TV    K   Q V +      L V  
Sbjct: 306 ESKIALVMHVYHMDLLPQLLHYAASMPAGCDLIATVDTEAK--AQQVREATAGLSLNVET 363

Query: 206 --MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFDLLG 262
             +EN+GRDV   L      + D YD +C IH KK +Q       EG   R   F ++L 
Sbjct: 364 ILIENRGRDVAALLVGARPRLLD-YDLVCFIHDKKVTQIRPGSVGEGFAKR--CFENVLA 420

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRR-----YRRYKRWSFFAKRSEVYRRVIDLAKRAGFP 317
             +    +I TF+  P LG++         Y     +S+          +      A   
Sbjct: 421 TPEFVCNVIATFQAEPRLGVLTPSAPHHGDYFPISAFSWGPNDKNTKELLASFGLHAPID 480

Query: 318 TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
             +  +  F G++FW +P+ + PL        +F  E    DG + HA+ER +
Sbjct: 481 PDKEAIAPF-GSVFWFRPQAIRPLLERKWRYDDFPAEPLPIDGTISHAIERVY 532


>gi|225868697|ref|YP_002744645.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. zooepidemicus]
 gi|225701973|emb|CAW99527.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. zooepidemicus]
          Length = 581

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 112/268 (41%), Gaps = 27/268 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L E    +P S  +S      KIA+ +H +Y D   E     
Sbjct: 256 MSQVHLP-DAKYLLAHKYLPE----QPISIDQS-----KKIAVHLHVFYVDLLSEFLEAF 305

Query: 171 LRLNFDFDLFVTVVEANKDFE-QDVLK-YFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              +FD+DL +T     K  E +++L+    SA + V  N GRDV P L L E     +Y
Sbjct: 306 SHFHFDYDLLITTDSKAKKAEIKEILRESGASADILVTGNIGRDVLPMLTLKER--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS--R 286
           DY+   H KKS+   +    G  WR  L   ++  +D  +  +        +  I S  R
Sbjct: 364 DYIGHFHTKKSKEADF--WAGQSWRTELIDMMVKPADQILTALAADAIGIVIADIPSFFR 421

Query: 287 RYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLHLDFF---NGTMFWVKPKCLEPL 341
             +    W+    A       + + L KR  F T    +D F    GT  W K   L+PL
Sbjct: 422 FNKIVDAWNEHLIAPEMNQLWQAMGLTKRIDFQT----MDTFVMSYGTFVWFKYDALKPL 477

Query: 342 RNLHLIGEFEEERNLKDGALEHAVERFF 369
            +L L         L   ++ HA+ER  
Sbjct: 478 FDLDLSEADIPAEPLPQNSILHAIERLL 505


>gi|225870347|ref|YP_002746294.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. equi 4047]
 gi|225699751|emb|CAW93520.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. equi 4047]
          Length = 581

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 96/229 (41%), Gaps = 17/229 (7%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLK-YFPSAQLYVME 207
           KIA+ +H +Y D   E        +FD+DL +T     K  E +++L+    SA + V  
Sbjct: 285 KIAVHLHVFYVDLLSEFLEAFSHFHFDYDLLITTDSKAKKAEIKEILRESGASADILVTG 344

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N GRDV P L L E     +YDY+   H KKS+   +    G  WR  L   ++  +D  
Sbjct: 345 NIGRDVLPMLTLKER--LSQYDYIGHFHTKKSKEADF--WAGQSWRTELIDMMVKPADQI 400

Query: 268 IRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
           +  +        +  I S  R  +    W+    A       + + L KR  F T    +
Sbjct: 401 LTALAADAIGIVIADIPSFFRFNKIVDAWNEHLIAPEMNQLWQAMGLTKRIDFQT----M 456

Query: 324 DFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           D F    GT  W K   L+PL +L L         L   ++ HA+ER  
Sbjct: 457 DTFVMSYGTFVWFKYDALKPLFDLDLSEADIPAEPLSQNSILHAIERLL 505


>gi|195977971|ref|YP_002123215.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
 gi|195974676|gb|ACG62202.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
          Length = 581

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 96/229 (41%), Gaps = 17/229 (7%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLK-YFPSAQLYVME 207
           KIA+ +H +Y D   E        +FD+DL +T     K  E +++L+    SA + V  
Sbjct: 285 KIAVHLHVFYADLLSEFLEAFSHFHFDYDLLITTDSKAKKAEIKEILRESGASADILVTG 344

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N GRDV P L L E     +YDY+   H KKS+   +    G  WR  L   ++  +D  
Sbjct: 345 NIGRDVLPMLTLKER--LSQYDYIGHFHTKKSKEADF--WAGQSWRTELIDMMVKPADQI 400

Query: 268 IRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
           +  +        +  I S  R  +    W+    A       + + L KR  F T    +
Sbjct: 401 LTALAADAIGIVIADIPSFFRFNKIVDAWNEHLIAPEMNQLWQAMGLTKRIDFQT----M 456

Query: 324 DFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           D F    GT  W K   L+PL +L L         L   ++ HA+ER  
Sbjct: 457 DTFVMSYGTFVWFKYDALKPLFDLGLNEADIPAEPLPQNSILHAIERLL 505


>gi|94988294|ref|YP_596395.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS9429]
 gi|94992170|ref|YP_600269.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS2096]
 gi|94541802|gb|ABF31851.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS9429]
 gi|94545678|gb|ABF35725.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS2096]
          Length = 581

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 100/234 (42%), Gaps = 23/234 (9%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPAD- 398

Query: 267 AIRIINTFEQNPCLGMIGS-----RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTK 319
              I++ FE N    +I       R  +    W+    A+      R +D+ K+  F   
Sbjct: 399 --SILSAFETNDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA- 455

Query: 320 RLHLDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
              +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 ---MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|50913971|ref|YP_059943.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS10394]
 gi|50903045|gb|AAT86760.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS10394]
          Length = 581

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 100/234 (42%), Gaps = 23/234 (9%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPAD- 398

Query: 267 AIRIINTFEQNPCLGMIGS-----RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTK 319
              I++ FE N    +I       R  +    W+    A+      R +D+ K+  F   
Sbjct: 399 --SILSAFETNDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA- 455

Query: 320 RLHLDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
              +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 ---MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|21910063|ref|NP_664331.1| hypothetical protein SpyM3_0527 [Streptococcus pyogenes MGAS315]
 gi|28896239|ref|NP_802589.1| hypothetical protein SPs1327 [Streptococcus pyogenes SSI-1]
 gi|21904254|gb|AAM79134.1| putative protein [Streptococcus pyogenes MGAS315]
 gi|28811490|dbj|BAC64422.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 581

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 100/234 (42%), Gaps = 23/234 (9%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPAD- 398

Query: 267 AIRIINTFEQNPCLGMIGS-----RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTK 319
              I++ FE N    +I       R  +    W+    A+      R +D+ K+  F   
Sbjct: 399 --SILSAFETNDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA- 455

Query: 320 RLHLDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
              +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 ---MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|94990172|ref|YP_598272.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10270]
 gi|94543680|gb|ABF33728.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10270]
          Length = 581

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 100/234 (42%), Gaps = 23/234 (9%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPAD- 398

Query: 267 AIRIINTFEQNPCLGMIGS-----RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTK 319
              I++ FE N    +I       R  +    W+    A+      R +D+ K+  F   
Sbjct: 399 --SILSAFETNDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA- 455

Query: 320 RLHLDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
              +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 ---MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|241668058|ref|ZP_04755636.1| glycosyl transferase, group 1 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 756

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 108/237 (45%), Gaps = 19/237 (8%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYF 198
           P  S   I  K AI +H +Y D   E +     L   +DL++T++++N  +F ++     
Sbjct: 511 PINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSSS 570

Query: 199 PSA--QLYVMENKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRW 255
            +A  ++  ++N GRD+ P ++ L+  + +R Y+ +   H KK+     H   G  WR +
Sbjct: 571 GAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTVSA--HDNLGDKWRAY 628

Query: 256 LFFDLLGFSD-IAIRIINTFEQNPCLGMI--GSRRYRRYKRWSFFAKRSEVYRRVIDLAK 312
           L  +L+G ++ I+  I+N F     +G++    R Y       F+         +  + +
Sbjct: 629 LLNNLIGDNEQISNSILNLFNDEK-IGLVFPEDRTYIDIGENKFYVDELCTAIGLEKICE 687

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
              FP          G MFW +   +  + +L+     +EE   +DG+  HA+ER  
Sbjct: 688 TPLFPL---------GNMFWARVDAIRDIFSLNEDMILQEEPLPRDGSYMHALERII 735


>gi|254876593|ref|ZP_05249303.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254842614|gb|EET21028.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 765

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 108/237 (45%), Gaps = 19/237 (8%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYF 198
           P  S   I  K AI +H +Y D   E +     L   +DL++T++++N  +F ++     
Sbjct: 520 PINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSSS 579

Query: 199 PSA--QLYVMENKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRW 255
            +A  ++  ++N GRD+ P ++ L+  + +R Y+ +   H KK+     H   G  WR +
Sbjct: 580 GAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTVSA--HDNLGDKWRAY 637

Query: 256 LFFDLLGFSD-IAIRIINTFEQNPCLGMI--GSRRYRRYKRWSFFAKRSEVYRRVIDLAK 312
           L  +L+G ++ I+  I+N F     +G++    R Y       F+         +  + +
Sbjct: 638 LLNNLIGDNEQISNSILNLFNDEK-IGLVFPEDRTYIDIGENKFYVDELCTAIGLEKICE 696

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
              FP          G MFW +   +  + +L+     +EE   +DG+  HA+ER  
Sbjct: 697 TPLFPL---------GNMFWARVDAIRDIFSLNEDMILQEEPLPRDGSYMHALERII 744


>gi|167627488|ref|YP_001677988.1| group 1 glycosyl transferase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597489|gb|ABZ87487.1| glycosyl transferase, group 1 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 763

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 108/237 (45%), Gaps = 19/237 (8%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYF 198
           P  S   I  K AI +H +Y D   E +     L   +DL++T++++N  +F ++     
Sbjct: 518 PINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSSS 577

Query: 199 PSA--QLYVMENKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRW 255
            +A  ++  ++N GRD+ P ++ L+  + +R Y+ +   H KK+     H   G  WR +
Sbjct: 578 GAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTVSA--HDNLGDKWRAY 635

Query: 256 LFFDLLGFSD-IAIRIINTFEQNPCLGMI--GSRRYRRYKRWSFFAKRSEVYRRVIDLAK 312
           L  +L+G ++ I+  I+N F     +G++    R Y       F+         +  + +
Sbjct: 636 LLNNLIGDNEQISNSILNLFNDEK-IGLVFPEDRTYIDIGENKFYVDELCTAIGLEKICE 694

Query: 313 RAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
              FP          G MFW +   +  + +L+     +EE   +DG+  HA+ER  
Sbjct: 695 TPLFPL---------GNMFWARVDAIRDIFSLNEDMILQEEPLPRDGSYMHALERII 742


>gi|289678438|ref|ZP_06499328.1| glycosyl transferase, group 1 [Pseudomonas syringae pv. syringae
           FF5]
          Length = 774

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 99/234 (42%), Gaps = 27/234 (11%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQ-DVLKYFP---SAQLYV 205
            +A+ +H +Y+D   + SH L       D+F+T+ +A    +   V    P   + ++  
Sbjct: 266 NVAVCLHIFYEDYIEKFSHALANFPTQVDVFITLADAKHQKKTIAVFSKHPRVKNLKVRC 325

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
           + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   LL  ++
Sbjct: 326 VPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEYLLRDAN 381

Query: 266 IAIRIINTFEQNPCLGMIGSRRYRRYKRW--------SFFAKRSEVYRRVIDLAKRAGFP 317
           I  R++N F  +  LG+     +     W        SF A     ++  ID     GF 
Sbjct: 382 IITRLLNAFADHKDLGLYYPTTFWMMPSWVNHVTMNKSFMAAWHNEWQ--IDPCD--GF- 436

Query: 318 TKRLHLDFFNGTMFWVKPKCLEP-LRNLHLIGEFEEERNLKDGALEHAVERFFA 370
                L +  G MFW +P+ L+  L   +    F +E    DG++ HA+ER   
Sbjct: 437 -----LSYPAGGMFWARPEALKDMLEKEYDYDFFPQEPLPNDGSMLHALERVIG 485


>gi|116071143|ref|ZP_01468412.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           BL107]
 gi|116066548|gb|EAU72305.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           BL107]
          Length = 1161

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 106/263 (40%), Gaps = 27/263 (10%)

Query: 138 SSPKKSGLTI---KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDV 194
           SSP    LT    + K  + +H +Y +    I+  L ++    D++++  E   D     
Sbjct: 187 SSPHPQKLTQAIEQKKFGVFLHIFYPELAKTIADYLAKIPVKIDIYISTTEKEVDELAKT 246

Query: 195 LKYFPSA---QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGII 251
            +   ++   Q+    N GRDV PF+      +  +YD++ K+H KKS       + G  
Sbjct: 247 FRRLDNSEHVQVKSFSNTGRDVAPFVVGFREEIL-KYDFILKLHSKKSPHSD--ALSG-- 301

Query: 252 WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYR---RYKRWSFFAKRSEVYRRVI 308
           W      +L+G  D+    I     N    +     Y      K  S +      Y +  
Sbjct: 302 WFEHCLDNLIGSKDVFYTNIFELMNNETAIIYPVENYALSLGIKHDSCWGHEDGNYDKAK 361

Query: 309 DLAKRAGFPTKRLHLD------FFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGAL 361
            L  +        H+D      F  GTMFW K   L+P+ + +L   +F+ E    DG L
Sbjct: 362 PLLDKLNLK----HIDRDSKFLFPTGTMFWCKSYILQPILDWNLGFHDFDNEGGQIDGTL 417

Query: 362 EHAVERFFA--CSVRYTEFSIES 382
            H++ER     C+ ++ +  I S
Sbjct: 418 AHSIERLIGLCCTEKFHKRIITS 440


>gi|116071634|ref|ZP_01468902.1| hypothetical protein BL107_05779 [Synechococcus sp. BL107]
 gi|116065257|gb|EAU71015.1| hypothetical protein BL107_05779 [Synechococcus sp. BL107]
          Length = 934

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 103/237 (43%), Gaps = 17/237 (7%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA 201
           K+ +  + ++AI +H YY ++  E    L  L     L +T   + K  ++ +++    A
Sbjct: 37  KTSIFQECQVAIYLHIYYPESLHEFLEYLTVLPSQIRLVITTTTSEK--KELIIEILERA 94

Query: 202 QL--------YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
            L           ENKGRD+  F+ + +  +  +YD +CK+H KKS   G     G  W 
Sbjct: 95  LLINRLDLCHVYHENKGRDIGAFINIYDELI--KYDVVCKLHAKKSPHLGEF---GKSWF 149

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKR 313
           R+L    +G       I+N    +  +G++    ++       +A   ++ + + D    
Sbjct: 150 RYLIRSTIGNQSAIENIVNILYHSKDIGILAPTSFQGTNNHD-WASNFDISQSISDHIFN 208

Query: 314 AGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFF 369
           +     +  L + + T+FW KP+ L   +   +  + F EE    DG   H++ER  
Sbjct: 209 SELDINKEKLRYPSATVFWFKPEALNQQQFRSIQPDFFPEEPIPIDGTTAHSLERLI 265


>gi|94994091|ref|YP_602189.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10750]
 gi|94547599|gb|ABF37645.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10750]
          Length = 581

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 100/231 (43%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            + +  T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSVFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER F 
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLFV 506


>gi|71903253|ref|YP_280056.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS6180]
 gi|71802348|gb|AAX71701.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS6180]
          Length = 581

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 100/231 (43%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            + +  T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSVFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER F 
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLFV 506


>gi|319939379|ref|ZP_08013739.1| RgpFc protein [Streptococcus anginosus 1_2_62CV]
 gi|319811365|gb|EFW07660.1| RgpFc protein [Streptococcus anginosus 1_2_62CV]
          Length = 587

 Score = 60.1 bits (144), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 99/229 (43%), Gaps = 19/229 (8%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL--KYFPSAQLYVME 207
           KI + +H +Y D   +        +F +DLF+T     K  E + +  +   +A ++V  
Sbjct: 291 KIGVHLHVFYVDLLEDFLKAFENFHFAYDLFITTDNDTKKLEIEAILNQNHKNAHIFVTG 350

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N GRDV P L L +      YDY+   H KKS+   +   E   WR  L   L+  +D  
Sbjct: 351 NIGRDVLPMLKLKKY--LSTYDYIGHFHTKKSKEADFWAGES--WRNELIDMLIKPAD-- 404

Query: 268 IRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDF 325
             I+  FE N  LG++ S    + RY +         +   + DL  +    TK +  + 
Sbjct: 405 -NILANFE-NDKLGLVISDIPTFFRYNKIVDAWNEHLIAPEMNDLWYKMKM-TKPIDFNT 461

Query: 326 FN------GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERF 368
           F+      GT  W K   L+PL +L L  +      L   ++ HA+ER 
Sbjct: 462 FHTFVMSYGTFIWFKYDALKPLFDLDLTDKDVPIEPLPQNSILHAIERL 510


>gi|320325880|gb|EFW81940.1| hypothetical protein PsgB076_04646 [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 774

 Score = 59.7 bits (143), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 97/234 (41%), Gaps = 27/234 (11%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF------PSAQL 203
            +AI +H +Y+D   + SH L       D+F+T+   N   ++  +  F       + ++
Sbjct: 266 NVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNH--KKKTIATFGQHPRVKNLKV 323

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
             + N+ R+  P L      +   YD  C +H KKS   G    E   W  +L   LL  
Sbjct: 324 SCVPNRERNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEYLLRD 379

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRV------IDLAKRAGFP 317
           ++I  R++N F  +  LG+     +     W      ++ +         ID  +  GF 
Sbjct: 380 ANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVTMNKAFMNAWHNEWQIDPCE--GF- 436

Query: 318 TKRLHLDFFNGTMFWVKPKCL-EPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
                L +  G MFW +P+ L E L   +    F +E    DG++ HA+ER   
Sbjct: 437 -----LSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIG 485


>gi|78184210|ref|YP_376645.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
 gi|78168504|gb|ABB25601.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
          Length = 1161

 Score = 59.3 bits (142), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 96/238 (40%), Gaps = 15/238 (6%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA---QLY 204
           + K  + +H +Y +    I+  + ++    D+ ++          ++ K   ++   Q+ 
Sbjct: 200 QKKFGVFLHIFYPELAPIIADYIRKIPVKIDIHISTTHDAISGLTEIFKGLENSLNVQVK 259

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
              N GRDV PF+      +  +YDY+ K+H KKS     + + G  W      +L+G  
Sbjct: 260 SFPNIGRDVAPFIVGFREEI-PKYDYILKLHSKKSPHS--NALSG--WFEHCLDNLIGSI 314

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYR---RYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRL 321
           D+    I    +     +     Y      K  S +      Y +   L K+ G      
Sbjct: 315 DVFYTNIQELNKEDISIVYPVENYALSLGIKHDSCWGHEDGNYNKAKTLLKKLGLEQINR 374

Query: 322 HLDFF--NGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA-CSVRY 375
           + +F    G MFW KP  L+P+ +  L   +F+ E    DG L H++ER    C   Y
Sbjct: 375 NSEFLFPTGNMFWCKPDILKPILDWDLKFEDFDNEGGQIDGTLAHSIERLIGLCCTEY 432


>gi|78213552|ref|YP_382331.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9605]
 gi|78198011|gb|ABB35776.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9605]
          Length = 1162

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 101/253 (39%), Gaps = 39/253 (15%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA 201
           K GL I  K+ I +H +Y +    I+  L  +    D+F++  E +    + +     + 
Sbjct: 197 KEGL-INKKVGIFLHIFYPELGETIAAYLKNIPCSIDVFISTREDSVAALEKIFARVENT 255

Query: 202 Q---LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFF 258
           Q   +    N GRDV PF+      + + YDY+ K+H KKS     + + G  W      
Sbjct: 256 QKIEVRHFSNIGRDVAPFIVGFRDQILN-YDYILKLHSKKSPHS--NALSG--WFLHCLD 310

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMI-----------------GSRRYRRYKRWSFFAKRS 301
           +L+G   I    +    Q+P +G++                        Y +   F  R 
Sbjct: 311 NLIGSEAITATNLKAL-QSPEVGIVYPIENYALSLGIQHDSCWGHEDGNYAKARPFLNRY 369

Query: 302 EVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGA 360
            +  R I    +  FPT         GTMFW KP  L+ + +  L    F+EE    DG 
Sbjct: 370 NL--RQIKRESQFQFPT---------GTMFWCKPAVLQSILDWGLNWNNFDEEGGQIDGT 418

Query: 361 LEHAVERFFACSV 373
           + H++ER    S 
Sbjct: 419 IAHSIERLIGIST 431


>gi|160894491|ref|ZP_02075267.1| hypothetical protein CLOL250_02043 [Clostridium sp. L2-50]
 gi|156863802|gb|EDO57233.1| hypothetical protein CLOL250_02043 [Clostridium sp. L2-50]
          Length = 646

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 104/239 (43%), Gaps = 18/239 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA-----Q 202
           K K+A+V+H Y+ D   +       +  + D+++T     K  ++ +LK F +      +
Sbjct: 312 KRKLALVMHLYFPDLVEDSFQWASNVPKETDVYITTDTVEK--KEAILKVFKNLPCNHLE 369

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI-EGIIWRRWLFFDLL 261
           + V+ N+GRDV   L  ++  V   YDY C +H KK+ +     + +   ++ W   + L
Sbjct: 370 VRVIVNRGRDVSSILVGVK-DVIQNYDYACFVHDKKTAQAKPGSVGDSFGYKCW--NNTL 426

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK----RSEVYRRVID-LAKRAGF 316
              +    ++ TFE N  LG++          +           E  R V D L      
Sbjct: 427 YNKEFVCNVLQTFEDNERLGILSPPEPNHGPFYQTLGNEWGCNFEKSREVADKLGITIPM 486

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLH-LIGEFEEERNLKDGALEHAVERFFACSVR 374
              +  L  + GT FW +P  L+ L +      EF EE N  DG + HA+ER +   V+
Sbjct: 487 SEDKEALAPY-GTFFWFRPTALKVLFDHDWQYEEFPEEPNNFDGTILHAIERLYPICVQ 544


>gi|15674835|ref|NP_269009.1| hypothetical protein SPy_0792 [Streptococcus pyogenes M1 GAS]
 gi|71910421|ref|YP_281971.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS5005]
 gi|13621968|gb|AAK33730.1| conserved hypothetical protein - possibly involved in cell wall
           localization and side chain formation of
           rhamnose-glucose polysaccharide [Streptococcus pyogenes
           M1 GAS]
 gi|71853203|gb|AAZ51226.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS5005]
          Length = 581

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 98/231 (42%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFENWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            +    T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|19745874|ref|NP_607010.1| hypothetical protein spyM18_0853 [Streptococcus pyogenes MGAS8232]
 gi|19748025|gb|AAL97509.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
          Length = 581

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 98/231 (42%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            +    T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|139474025|ref|YP_001128741.1| rhamnan synthesis protein F family protein [Streptococcus pyogenes
           str. Manfredo]
 gi|134272272|emb|CAM30524.1| rhamnan synthesis protein F family protein [Streptococcus pyogenes
           str. Manfredo]
          Length = 581

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 98/231 (42%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            +    T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|50982351|gb|AAT91804.1| hypothetical protein [Yersinia enterocolitica]
          Length = 358

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 100/244 (40%), Gaps = 28/244 (11%)

Query: 134 NDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT------VVEAN 187
           ND      K      +K  I+VH +YQ    EI + L+    D+D+ +T      + +A 
Sbjct: 112 NDGSFELNKIKPNTDNKKLIIVHAFYQREAEEIFNRLVAFT-DYDIVITSPYNNIICKAK 170

Query: 188 KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPI 247
           +   Q+ +  F      +M N GRD+ PFL  L+L V ++Y+Y  K+H K+SQ    H  
Sbjct: 171 EILGQERVIGF------IMPNYGRDILPFLICLQLIVIEKYEYFVKVHTKRSQ----HLN 220

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRV 307
           +   W       L+G         N    +    ++     + Y  +     +  +   +
Sbjct: 221 DNGAWFNNNLDYLVG---------NKNATDGLFSIMSDDEPQIYGEY-ILPIQDHIANNI 270

Query: 308 IDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVE 366
             L          +   F  GTMF      L  +R+L L + + E+E    DG   HA+E
Sbjct: 271 HWLTYLLEKEPASVEASFIPGTMFIGNRAFLVLIRDLQLHLFQIEKENGQLDGCCVHAIE 330

Query: 367 RFFA 370
           R+F 
Sbjct: 331 RYFG 334


>gi|209559162|ref|YP_002285634.1| RgpFc protein [Streptococcus pyogenes NZ131]
 gi|209540363|gb|ACI60939.1| RgpFc protein [Streptococcus pyogenes NZ131]
          Length = 581

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 98/231 (42%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            +    T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|306827605|ref|ZP_07460885.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes ATCC 10782]
 gi|304430168|gb|EFM33197.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes ATCC 10782]
          Length = 581

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 98/231 (42%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            +    T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|260434430|ref|ZP_05788400.1| glycosyltransferase [Synechococcus sp. WH 8109]
 gi|260412304|gb|EEX05600.1| glycosyltransferase [Synechococcus sp. WH 8109]
          Length = 772

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 105/256 (41%), Gaps = 20/256 (7%)

Query: 133 WNDRPSSPKKSGL-TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE 191
           WN +   P +  L  I  K+ + +H +Y +   EI   +       +++++    N+   
Sbjct: 517 WNTKLIIPTEDVLMNIDEKVGLHIHVHYPELLDEILKAISMNKIRPEIYISC--TNQAIR 574

Query: 192 QDVLKYFPS-----AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP 246
              +K          ++ +  N+GRD+ P L  L   + ++Y     IH KKS     H 
Sbjct: 575 DLAIKNINEHGLILKKIILTPNRGRDIGPLLTCLGQELDEKYRIYGHIHTKKSIHIARH- 633

Query: 247 IEGIIWRRWLFFDLLGFSDIAIR--IINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVY 304
            +   WR +L  +L+G  +  +   II+   ++  +G+        +            Y
Sbjct: 634 -QSYSWRTFLIENLIGNEENHMMDCIISAMIKDKTIGL-------AFPSDPHCPGWDANY 685

Query: 305 RRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEH 363
           R+   LA++    +     +F  GTMFW +   L PL +L+L   ++  E    DG L H
Sbjct: 686 RQAKLLAEKLNIKSLTNEFNFPIGTMFWARKNALSPLYSLNLGWDDYPSEPIGYDGTLLH 745

Query: 364 AVERFFACSVRYTEFS 379
           ++ER          FS
Sbjct: 746 SIERLIPFVAESQGFS 761


>gi|56808559|ref|ZP_00366292.1| COG3754: Lipopolysaccharide biosynthesis protein [Streptococcus
           pyogenes M49 591]
          Length = 581

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 98/231 (42%), Gaps = 17/231 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM 206
            K+A+ +H +Y D   E        NF +DLF+T       K+ ++ + +   +A + V 
Sbjct: 284 QKVAVHLHVFYVDLLDEFLTAFEDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVT 343

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L +     +YDY+   H KKS+   +   E   WR+ L   L+  +D 
Sbjct: 344 GNRGRDIYPMLLLKD--KLSQYDYIGHFHTKKSKEADFWAGES--WRKELIDMLVKPADS 399

Query: 267 AIRIINTFEQNPCLGMIGS--RRYRRYKRWS--FFAKRSEVYRRVIDLAKRAGFPTKRLH 322
            +    T +    +  I S  R  +    W+    A+      R +D+ K+  F      
Sbjct: 400 ILSAFETDDIGIIIADIPSFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQA---- 455

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +D F    GT  W K   L+ L +L L         L   ++ HA+ER   
Sbjct: 456 MDTFVMSYGTFVWFKYDALKSLFDLELTQNDIPSEPLPQNSILHAIERLLV 506


>gi|301632931|ref|XP_002945533.1| PREDICTED: o-antigen export system ATP-binding protein rfbB-like,
           partial [Xenopus (Silurana) tropicalis]
          Length = 367

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 71/159 (44%), Gaps = 20/159 (12%)

Query: 227 RYDYLCKIHGKKSQREGYHPIEGII---WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMI 283
           RY  + ++H K+S       I G +   WR  L+  L G       I++TF  +P LGM+
Sbjct: 203 RYALILRLHSKRSLH-----IPGQVGEEWRALLYTSLAGSRQRVNAIVDTFNTHPKLGML 257

Query: 284 GSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG--FPTKRLHLDFFNGTMFWVKPKCLEP- 340
                  Y     F      Y+R+  L +  G   P  +  +DF  G+MFW +P+ L   
Sbjct: 258 CPAVIDHYADCLHFGGN---YKRMCALLQPHGITLPPDQ-PIDFPMGSMFWCRPQALSVW 313

Query: 341 LRNLHLIGEFEEERNL---KDGALEHAVER--FFACSVR 374
           L       +F    +L   +DG L HA+ER  FF C ++
Sbjct: 314 LEPGFTFDDFTPTNDLDTDRDGTLAHALERLFFFGCGLK 352


>gi|78184217|ref|YP_376652.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
 gi|78168511|gb|ABB25608.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
          Length = 519

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 118/267 (44%), Gaps = 26/267 (9%)

Query: 137 PSSPKKS-GLTIKSKIAIVVHCYYQDTWIEISHILLRL--------NFDFDLFVTVVEAN 187
           PS+ ++S G +    +A+++H +Y D    +  ILL+L            DL+V+     
Sbjct: 253 PSTDERSWGESSPGHLALMIHGFYPDV---LDDILLKLPSFCAGMVGTQLDLYVSTSMDQ 309

Query: 188 KDFEQDVLKY--FPSAQLYVMENKGRDVRPF-LYLLELGVFDRYDYLCKIHGKKSQREGY 244
            D  +  L+   F   +L+ +EN+GRDV PF L+LL       + +  K+H KKS + G 
Sbjct: 310 IDQVEKKLRDLDFACVRLFGVENRGRDVAPFLLHLLPAVAAAGHHFFVKLHTKKSLQFG- 368

Query: 245 HPIEGII-WRRWLFFDLLGFSDI-AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSE 302
             I+G+  W R L   LL  + + AIR    F  +  LG +           + F  ++ 
Sbjct: 369 --IDGLDKWSRHLIESLLSAAGLEAIRY--QFLDDEDLGCLCPSGTLLPLAIALFKNKTH 424

Query: 303 VYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGAL 361
           ++  +        +    L   F  G+MF  + +    L +    + +FE E    DG  
Sbjct: 425 LHHLLSHSEINGRW---ALMQTFVAGSMFAGRVEAFRSLLDQGFSLDDFELEGGQFDGTF 481

Query: 362 EHAVERFFACSVRYTEFSIESVDCVAE 388
            HA+ER  +  V+ + + I+ +    E
Sbjct: 482 AHALERLISLEVKRSGWQIKEMSGSPE 508


>gi|332035169|gb|EGI71680.1| glycosyl transferase, group 1 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 672

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 97/250 (38%), Gaps = 17/250 (6%)

Query: 133 WNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQ 192
           W  +  +   +G     K+A+  H +Y +        L +     D+FV+V  A+++  +
Sbjct: 147 WYPKAIASSANGEPTTLKLAMCFHVFYGEFIDYYCGALAKFTQQVDVFVSV--ASEELAK 204

Query: 193 DVLKYFPSAQLYVM------ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP 246
             +  F +             N GR+  P L      +   YD  C +H KKS   G   
Sbjct: 205 KAIHDFKACSKVNKVVVKVVPNHGRNFGPMLVEFASDL-QNYDLFCHMHSKKSLYSGRAQ 263

Query: 247 IEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRW-SFFAKRSEVYR 305
            +   W  +L   LL    +  +++N F  NP  G+     +     W + + K     +
Sbjct: 264 TQ---WADYLGEYLLNDPHVIKQVLNHFNDNPKSGLYYPTSFWMMPDWVNHWLKNKPAAQ 320

Query: 306 RVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNL-HLIGEFEEERNLKDGALEHA 364
           +     K+     K   L +  G MFW +P+ L+ L N  +   +F  E    DG+  HA
Sbjct: 321 K---FTKKWNIELKDDFLAYPAGGMFWARPEALKQLLNKEYKYDDFPGEPLPNDGSQLHA 377

Query: 365 VERFFACSVR 374
           +ER     V 
Sbjct: 378 LERMLGLLVE 387


>gi|219670466|ref|YP_002460901.1| Rhamnan synthesis F [Desulfitobacterium hafniense DCB-2]
 gi|219540726|gb|ACL22465.1| Rhamnan synthesis F [Desulfitobacterium hafniense DCB-2]
          Length = 606

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 99/253 (39%), Gaps = 34/253 (13%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV--EANKDFEQDV 194
           PS      L  + K+ +  H YY+D      H +  +    D+ +T    E     E+ +
Sbjct: 279 PSDYVVKPLKRQPKVVVCFHVYYEDLLDSCFHYMQSIPQFADIVITTPKKELVGIIEEKI 338

Query: 195 LKY-FPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ--REGYHPIEGII 251
             Y   +  + V+  +GR    FL   +  + D YDY C +H KKS   R G     G+ 
Sbjct: 339 KSYELNNTTIKVINARGRAESAFLVATKDFILD-YDYACIVHDKKSSFLRPG---CVGVE 394

Query: 252 WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMI--------------GSRRYRRYKRWSFF 297
           +       LL  S     I++ FE NP +G +              G      YK    F
Sbjct: 395 FGLQNLDALLATSAYVENILSIFEDNPRIGALEPVHLLHANFRDLYGGEWGANYKGTEEF 454

Query: 298 AKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNL 356
            KR+      IDL      P          G MFW +P C++ + ++    E F EE   
Sbjct: 455 LKRAG-----IDLLISPDVPPLAPM-----GAMFWFRPICMKRILDMEWEYEDFPEEPLP 504

Query: 357 KDGALEHAVERFF 369
            DG+L H +ER +
Sbjct: 505 LDGSLIHIIERAY 517


>gi|261367011|ref|ZP_05979894.1| putative polysaccharide biosynthesis protein [Subdoligranulum
           variabile DSM 15176]
 gi|282571129|gb|EFB76664.1| putative polysaccharide biosynthesis protein [Subdoligranulum
           variabile DSM 15176]
          Length = 646

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 107/244 (43%), Gaps = 31/244 (12%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLY 204
           L  + +IA+ +H Y+ D   +      +     D+FV+     K  ++ + + F   +L+
Sbjct: 304 LCAQRRIALAMHLYFMDMLEQSVAFAAKFPPQTDVFVSTNSEEK--KEQIEQAFSGQKLH 361

Query: 205 -----VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
                V+EN+GRDV  FL  L   + + YDY C +H KK+ +       G +   + +  
Sbjct: 362 SVTVMVVENRGRDVGAFLCDLAPHLRN-YDYACFMHDKKAIQTK----PGSVGASFGYVC 416

Query: 260 LLGFSDIAIRIINT---FEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
                  A  ++N    FE +P LG++    Y  +  + F    S  +    +  K+   
Sbjct: 417 NENVCKNAAHVLNVLCEFENDPYLGIL-CPPYPTHGLY-FMNMCSGGWGPNFENTKKL-- 472

Query: 317 PTKRLHLDFFN----------GTMFWVKPKCLEPL-RNLHLIGEFEEERNLKDGALEHAV 365
             K L LD             G++FW +PK LEPL  +     +F +E   +DG + HA+
Sbjct: 473 -LKELGLDVPISGEESPIAPFGSVFWFRPKALEPLFAHGWQHTDFPQEPLPQDGTISHAI 531

Query: 366 ERFF 369
           ER +
Sbjct: 532 ERVY 535


>gi|312133752|ref|YP_004001091.1| protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773032|gb|ADQ02520.1| Hypothetical protein BBMN68_1493 [Bifidobacterium longum subsp.
           longum BBMN68]
          Length = 651

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 97/230 (42%), Gaps = 14/230 (6%)

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD-FEQDVLKYFP-SAQLYVMEN 208
           +A+V H YY D        +  +    D+ +TV    K    ++  +  P +  + V+EN
Sbjct: 311 VALVFHLYYIDLLDSSLQYISSMPEGCDVIITVGSEEKACIVKERCEGMPYNIDVRVIEN 370

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKK-SQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           +GRDV   L      V + YD +C  H KK +Q +     +G  ++   F ++L      
Sbjct: 371 RGRDVSALLVGAGKDVLN-YDLVCFAHDKKVTQIKPLSVGDGFAYK--CFENILASKAYV 427

Query: 268 IRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR-----SEVYRRVIDLAKRAGFPTKRLH 322
             II+ FE+ P LG++          +  F            + + D+ K      K+  
Sbjct: 428 ANIIDQFEREPHLGVLMPNPPEHGNYFPVFTLSWGDNFDGTVQLLRDIHKTVPLDKKKEV 487

Query: 323 LDFFNGTMFWVKPKCLEP--LRNLHLIGEFEEERNLKDGALEHAVERFFA 370
           +    GTMFW +PK L    L +     +F +E N  DG + H +ER + 
Sbjct: 488 IAPL-GTMFWFRPKALSDGLLNHNWQYSDFPKEPNKIDGTILHYIERAYC 536


>gi|14090418|gb|AAK53494.1| putative methyltransferase [Xanthomonas campestris pv. campestris]
          Length = 212

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 68/149 (45%), Gaps = 14/149 (9%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT-----VVEANKDFEQD 193
           +P  +         +V+H +Y D   E+   ++       + +T     V+E  K  ++ 
Sbjct: 37  APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQRR 96

Query: 194 VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWR 253
            ++    A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR
Sbjct: 97  GIQ----AEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWR 148

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGM 282
             +   LLG   +   I+N F  +P +G+
Sbjct: 149 GEMLTALLGPQRVD-AIVNAFSTDPLVGL 176


>gi|291520449|emb|CBK75670.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 486

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (53%), Gaps = 13/140 (9%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL-----KYFPSAQLY 204
           K+A+V H YY + +      L ++ +  D+ +T    +K  +Q+++     K     ++ 
Sbjct: 291 KVAVVAHLYYVEMFELCMDYLAKVPYGIDIIITTNSDDK--KQNIIEVASEKGVKLTEVI 348

Query: 205 VMENKGRDVRPFLYLLELGVF-DRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
           V EN+GR++     L+  G F  +Y Y C +H KKS  + +  + G+ +R  L+   L +
Sbjct: 349 VAENRGRELAAL--LVGCGKFLLKYKYFCFVHDKKSSAKEHLSV-GLAFRDILWDSSL-Y 404

Query: 264 SDIAIR-IINTFEQNPCLGM 282
           S+  IR II+ FEQN C+G+
Sbjct: 405 SEGYIRNIIDMFEQNECMGL 424


>gi|297182567|gb|ADI18727.1| lipopolysaccharide biosynthesis protein [uncultured Rhizobiales
           bacterium HF4000_32B18]
          Length = 887

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 75/181 (41%), Gaps = 25/181 (13%)

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIE-GIIWRRWLFFDLLGF 263
           V+ N+GRDV PFL L + G  D     C +H KKS   G  P   G +WR +L   LLG 
Sbjct: 702 VVANRGRDVLPFLELFD-GSEDDNALWCHVHLKKSV--GLGPTSPGAVWRAFLMRILLGG 758

Query: 264 SD---IAIRIINTFEQ------NP-CLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKR 313
            +    A+ +I   E       +P  +G  GSRR     +       ++  RR       
Sbjct: 759 PERLSTALALIRAPEAGLVGAFDPYVMGWTGSRRLLAPLQARLDGWEADGGRR------- 811

Query: 314 AGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACS 372
              P     L F  G MFWVK   +  +R L      +  E    DG + H +ER +  +
Sbjct: 812 ---PLPDHPLLFPVGDMFWVKAGVVNAMRRLFGADYPWPGEPLPGDGTVYHLIERLWPTA 868

Query: 373 V 373
            
Sbjct: 869 A 869


>gi|221218294|ref|YP_002524321.1| glycosyltransferase [Rhodobacter sphaeroides KD131]
 gi|221163321|gb|ACM04287.1| glycosyltransferase [Rhodobacter sphaeroides KD131]
          Length = 821

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 87/195 (44%), Gaps = 20/195 (10%)

Query: 183 VVEANKDFEQDVLKYFPSA-----QLYVMENKGRDVRPFLYL-LELGVFDRYDYLCKIHG 236
           VV  + D + D ++   +A     ++ V  N+GRD+ PFL L L  G     +  C +H 
Sbjct: 617 VVTTDSDRKADEIRTLMAAVGLAPEVLVRPNRGRDILPFLQLFLPGGAAGEDEIWCHLHQ 676

Query: 237 KKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS-RRYRRYKRWS 295
           KKS         G IWR +L   LLG  + ++    T  +NP +G++     Y  +  W 
Sbjct: 677 KKSLATTD---SGDIWRAFLLRILLG-DEASLSDAATHLRNPGVGLVAPFDPY--FIPWD 730

Query: 296 FFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEER 354
             A R+ + R    +A R   P     L F  G MF+V+ + +  + +L   G  +  E 
Sbjct: 731 --ASRALLPR----VAPRLPGPLPDNPLLFPVGNMFFVRSRVVRAMNDLFGAGYPWPNEP 784

Query: 355 NLKDGALEHAVERFF 369
              DG   H +ER +
Sbjct: 785 IPNDGTEFHLIERLW 799


>gi|88808074|ref|ZP_01123585.1| Glycosyl transferase, group 1 [Synechococcus sp. WH 7805]
 gi|88788113|gb|EAR19269.1| Glycosyl transferase, group 1 [Synechococcus sp. WH 7805]
          Length = 512

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 102/247 (41%), Gaps = 23/247 (9%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-----EANKDFEQDVLKYFPSAQLY 204
           KI +V+H YY ++   I   L  +   FDL VTV      E  K++ + V        + 
Sbjct: 50  KILVVIHAYYPESLATIFPSLRHMPCHFDLVVTVCSCGDKEVVKEYLEKVDLPIDVLDIK 109

Query: 205 VMENKGRDVRPFLYLLE-LGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           V+ N GRD+ PF+ +++ L + ++ YD++ K+H K+S         G  W      +LLG
Sbjct: 110 VLTNLGRDLLPFVQVIKGLKLQNKAYDFVLKLHTKRSVASSKGKEFGGKWLEGSLSNLLG 169

Query: 263 FSDIAIRIINTFEQNPCLGMIG---SRRYRRYKRW-SFFAKRSEVYRRVIDLAKRAGFPT 318
             +    I+    Q     ++    S    R+ +W +  A  S +  R         F  
Sbjct: 170 SPENVKYILLELLQTTNCALVSPLISLDVFRFCKWKNNLAPISHLLDR---------FGV 220

Query: 319 KRLHLDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRY 375
           +    DF     G+MFWV  K    + +         E    +G+  HA ER     +  
Sbjct: 221 RESPEDFICFPAGSMFWVDFKAAVLIASCFEESRVPPEPLPSNGSYLHAFERLVPYILES 280

Query: 376 TEFSIES 382
           T+  ++S
Sbjct: 281 TQKRMQS 287


>gi|291516581|emb|CBK70197.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           subsp. longum F8]
          Length = 688

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 101/261 (38%), Gaps = 29/261 (11%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN-----KDFE 191
           PS         + + A + H Y+ D   +  H +  L  + DL++T  E       +  +
Sbjct: 313 PSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYITSTEDKIPQIREYMQ 372

Query: 192 QDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS---QREGYHPI 247
           Q  + +   A    + N+GRDV   L      V   +YD +   H KKS   Q  G+H  
Sbjct: 373 QHGISH--QATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKKSSQNQENGHHGT 430

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR-----YRRYKRWSFFAKRSE 302
           E   +   L  + LG       I+  F +NP LG +         Y  +     +    E
Sbjct: 431 ESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFAHTIPHDWGANYE 490

Query: 303 VYRRVIDLAKRAGF-----PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE--FEEERN 355
           + + +  L  R G      PTK        G+ +W + + L+PL       E    E + 
Sbjct: 491 ITKEL--LEDRLGIHVPLSPTKPTASAM--GSCYWFRVEALKPLFEYGWKYEDFLPEGQM 546

Query: 356 LKDGALEHAVERF--FACSVR 374
            +DG + HA+ER   + C  R
Sbjct: 547 GEDGTISHAIERANGYICQSR 567


>gi|189440434|ref|YP_001955515.1| lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           DJO10A]
 gi|317482688|ref|ZP_07941702.1| rhamnan synthesis protein F [Bifidobacterium sp. 12_1_47BFAA]
 gi|189428869|gb|ACD99017.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           DJO10A]
 gi|316915934|gb|EFV37342.1| rhamnan synthesis protein F [Bifidobacterium sp. 12_1_47BFAA]
          Length = 666

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 101/261 (38%), Gaps = 29/261 (11%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN-----KDFE 191
           PS         + + A + H Y+ D   +  H +  L  + DL++T  E       +  +
Sbjct: 291 PSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYITSTEDKIPQIREYMQ 350

Query: 192 QDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS---QREGYHPI 247
           Q  + +   A    + N+GRDV   L      V   +YD +   H KKS   Q  G+H  
Sbjct: 351 QHGISH--QATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKKSSQNQENGHHGT 408

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR-----YRRYKRWSFFAKRSE 302
           E   +   L  + LG       I+  F +NP LG +         Y  +     +    E
Sbjct: 409 ESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFAHTIPHDWGANYE 468

Query: 303 VYRRVIDLAKRAGF-----PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE--FEEERN 355
           + + +  L  R G      PTK        G+ +W + + L+PL       E    E + 
Sbjct: 469 ITKEL--LEDRLGIHVPLSPTKPTASAM--GSCYWFRVEALKPLFEYGWKYEDFLPEGQM 524

Query: 356 LKDGALEHAVERF--FACSVR 374
            +DG + HA+ER   + C  R
Sbjct: 525 GEDGTISHAIERANGYICQSR 545


>gi|322690050|ref|YP_004209784.1| hypothetical protein BLIF_1872 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|320461386|dbj|BAJ72006.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 672

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 101/261 (38%), Gaps = 29/261 (11%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN-----KDFE 191
           PS         + + A + H Y+ D   +  H +  L  + DL++T  E       +  +
Sbjct: 291 PSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYITSTEDKIPQIREYMQ 350

Query: 192 QDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS---QREGYHPI 247
           Q  + +   A    + N+GRDV   L      V   +YD +   H KKS   Q  G+H  
Sbjct: 351 QHGISH--QATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKKSSQNQENGHHGT 408

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR-----YRRYKRWSFFAKRSE 302
           E   +   L  + LG       I+  F +NP LG +         Y  +     +    E
Sbjct: 409 ESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFAHTIPHDWGANYE 468

Query: 303 VYRRVIDLAKRAGF-----PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE--FEEERN 355
           + + +  L  R G      PTK        G+ +W + + L+PL       E    E + 
Sbjct: 469 ITKEL--LEDRLGIHVPLSPTKPTASAM--GSCYWFRVEALKPLFEYGWKYEDFLPEGQM 524

Query: 356 LKDGALEHAVERF--FACSVR 374
            +DG + HA+ER   + C  R
Sbjct: 525 GEDGTISHAIERANGYICQSR 545


>gi|160936497|ref|ZP_02083865.1| hypothetical protein CLOBOL_01388 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440582|gb|EDP18320.1| hypothetical protein CLOBOL_01388 [Clostridium bolteae ATCC
           BAA-613]
          Length = 373

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 92/216 (42%), Gaps = 14/216 (6%)

Query: 181 VTVVEANKDFEQDVLKYFPSAQ-----LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIH 235
           V  V +N      V KY  + +     + V EN+GRD+   L      + + Y+YLC +H
Sbjct: 23  VCFVTSNPKIAFKVKKYINNTKKINYKVLVKENRGRDMAALLVTCHDFIME-YEYLCFVH 81

Query: 236 GKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLG-MIGSRRYRRYKRW 294
            KKS + G +  +G  +   ++ +L+G + +   I+     N  +G M+    Y      
Sbjct: 82  DKKSLQMG-NDNDGCKFMELIWKNLIGSTGLIENILRYLGNNRDVGLMVPPIPYWGNYIG 140

Query: 295 SFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN--GTMFWVKPKCLEPLRNLHL-IGEFE 351
            F    +  Y  VI+L  +        +   +   G  FW +   L+PL      + +F 
Sbjct: 141 VFINPWTCNYDNVINLGNQLKLKKNVCYEKEYVTIGGAFWCRTNALKPLFEYKWKLEDFC 200

Query: 352 EERNLKDGALEHAVER---FFACSVRYTEFSIESVD 384
           +E    DG + HA+ER   F A +  Y    I ++D
Sbjct: 201 QEPMAVDGTISHAIERILGFVALNNGYDVLEIINLD 236


>gi|146279467|ref|YP_001169625.1| hypothetical protein Rsph17025_3443 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557708|gb|ABP72320.1| hypothetical protein Rsph17025_3443 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 823

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 92/227 (40%), Gaps = 25/227 (11%)

Query: 152 AIVVHCYYQDTWIEI--SHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLY----V 205
           A+ VH +Y D       SH   RL       + +   N+    ++     +  LY    +
Sbjct: 591 ALHVHAFYTDDLAADVRSHRAFRLA----RRIVITTDNERKASEIRTRMGAEGLYPEVIL 646

Query: 206 MENKGRDVRPFLYL-LELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
           + N+GRD+ PF+ L L  G   + +  C +H KKS         G +WR +L   LLG  
Sbjct: 647 VPNRGRDILPFMQLFLPGGPAGKDEIWCHLHQKKSLATSD---SGDVWRAFLLRILLG-D 702

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYK-RWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
           D  +       ++P +G++    +  Y   W   A R+ + R     A R   P     L
Sbjct: 703 DAGLSDAVGHLRDPAVGLVAP--FDPYHVPWD--ASRALLPR----FAPRLPGPLPDNPL 754

Query: 324 DFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFF 369
            F  G MFWV+   +  + +L      +  E    DG   H VER +
Sbjct: 755 LFPVGNMFWVRAGVVRAMNDLFGPSYPWPNEPIANDGTEFHLVERLW 801


>gi|77404644|ref|YP_345218.1| glycosyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|77390294|gb|ABA81477.1| possible glycosyltransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 793

 Score = 44.3 bits (103), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 77/173 (44%), Gaps = 19/173 (10%)

Query: 183 VVEANKDFEQDVLKYFPSA-----QLYVMENKGRDVRPFLYL-LELGVFDRYDYLCKIHG 236
           VV  + D + D ++   +A     ++ V  N+GRD+ PFL L L  G     +  C +H 
Sbjct: 617 VVTTDSDRKADEIRTLMAAVGLAPEVLVRPNRGRDILPFLQLFLPGGAAGEDEIWCHLHQ 676

Query: 237 KKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS-RRYRRYKRWS 295
           KKS         G IWR +L   LLG  + ++    T  +NP +G++     Y  +  W 
Sbjct: 677 KKSLATTD---SGDIWRAFLLRILLG-DEASLSDAATNLRNPGVGLVAPFDPY--FIPWD 730

Query: 296 FFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG 348
             A R+ + R    +A R   P     L F  G MF+V+   +  + +L   G
Sbjct: 731 --ASRALLPR----VAPRLPGPLPDNPLLFPVGNMFFVRSAVVRAMNDLFGAG 777


>gi|310286583|ref|YP_003937841.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           S17]
 gi|309250519|gb|ADO52267.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           S17]
          Length = 662

 Score = 43.5 bits (101), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 98/247 (39%), Gaps = 29/247 (11%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKY---- 197
           ++G  ++S  A + H Y+ D   +    +  L  + DL++T  E   D  +D +      
Sbjct: 299 RTGADVRS--AFIYHIYFLDLLGDTCRYISALPEETDLYITTTEDKIDAIRDYMASHGVN 356

Query: 198 FPSAQLYVMENKGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKS---QREGYHPIEGIIWR 253
            P   + V+ N+GRDV   L    ++ +  +YD +   H KKS   Q  G+H  E   + 
Sbjct: 357 HPVTFISVV-NRGRDVSALLVAACDVVLSGKYDVIGFAHDKKSSQNQENGHHGTESQGFA 415

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR-----YRRYKRWSFFAKRSEVYRRV- 307
             L  + L   D    I+  F   P LG +         Y  +     +    E+ + + 
Sbjct: 416 YKLMENTLASRDYVENILTLFSNEPRLGQVAPPPPFHALYFAHTLPHDWGANFEITKELL 475

Query: 308 -----IDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE--FEEERNLKDGA 360
                I +    G P+         G+ +W + + L+PL       E    E    +DG 
Sbjct: 476 EDRFDIHVPLSPGKPSASA-----IGSCYWFRVEALKPLFEYGWKYEDFLPEGEMGEDGT 530

Query: 361 LEHAVER 367
           + HA+ER
Sbjct: 531 VSHAIER 537


>gi|224284010|ref|ZP_03647332.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           NCIMB 41171]
 gi|313141164|ref|ZP_07803357.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313133674|gb|EFR51291.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 662

 Score = 43.5 bits (101), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 98/247 (39%), Gaps = 29/247 (11%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKY---- 197
           ++G  ++S  A + H Y+ D   +    +  L  + DL++T  E   D  +D +      
Sbjct: 299 RTGADVRS--AFIYHIYFLDLLGDTCRYISALPEETDLYITTTEDKIDAIRDYMASHGVN 356

Query: 198 FPSAQLYVMENKGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKS---QREGYHPIEGIIWR 253
            P   + V+ N+GRDV   L    ++ +  +YD +   H KKS   Q  G+H  E   + 
Sbjct: 357 HPVTFISVV-NRGRDVSALLVAACDVVLSGKYDVIGFAHDKKSSQNQENGHHGTESQGFA 415

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR-----YRRYKRWSFFAKRSEVYRRV- 307
             L  + L   D    I+  F   P LG +         Y  +     +    E+ + + 
Sbjct: 416 YKLMENTLASRDYVENILTLFSNEPRLGQVAPPPPFHALYFAHTLPHDWGANFEITKELL 475

Query: 308 -----IDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE--FEEERNLKDGA 360
                I +    G P+         G+ +W + + L+PL       E    E    +DG 
Sbjct: 476 EDRFDIHVPLSPGKPSASA-----IGSCYWFRVEALKPLFEYGWKYEDFLPEGEMGEDGT 530

Query: 361 LEHAVER 367
           + HA+ER
Sbjct: 531 VSHAIER 537


>gi|326494820|dbj|BAJ94529.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 595

 Score = 38.5 bits (88), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 4/114 (3%)

Query: 28  NMQAIYIPAHVSGYYVLWSFSPK--QRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKL 85
           +++ IY  A V G  + W  +P   Q++ + DV F  +  F  F   L  F+ F  Y  +
Sbjct: 183 SVKGIYYQAEVQGQKITW-LTPHALQQVLTDDVDFNVMLTFLEFYETLLGFVNFKLYHSI 241

Query: 86  SFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSS 139
           +     I              L+R+MS+ R+P + E   ++++  E  ND+ SS
Sbjct: 242 NVNYPPILDSRLEALSAELYALSRYMSSGRLPGNPESNGFIEDK-ETENDKESS 294


>gi|254971800|gb|ACT98135.1| TNP2 [Glycine max]
          Length = 1063

 Score = 37.7 bits (86), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 75/170 (44%), Gaps = 22/170 (12%)

Query: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF 180
           E F     +F   ND P+    SG ++K  +A  + C    T++++ H            
Sbjct: 393 ESFRLRAMIFCTINDFPAYGNLSGYSVKGHLACPI-CEKDTTYLQLKHGK---------- 441

Query: 181 VTVVEANKDFEQDVLKYFPSAQLY-VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS 239
            TV   ++ F Q    + P  +L    +    +    + L  + VFDR   +C I+GK  
Sbjct: 442 KTVYTRHRRFLQ---PFHPYRRLKKAFDGTSENDSASIPLSGVEVFDRVKNICNIYGKTQ 498

Query: 240 QREGYHPIEGIIW-RRWLFFDLLGFSDIAIR---IINTFEQNPCLGMIGS 285
           +++G       IW +R +FFDL  + ++ +R    +   E+N C  ++G+
Sbjct: 499 KKDG---APKNIWKKRSIFFDLPYWCNLDVRHCLDVMHVEKNVCDSLVGT 545


Searching..................................................done


Results from round 2




>gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039878|gb|ACT56674.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 394

 Score =  525 bits (1353), Expect = e-147,   Method: Composition-based stats.
 Identities = 394/394 (100%), Positives = 394/394 (100%)

Query: 1   MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHF 60
           MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHF
Sbjct: 1   MYKVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHF 60

Query: 61  QELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDS 120
           QELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDS
Sbjct: 61  QELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDS 120

Query: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF 180
           EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF
Sbjct: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF 180

Query: 181 VTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ 240
           VTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ
Sbjct: 181 VTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ 240

Query: 241 REGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR 300
           REGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR
Sbjct: 241 REGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR 300

Query: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGA 360
           SEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGA
Sbjct: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGA 360

Query: 361 LEHAVERFFACSVRYTEFSIESVDCVAEYERLLH 394
           LEHAVERFFACSVRYTEFSIESVDCVAEYERLLH
Sbjct: 361 LEHAVERFFACSVRYTEFSIESVDCVAEYERLLH 394


>gi|315122628|ref|YP_004063117.1| hypothetical protein CKC_04400 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496030|gb|ADR52629.1| hypothetical protein CKC_04400 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 399

 Score =  493 bits (1269), Expect = e-137,   Method: Composition-based stats.
 Identities = 287/390 (73%), Positives = 335/390 (85%)

Query: 3   KVFRLKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQE 62
           K+FRLK K   +E L+ RLDVE KG++  +YIPA++SGYY+LWS S +Q+ITS+DV F+E
Sbjct: 8   KIFRLKIKSETLEKLVFRLDVENKGSVNTLYIPANISGYYMLWSLSKEQKITSEDVFFEE 67

Query: 63  LSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDSEK 122
           ++ F++ +FWLRSFL FSKYS+LSFPSCRIFFYGSRK++KAF RLNRFMSNSRMPFD +K
Sbjct: 68  VTTFKACLFWLRSFLTFSKYSQLSFPSCRIFFYGSRKDKKAFFRLNRFMSNSRMPFDGKK 127

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT 182
           FLY+KELFEGW +  S   K  + I SKIAIVVHCYYQDTW EISH+LLRLNFDFDLF+T
Sbjct: 128 FLYIKELFEGWKNLSSLDNKGKIKINSKIAIVVHCYYQDTWDEISHLLLRLNFDFDLFIT 187

Query: 183 VVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
            V+ NKDFEQDVLK FPSA+LYVMENKGRDV PFL LLELGVF  YDYLCKIHGKKS R 
Sbjct: 188 TVKKNKDFEQDVLKNFPSARLYVMENKGRDVLPFLCLLELGVFYDYDYLCKIHGKKSARR 247

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSE 302
            YHP EGI+WRRW+FFDLLGFSDIA+RIIN FEQNP +GMIGS R+RRYK++SFF KRS+
Sbjct: 248 NYHPFEGILWRRWIFFDLLGFSDIALRIINKFEQNPSIGMIGSGRFRRYKKYSFFKKRSK 307

Query: 303 VYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALE 362
           VY+RV+DLA+R  FP + L LDFFNGTMFWV+PKCLEPLRN+HL GEFEEE NL+DGALE
Sbjct: 308 VYKRVVDLARRIDFPVEELDLDFFNGTMFWVRPKCLEPLRNIHLTGEFEEECNLEDGALE 367

Query: 363 HAVERFFACSVRYTEFSIESVDCVAEYERL 392
           HAVERFF  SV+   FS+ESVDCVAEY++L
Sbjct: 368 HAVERFFPLSVQRAGFSLESVDCVAEYDQL 397


>gi|315122651|ref|YP_004063140.1| hypothetical protein CKC_04515 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496053|gb|ADR52652.1| hypothetical protein CKC_04515 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 405

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 167/390 (42%), Positives = 227/390 (58%), Gaps = 10/390 (2%)

Query: 4   VFRLKSKLGKIENLLLRLD-VEEKGNMQAIYIPAHVS--GYYVLWSFSPKQRITSKDVHF 60
           V+RL  K    +  L     V  K    +I++P      GY +  S        S  +  
Sbjct: 7   VYRLIPKSEFRDCSLCNFQMVSSKNRKLSIFLPVSGCRKGYLLFVSRRENWNFDSNHLVI 66

Query: 61  QELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKEQKAFLRLNRFMSNSRMPFDS 120
           +++S F  F FW+RS   F +Y  L +   RI  YGSR  +K F   N+ M    +PFD 
Sbjct: 67  RKVSFFLGFFFWIRSLFLFKRYQTLRYDENRIIAYGSRIGKKFFACSNKDMLARGVPFDG 126

Query: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF 180
           EK      L  GW D PSS K + + I+S++AIVVH YY D W EI+++L  LNF FDL 
Sbjct: 127 EKIHRFPRLLHGW-DSPSSEKIASVKIQSRVAIVVHIYYADLWAEIANLLSGLNFSFDLH 185

Query: 181 VTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQ 240
           +T+V      + ++LK FP+A +YVMEN GRD+R FL LLE G  D YDY+CKIHGKKS+
Sbjct: 186 ITLVTEIASIKSEILKRFPNAHIYVMENYGRDIRSFLKLLEGGKLDSYDYVCKIHGKKSK 245

Query: 241 REGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR 300
           R G+   +G +WRRWLFFDLLG   IA+ II TFE+ P +GMIGSR YR  ++ S    R
Sbjct: 246 RNGHVWWDGDLWRRWLFFDLLGAPGIALEIIKTFEKYPKIGMIGSRTYRYDQKISLGNNR 305

Query: 301 SEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLK--D 358
                 V  +A + G   +   +DFF GTMFWV+P+ L+P++NL L   F+ + ++   D
Sbjct: 306 ----EFVCAIANKMGVSFEDTKIDFFGGTMFWVRPQALDPIKNLALTQYFKSKVDMVGLD 361

Query: 359 GALEHAVERFFACSVRYTEFSIESVDCVAE 388
           G LEHA+ER F+ SV    F +  VDC++E
Sbjct: 362 GCLEHAIERCFSISVEKANFDLAYVDCLSE 391


>gi|254780923|ref|YP_003065336.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040600|gb|ACT57396.1| hypothetical protein CLIBASIA_04110 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 365

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 145/364 (39%), Positives = 213/364 (58%), Gaps = 6/364 (1%)

Query: 34  IPAHVS--GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCR 91
           +P      GY++  S        S   + ++++++  F FW  + L + +  KL +    
Sbjct: 1   MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT-LFYKRSKKLCYDENY 59

Query: 92  IFFYGSRKEQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKI 151
           +  YGSR  +K F + N +M    + FD ++  +  +L  GW + P+  K   + IK+KI
Sbjct: 60  VVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGW-ESPAMGKVMQIAIKAKI 118

Query: 152 AIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGR 211
           AIVVH YY D WIEI+++L  L+  FDL VT+V  +   + ++LK FP+A++++MEN GR
Sbjct: 119 AIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGR 178

Query: 212 DVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRII 271
           DV PFL LLE      YDY+CKIHGKKS+R+GY   EG +WRRWLF+DLLG   +  +II
Sbjct: 179 DVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKII 238

Query: 272 NTFEQNPCLGMIGSRRYRRYKRWSFFAKR-SEVYRRVIDLAKRAGFPTKRLHLDFFNGTM 330
            TF+ +  +GMIGSR YR   ++  +     +    +  LA R G   +   LDFF GTM
Sbjct: 239 RTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTM 298

Query: 331 FWVKPKCLEPLRNLHLIGEFEEE-RNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEY 389
           FWV+ + L+P++NL L   FE +     DG +EHAVER F+ SV+   F I  VDC+  Y
Sbjct: 299 FWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGY 358

Query: 390 ERLL 393
            + L
Sbjct: 359 RKSL 362


>gi|295687882|ref|YP_003591575.1| rhamnan synthesis protein F [Caulobacter segnis ATCC 21756]
 gi|295429785|gb|ADG08957.1| Rhamnan synthesis F [Caulobacter segnis ATCC 21756]
          Length = 818

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 90/372 (24%), Positives = 145/372 (38%), Gaps = 34/372 (9%)

Query: 18  LLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFL 77
           ++R  + E   + A Y+P  + G    W    ++       H  +    ES++ WL   L
Sbjct: 466 VVRHKLSELSRVDAAYVPGVMPG----WDNQARKPWAGHAFHNADP---ESYLTWLSGAL 518

Query: 78  --AFSKYSKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKF-LYVKELFEG 132
             A +++ K       + F  +  E  + A+L  +R+  +  +         Y   L + 
Sbjct: 519 THAVARHPK----GEAMVFVNAWNEWGEGAYLEPDRWFGHGYLHATRAALSAYQPRLTDA 574

Query: 133 WNDRPSSPKKSGLTIKSKIAI-VVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDF- 190
               P   +     +K   A+ ++H +Y +     +  L       DL +TV E   +  
Sbjct: 575 ---HPLVAQAQAAFVKRADAVTLLHLFYPELIDWFAERLAATADVLDLMITVPETWSEAD 631

Query: 191 EQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGI 250
                  FP A L + EN+GRD+RPF+  L       Y   CK+H K+S     H  +G 
Sbjct: 632 LARARATFPMAHLAIAENRGRDIRPFVETLRRARTLGYSVFCKLHSKRSP----HRAKGD 687

Query: 251 IWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR--YRRYKRWSFFAKRSEVYRRVI 308
            WR  L   LLG  + A   +  F Q+  LG++ +     R          R +  R   
Sbjct: 688 EWRAELVDGLLGG-EAAALALRAFAQDAKLGLLAAAGSRLRIGDPDVMNNNRQDADR--- 743

Query: 309 DLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVER 367
            LA+R G         F  G+MFW + +   PL +L     +F  E    DG   HA+ER
Sbjct: 744 -LARRMGLKLAPET-PFSAGSMFWGRTEAFAPLSDLTDAEIDFGPELGRVDGTTAHAIER 801

Query: 368 FFACSVRYTEFS 379
             A  V    + 
Sbjct: 802 LTAAIVARAGYR 813


>gi|122879048|ref|YP_199439.6| hypothetical protein XOO0800 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 546

 Score =  290 bits (743), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 85/376 (22%), Positives = 150/376 (39%), Gaps = 39/376 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++   +    P    G    W   P++    +         +       R +L  + 
Sbjct: 190 DMEQRPLREYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLMLTV 238

Query: 82  YSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
            ++L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+        
Sbjct: 239 RNRLKNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEVV------- 291

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
                   + +    +V+H +Y D   E    L        L VT          Q + +
Sbjct: 292 ------TRSGQHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQ 345

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ+   EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +
Sbjct: 346 RGLQAQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDM 401

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LL        I+  F ++P LG++   ++       F    ++       L  R G 
Sbjct: 402 LSGLLAPQH-VAAIVRGFAEDPLLGLVAPAQH-LLPVTDFMGGNADALDY---LTVRTGT 456

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                H  F +G+MFWVK + L PL + HL   EFE E+   DG L HA+ERF A +V +
Sbjct: 457 DAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAH 516

Query: 376 TEFSIESVDCVAEYER 391
           +   + +++ +    +
Sbjct: 517 SGQRVATIEQLLGIPQ 532


>gi|84622385|ref|YP_449757.1| hypothetical protein XOO_0728 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578640|ref|YP_001915569.1| hypothetical protein PXO_03177 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84366325|dbj|BAE67483.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523092|gb|ACD61037.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 695

 Score =  288 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 85/376 (22%), Positives = 150/376 (39%), Gaps = 39/376 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++   +    P    G    W   P++    +         +       R +L  + 
Sbjct: 339 DMEQRPLREYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLMLTV 387

Query: 82  YSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
            ++L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+        
Sbjct: 388 RNRLKNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEVV------- 440

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
                   + +    +V+H +Y D   E    L        L VT          Q + +
Sbjct: 441 ------TRSGQHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQ 494

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ+   EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +
Sbjct: 495 RGLQAQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDM 550

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LL        I+  F ++P LG++   ++       F    ++       L  R G 
Sbjct: 551 LSGLLAPQH-VAAIVRGFAEDPLLGLVAPAQH-LLPVTDFMGGNADALDY---LTVRTGT 605

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                H  F +G+MFWVK + L PL + HL   EFE E+   DG L HA+ERF A +V +
Sbjct: 606 DAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAH 665

Query: 376 TEFSIESVDCVAEYER 391
           +   + +++ +    +
Sbjct: 666 SGQRVATIEQLLGIPQ 681


>gi|58425017|gb|AAW74054.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 727

 Score =  288 bits (738), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 85/376 (22%), Positives = 150/376 (39%), Gaps = 39/376 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++   +    P    G    W   P++    +         +       R +L  + 
Sbjct: 371 DMEQRPLREYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLMLTV 419

Query: 82  YSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
            ++L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+        
Sbjct: 420 RNRLKNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEVV------- 472

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
                   + +    +V+H +Y D   E    L        L VT          Q + +
Sbjct: 473 ------TRSGQHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQ 526

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ+   EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +
Sbjct: 527 RGLQAQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDM 582

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LL        I+  F ++P LG++   ++       F    ++       L  R G 
Sbjct: 583 LSGLLAPQH-VAAIVRGFAEDPLLGLVAPAQH-LLPVTDFMGGNADALDY---LTVRTGT 637

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                H  F +G+MFWVK + L PL + HL   EFE E+   DG L HA+ERF A +V +
Sbjct: 638 DAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAH 697

Query: 376 TEFSIESVDCVAEYER 391
           +   + +++ +    +
Sbjct: 698 SGQRVATIEQLLGIPQ 713


>gi|325928558|ref|ZP_08189746.1| Lipopolysaccharide biosynthesis protein/putative glycosyl
           transferase [Xanthomonas perforans 91-118]
 gi|325541097|gb|EGD12651.1| Lipopolysaccharide biosynthesis protein/putative glycosyl
           transferase [Xanthomonas perforans 91-118]
          Length = 695

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 85/376 (22%), Positives = 150/376 (39%), Gaps = 39/376 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++   +    P    G    W   P++    +         +       R +L  + 
Sbjct: 339 DMEQRPLREYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLMRTV 387

Query: 82  YSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
             +L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+            
Sbjct: 388 RDRLRNTPPAHRLVFINAWNEWAEGAVLEPDTRLGYAWLHATRQALLHTA---------- 437

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
                +  + +  + +V+H +Y D   E    +        L +T      +   Q + +
Sbjct: 438 ---GAATGSDQRDVCVVLHAWYLDVLDEALEAIAHCGLSLRLVITTDITMVEQVRQRLQQ 494

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ+   EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +
Sbjct: 495 RGVQAQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRREM 550

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
           F  LL        I+  F  +P LG+    ++       F    ++       LA R G 
Sbjct: 551 FSALLAPQH-VDAIMRGFADDPLLGLAAPAQH-LLPVTDFIGGNADALDY---LAVRTGT 605

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                H  F +G+MFWVK + L PL + HL   EFE+E+   DG L HA+ERF A +V +
Sbjct: 606 DAINEHSMFASGSMFWVKLEALRPLLDAHLHPSEFEDEQGQIDGTLAHAIERFLAVAVGH 665

Query: 376 TEFSIESVDCVAEYER 391
               + +V+ +    +
Sbjct: 666 CGHHVATVEQLLGIAQ 681


>gi|166713445|ref|ZP_02244652.1| hypothetical protein Xoryp_18900 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 695

 Score =  287 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 85/376 (22%), Positives = 150/376 (39%), Gaps = 39/376 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++   +    P    G    W   P++    +         +       R +L  + 
Sbjct: 339 DMEQRPLREYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLILTV 387

Query: 82  YSKL--SFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
            ++L  + P+ R+ F  +  E  + A L  +  +  + +    +  L+  E+        
Sbjct: 388 RNRLKNTTPAHRLVFINAWNEWAEGAVLEPDTRVGYAWLDATRQALLHTAEVV------- 440

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
                   + +    +V+H +Y D   E    L        L VT          Q + +
Sbjct: 441 ------TRSGQHDACVVLHAWYLDVLDEALDALAHCGLSLRLVVTTDITMVTQVRQCLQQ 494

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ+   EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +
Sbjct: 495 RGLQAQVEGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDTWRRDM 550

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LL        I+  F ++P LG++   ++       F    ++       L  R G 
Sbjct: 551 LSGLLAPQH-VAAIVRGFAEDPLLGLVAPAQH-LLPVTDFIGGNADALDY---LTVRTGT 605

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                H  F +G+MFWVK + L PL + HL   EFE E+   DG L HA+ERF A +V +
Sbjct: 606 DAINAHSLFASGSMFWVKLEALRPLLDAHLHPSEFESEQGQIDGTLAHAIERFLAVAVAH 665

Query: 376 TEFSIESVDCVAEYER 391
           +   + +++ +    +
Sbjct: 666 SGQRVATIEQLLGIPK 681


>gi|77748730|ref|NP_643883.2| hypothetical protein XAC3576 [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 546

 Score =  285 bits (729), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 88/376 (23%), Positives = 149/376 (39%), Gaps = 39/376 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++   +    P    G    W   P++    +         +       R +L  + 
Sbjct: 190 DMEQRPLREYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLMRTV 238

Query: 82  YSKLSF--PSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
             +L+   P+ R+ F  +  E  + A L  +  +  + +    +  L+      G + R 
Sbjct: 239 RDRLTNTPPAHRLVFINAWNEWAEGAVLEPDTRLGYAWLHATRQALLHTAGAATGSDLR- 297

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
                          +V+H +Y D   E    +        L VT      +   Q + +
Sbjct: 298 ------------DACVVLHAWYLDVLDEALDAIADCGLSLRLVVTTDITMVEQVRQRLQQ 345

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ+   EN+GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +
Sbjct: 346 RGVQAQVDGFENRGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDAWRREM 401

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
           F  LL     A  I+  F  +P LG+    ++       F    ++       LA R G 
Sbjct: 402 FSALL-TPQHADAIMRGFTDDPLLGLAAPAQH-LLPVTDFIGGNADALDY---LAVRTGT 456

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                H  F +G+MFWVK + L PL + +L   EFE E+   DG L HA+ERF A +V +
Sbjct: 457 DAIDEHSVFASGSMFWVKLEALRPLLDANLHPSEFENEQGQIDGTLAHAIERFLAVAVSH 516

Query: 376 TEFSIESVDCVAEYER 391
               + ++D +    +
Sbjct: 517 CGHHVATIDQLLGIPQ 532


>gi|77747764|ref|NP_636021.2| hypothetical protein XCC0629 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|77761299|ref|YP_244667.2| hypothetical protein XC_3605 [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 546

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 76/377 (20%), Positives = 141/377 (37%), Gaps = 39/377 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++        P    G    W   P++    +         +       R +LA + 
Sbjct: 190 DMEQRPLRDYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLARTV 238

Query: 82  YSKLSF--PSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
             +L+    + R+ F  +  E  + A L  +  +  + +    +                
Sbjct: 239 QHRLANAPSAHRMVFINAWNEWAEGAVLEPDARLGYAWLDATRQALTR------------ 286

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD-VLK 196
            +P  +         +V+H +Y D   E+   ++       + +T            + +
Sbjct: 287 -APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQR 345

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR  +
Sbjct: 346 RGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWRGEM 401

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LLG       I+N F  +P  G+     +       F    ++       L  R G 
Sbjct: 402 LTALLGPQ-RVDAIVNAFSTDPLAGLAAPEDH-LLPVTEFIGGNADALDY---LTVRTGS 456

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                +  F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   +V +
Sbjct: 457 DAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGLAVTH 516

Query: 376 TEFSIESVDCVAEYERL 392
           +   + +V+      + 
Sbjct: 517 SGHRVTTVEQTLGITKT 533


>gi|188993121|ref|YP_001905131.1| conserved protein involved in carbohydrate biosynthesis
           [Xanthomonas campestris pv. campestris str. B100]
 gi|189030067|sp|B0RVK2|WXCX_XANCB RecName: Full=Uncharacterized protein wxcX
 gi|167734881|emb|CAP53093.1| conserved protein involved in carbohydrate biosynthesis
           [Xanthomonas campestris pv. campestris]
          Length = 695

 Score =  282 bits (722), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 76/377 (20%), Positives = 142/377 (37%), Gaps = 39/377 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++        P    G    W   P++    +         +       R +LA + 
Sbjct: 339 DMEQRPLRDYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLARTV 387

Query: 82  YSKLSF--PSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
             +L+    + R+ F  +  E  + A L  +  +  + +    +                
Sbjct: 388 QHRLANAPSAHRMVFINAWNEWAEGAVLEPDARLGYAWLDATRQALTR------------ 435

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD-VLK 196
            +P  +         +V+H +Y D   E+   ++       + +T            + +
Sbjct: 436 -APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQR 494

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR  +
Sbjct: 495 RGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWRGEM 550

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LLG       I+N F  +P +G+     +       F    ++       L  R G 
Sbjct: 551 LTALLGPQ-RVDAIVNAFSTDPLVGLAAPEDH-LLPVTEFIGGNADALDY---LTVRTGS 605

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                +  F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   +V +
Sbjct: 606 DAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGLAVTH 665

Query: 376 TEFSIESVDCVAEYERL 392
           +   + +V+      + 
Sbjct: 666 SGHRVTTVEQTLGITKT 682


>gi|189030068|sp|P0C7J1|WXCX_XANCP RecName: Full=Uncharacterized protein wxcX
          Length = 695

 Score =  281 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 76/377 (20%), Positives = 141/377 (37%), Gaps = 39/377 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++        P    G    W   P++    +         +       R +LA + 
Sbjct: 339 DMEQRPLRDYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLARTV 387

Query: 82  YSKLSF--PSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
             +L+    + R+ F  +  E  + A L  +  +  + +    +                
Sbjct: 388 QHRLANAPSAHRMVFINAWNEWAEGAVLEPDARLGYAWLDATRQALTR------------ 435

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD-VLK 196
            +P  +         +V+H +Y D   E+   ++       + +T            + +
Sbjct: 436 -APDVATEICSPSACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQR 494

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR  +
Sbjct: 495 RGIQAEVEGFENRGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWRGEM 550

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LLG       I+N F  +P  G+     +       F    ++       L  R G 
Sbjct: 551 LTALLGPQ-RVDAIVNAFSTDPLAGLAAPEDH-LLPVTEFIGGNADALDY---LTVRTGS 605

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
                +  F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   +V +
Sbjct: 606 DAPDTNSLFASGSMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGLAVTH 665

Query: 376 TEFSIESVDCVAEYERL 392
           +   + +V+      + 
Sbjct: 666 SGHRVTTVEQTLGITKT 682


>gi|16124886|ref|NP_419450.1| hypothetical protein CC_0633 [Caulobacter crescentus CB15]
 gi|221233606|ref|YP_002516042.1| hypothetical protein CCNA_00669 [Caulobacter crescentus NA1000]
 gi|13421844|gb|AAK22618.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|51039815|tpg|DAA00361.1| TPA_exp: conserved hypothetical protein [Caulobacter vibrioides]
 gi|220962778|gb|ACL94134.1| hypothetical protein CCNA_00669 [Caulobacter crescentus NA1000]
          Length = 818

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 89/371 (23%), Positives = 143/371 (38%), Gaps = 32/371 (8%)

Query: 18  LLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFL 77
           + R  ++E   + A ++P  + G    W    ++       H  +    ES+  WL   L
Sbjct: 466 VARHKLDELEQVPAAFVPGVMPG----WDNQARKPWAGVAFHNADP---ESYFGWLSGAL 518

Query: 78  --AFSKYSKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGW 133
             A +++ K       + F  +  E  + A+L  +R+  +  +            L    
Sbjct: 519 KHAEARHPK----GEALVFVNAWNEWGEGAYLEPDRWFGHGYLHATRTAL--SAWLPRLT 572

Query: 134 NDRPSSPKKSGLTIKSKIAI-VVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDF-E 191
           N  P   +      K   A+ ++H +Y +     +  L       DL +TV E   +   
Sbjct: 573 NAHPIIAEAQSQFAKRADAVTLLHLFYPELIDWFAERLAATADVLDLMITVPETWSEADL 632

Query: 192 QDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGII 251
                 FP+A L + EN+GRD+RPF+  L       Y   CK+H K+S     H  +G  
Sbjct: 633 ARARAAFPTAHLAIAENRGRDIRPFVETLRRARALGYSVFCKLHSKRSP----HQAKGDQ 688

Query: 252 WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR--YRRYKRWSFFAKRSEVYRRVID 309
           WR  L   LLG  + A   +  F Q+P LG++ +     R          R+E  R    
Sbjct: 689 WRTTLVEGLLGG-EAAALALRAFAQDPKLGLLAAAGARMRIGDPDVMDNNRAEADR---- 743

Query: 310 LAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERF 368
           L+   G   +     F  G+MFW + +   PL +L      F  E    DG   HA+ER 
Sbjct: 744 LSAHMGLKPRPET-PFAAGSMFWGRTEAFAPLTDLSDDEIAFGPELGRVDGTTAHAIERL 802

Query: 369 FACSVRYTEFS 379
            A  V    + 
Sbjct: 803 TAAIVERAGYR 813


>gi|325921211|ref|ZP_08183074.1| lipopolysaccharide biosynthesis protein [Xanthomonas gardneri ATCC
           19865]
 gi|325548310|gb|EGD19301.1| lipopolysaccharide biosynthesis protein [Xanthomonas gardneri ATCC
           19865]
          Length = 706

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 85/379 (22%), Positives = 147/379 (38%), Gaps = 39/379 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++        P    G    W   P++    +         +       R +L+ + 
Sbjct: 332 DMEQRPLRDYTLYPGVNPG----WDNEPRRSGKGRIYLHASPRRY-------RDWLSRTV 380

Query: 82  YSKLS--FPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
             +L+   P+ R+ F  +  E  + A L  +  + ++ +    E  +            P
Sbjct: 381 QQRLANALPAHRMVFINAWNEWAEGAVLEPDARLGHAWLEATREALI-----------GP 429

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
           S  K        ++ +V+H +Y D   E+   +        L +T       +    V +
Sbjct: 430 S--KVVSELAPHRVCVVLHAWYLDVLDEMLDAVAHCAISPRLVITTDLTMVVEVRHRVQQ 487

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WR  +
Sbjct: 488 RGMQAEVEGFENRGRDILPFLHVANRLLDEGVCLVVKLHTKKST----HRSDGDTWRHEM 543

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LL   + A  I+N F  +P LG+     +       F    ++       L  R G 
Sbjct: 544 LSALLA-PERADAIVNAFSSDPLLGLAAPDGH-LLPVADFIGGNTDALDY---LGARTGT 598

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRY 375
            T      F +G+MFW + + L PL + HL   EFE E+   DG L HA+ERF   S   
Sbjct: 599 ETAIEQGMFASGSMFWARLEALRPLLDAHLHPSEFETEQGQIDGTLAHAIERFMGISAIQ 658

Query: 376 TEFSIESVDCVAEYERLLH 394
           + + I ++    E     H
Sbjct: 659 SGYRIATIGQALEISTENH 677


>gi|21111631|gb|AAM39945.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575237|gb|AAY50647.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 296

 Score =  276 bits (707), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 65/305 (21%), Positives = 118/305 (38%), Gaps = 26/305 (8%)

Query: 92  IFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKS 149
           + F  +  E  + A L  +  +  + +    +                 +P  +      
Sbjct: 1   MVFINAWNEWAEGAVLEPDARLGYAWLDATRQALTR-------------APDVATEICSP 47

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD-VLKYFPSAQLYVMEN 208
              +V+H +Y D   E+   ++       + +T            + +    A++   EN
Sbjct: 48  SACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQRRGIQAEVEGFEN 107

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAI 268
           +GRD+ PFL++    + +    + K+H KKS     H  +G  WR  +   LLG      
Sbjct: 108 RGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWRGEMLTALLGPQ-RVD 162

Query: 269 RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNG 328
            I+N F  +P  G+     +       F    ++       L  R G      +  F +G
Sbjct: 163 AIVNAFSTDPLAGLAAPEDH-LLPVTEFIGGNADALDY---LTVRTGSDAPDTNSLFASG 218

Query: 329 TMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVA 387
           +MFW + + L PL + HL   EFE E+   DG L HA+ERF   +V ++   + +V+   
Sbjct: 219 SMFWARLEALRPLLDAHLHASEFESEQGQIDGTLAHAIERFVGLAVTHSGHRVTTVEQTL 278

Query: 388 EYERL 392
              + 
Sbjct: 279 GITKT 283


>gi|325915787|ref|ZP_08178089.1| Putative glycosyltransferase [Xanthomonas vesicatoria ATCC 35937]
 gi|325538051|gb|EGD09745.1| Putative glycosyltransferase [Xanthomonas vesicatoria ATCC 35937]
          Length = 695

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 85/376 (22%), Positives = 146/376 (38%), Gaps = 39/376 (10%)

Query: 22  DVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSK 81
           D+E++   +    P    G    W   P++    +         +       R +L+ + 
Sbjct: 339 DIEQRPLREYTLYPGVNPG----WDNEPRRSGKGRVYLHASPRRY-------RDWLSTTV 387

Query: 82  YSKLSF--PSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
           + +L+    + R+ F  +  E  + A L  +  + ++ +    +                
Sbjct: 388 HHRLAHVPTAHRLVFINAWNEWAEGAVLEPDMRLGHAWLDATRQAMTRSAH--------- 438

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLK 196
                       +  +VVH +Y D   EI   L        L VT            + +
Sbjct: 439 ----DVPAPRTYRACVVVHAWYLDVLDEILDALAPSVAMLRLIVTTDLTLVGQVRGRLQQ 494

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
           +   A++   EN+GRD+ PFL++    + +    + K+H KKS     H  +G  WRR +
Sbjct: 495 HGIEAEVEGFENRGRDILPFLHIANRLLDEGEQLVVKLHTKKST----HRHDGDAWRREM 550

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
              LLG       I+N F  +P LG+    ++       F    ++       LA R G 
Sbjct: 551 LAALLGG-GRVDAIVNAFVADPQLGLAAPAQHLLA-VTDFIGGNADALDY---LAVRTGT 605

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRY 375
            T   H  F +G+MFW K   L PL + HL   +FE E+   DG L HA+ERF   +V +
Sbjct: 606 GTVTEHDRFASGSMFWAKLDALRPLLDAHLQPGDFEGEQGQIDGTLAHAIERFLGHAVLH 665

Query: 376 TEFSIESVDCVAEYER 391
           +   I ++D +     
Sbjct: 666 SGHRIATIDGLMGQRE 681


>gi|21109952|gb|AAM38419.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 296

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 77/304 (25%), Positives = 125/304 (41%), Gaps = 26/304 (8%)

Query: 92  IFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKS 149
           + F  +  E  + A L  +  +  + +    +  L+      G + R             
Sbjct: 1   MVFINAWNEWAEGAVLEPDTRLGYAWLHATRQALLHTAGAATGSDLR------------- 47

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYFPSAQLYVMEN 208
              +V+H +Y D   E    +        L VT      +   Q + +    AQ+   EN
Sbjct: 48  DACVVLHAWYLDVLDEALDAIADCGLSLRLVVTTDITMVEQVRQRLQQRGVQAQVDGFEN 107

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAI 268
           +GRD+ PFL +    + +    + K+H KKS     H  +G  WRR +F  LL     A 
Sbjct: 108 RGRDILPFLRVANRLLDEGEQVVLKLHTKKST----HREDGDAWRREMFSALL-TPQHAD 162

Query: 269 RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNG 328
            I+  F  +P LG+    ++       F    ++       LA R G      H  F +G
Sbjct: 163 AIMRGFTDDPLLGLAAPAQH-LLPVTDFIGGNADALDY---LAVRTGTDAIDEHSVFASG 218

Query: 329 TMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVA 387
           +MFWVK + L PL + +L   EFE E+   DG L HA+ERF A +V +    + ++D + 
Sbjct: 219 SMFWVKLEALRPLLDANLHPSEFENEQGQIDGTLAHAIERFLAVAVSHCGHHVATIDQLL 278

Query: 388 EYER 391
              +
Sbjct: 279 GIPQ 282


>gi|325928537|ref|ZP_08189725.1| Lipopolysaccharide biosynthesis protein [Xanthomonas perforans
            91-118]
 gi|325541076|gb|EGD12630.1| Lipopolysaccharide biosynthesis protein [Xanthomonas perforans
            91-118]
          Length = 1415

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 82/350 (23%), Positives = 144/350 (41%), Gaps = 36/350 (10%)

Query: 38   VSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGS 97
            + G +  W    ++      V     + +     WLR  + +S+  K       + F  +
Sbjct: 1075 IRGVFPSWDNDARKPGRGYTVARSTPARYR---TWLRGAIDYSR--KFPVRGESLVFVNA 1129

Query: 98   RKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVV 155
              E  + A L  +R    + +                   RP  P+        ++A+V+
Sbjct: 1130 WNEWAEGAHLEPDRKYGYAYLEATRRAL-----------RRPVMPR-----TPERVAVVI 1173

Query: 156  HCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS-AQLYVMENKGRDVR 214
            H +Y +   E+   L   +  + L ++ V    D  +  L      A + V EN+GRD+ 
Sbjct: 1174 HAFYPEILPEMLKELQSWDVPYFLIISTVADKADEVRGYLADLSVVADVRVFENRGRDIL 1233

Query: 215  PFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTF 274
            PFL +++  +  R   + K+H K+S     H  +G  WRR +   LL    +A  I   F
Sbjct: 1234 PFLEIMK-DLRGRESLVLKLHTKRSL----HRQDGESWRRDMLEKLLAPK-VASEIFAAF 1287

Query: 275  EQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF-PTKRLHLDFFNGTMFWV 333
             +   LG+     +       + A    V+R    L+K+    P   +   F  G+MF+V
Sbjct: 1288 REQERLGLAAPEGHILSMTTYWGANADTVHR----LSKQMHVDPVNPVTAMFAAGSMFYV 1343

Query: 334  KPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRYTEFSIES 382
            +P+ ++ + +L L   +FE E    DG L HA+ER F+ +V  T + I S
Sbjct: 1344 RPEAIDSIMDLDLRREDFEPEAGQVDGTLAHAIERCFSLAVCSTGYYIAS 1393


>gi|194364297|ref|YP_002026907.1| hypothetical protein Smal_0519 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347101|gb|ACF50224.1| conserved hypothetical protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 686

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 74/361 (20%), Positives = 134/361 (37%), Gaps = 44/361 (12%)

Query: 35  PAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLS--FPSCRI 92
           P    G    W    ++    + +          +  WL      + + +L    P+ R+
Sbjct: 349 PGVNPG----WDNEARRPGRGRVLLHASP---RGYADWLHD----TVHGRLRDVPPARRM 397

Query: 93  FFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSK 150
            F  +  E  + A L  +  + ++ +                    PS P  S      +
Sbjct: 398 VFINAWNEWAESAVLEPDARLGHAWLQATRRAM------------TPSQPAPS------R 439

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS-AQLYVMENK 209
             +V+H ++ D   E+   +        L +T     +   Q + +     A+++  +N 
Sbjct: 440 PCVVIHAWHLDALPELLSAVKDSGLPARLVITTTSDRQAQVQSITESHGLPAEIWAYDNH 499

Query: 210 GRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIR 269
           GRD+ PFL+  +  +      + K+H K+S     H   G  WRR +   LLG +  A  
Sbjct: 500 GRDILPFLHAADRLLQQNESLVLKLHTKRST----HRDNGDQWRREMVDALLGPAQAAAN 555

Query: 270 IINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGT 329
            +   + +P LG++    +       +    +   +R+  L  + G         F +G+
Sbjct: 556 -LAHLQADPRLGLMAPAGH-LLNVADYIGGNA---QRMERLWAQLGLDGAPGDGQFASGS 610

Query: 330 MFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAE 388
           MFWV+ + L PL + HL+   FE E    DG L HA+ER          FS+     V  
Sbjct: 611 MFWVRLQALRPLLDAHLLPSMFEVEAGQIDGTLAHAIERATGAVATCAGFSVGDTSQVHG 670

Query: 389 Y 389
            
Sbjct: 671 A 671


>gi|320531350|ref|ZP_08032322.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320136441|gb|EFW28417.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 626

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 56/242 (23%), Positives = 101/242 (41%), Gaps = 10/242 (4%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQ 202
              + K+A++ H Y+ D           +    DL +TV    K +  +   +  P +  
Sbjct: 304 EPKQQKVALIAHLYFMDLLDSTLAYARSMPEGTDLILTVGSQEKAELVERACQDLPYNVD 363

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           + V+EN+GRDV   L   +  V D YD +C +H KK  +   +   G  + R  F +LL 
Sbjct: 364 VRVIENRGRDVSALLVGCKDIV-DDYDLVCFMHDKKVTQLSPY-TVGEGFARKCFDNLLP 421

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVYRRVIDLAKRAGFPT 318
             +    ++ TF+  P LG++          +      +    +  + +++       P 
Sbjct: 422 TREFVENVVATFDSEPRLGLLSPTPPNHADYFPIYSYSWGPNFDRTKMLLEKELNLNVPL 481

Query: 319 KRL-HLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYT 376
                +    GTMFW +P  L+PL +      +F  E N  DG + HA+ER +    + +
Sbjct: 482 DAHKEVIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEPNDIDGTILHAIERAYGYVAQAS 541

Query: 377 EF 378
            +
Sbjct: 542 GY 543


>gi|289662624|ref|ZP_06484205.1| hypothetical protein XcampvN_05932 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 945

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 74/258 (28%), Positives = 118/258 (45%), Gaps = 14/258 (5%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--- 193
           P         ++ K+ ++VH +Y D   E +  L ++   +DL V+V++   + +     
Sbjct: 71  PFGRPVPSAQLQLKVGVMVHVFYPDLIDEFAQSLQQMPVGYDLLVSVMDNAAEAQARDRF 130

Query: 194 -VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIW 252
             L+      + ++ N+GRD+ P L      +    D +  +H KKS   G    E   W
Sbjct: 131 SKLQQIEKLDIRIVPNRGRDIAPLLVTFREQILAL-DVVGHLHTKKSLYTG---SEQGQW 186

Query: 253 RRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVYRRVIDLA 311
           RR+L   L+G ++     +  F+  P LGM+    Y R   W+  +    EV R    LA
Sbjct: 187 RRYLVSSLMGSAERIAWQLGMFQAEPRLGMLYPESYERVPLWAHTWLSNFEVCR---TLA 243

Query: 312 KRAGFPTK-RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
           +R GF      ++DF  G+MFW K   L PL  L+L + +F EE    DG L HA+ER F
Sbjct: 244 QRLGFDINASEYIDFPAGSMFWAKVDALRPLYALNLELKDFPEEHGQIDGTLHHAMERMF 303

Query: 370 ACSVRYTEFSIESVDCVA 387
              VR+  + I  +    
Sbjct: 304 VAVVRHQHYRIGILPQDG 321


>gi|289668432|ref|ZP_06489507.1| hypothetical protein XcampmN_08015 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 945

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 74/258 (28%), Positives = 118/258 (45%), Gaps = 14/258 (5%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--- 193
           P         ++ K+ ++VH +Y D   E +  L ++   +DL V+V++   + +     
Sbjct: 71  PFGRPVPSAQLQVKVGVMVHVFYPDLIDEFAQSLQQMPVGYDLLVSVMDNAAEAQARDRF 130

Query: 194 -VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIW 252
             L+      + ++ N+GRD+ P L      +    D +  +H KKS   G    E   W
Sbjct: 131 SKLQQIEKLDIRIVPNRGRDIAPLLVTFREQILAL-DVVGHLHTKKSLYTG---SEQGQW 186

Query: 253 RRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVYRRVIDLA 311
           RR+L   L+G ++     +  F+  P LGM+    Y R   W+  +    EV R    LA
Sbjct: 187 RRYLVSSLMGSAERIAWQLGMFQAEPRLGMLYPESYERVPLWAHTWLSNFEVCR---TLA 243

Query: 312 KRAGFPTK-RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
           +R GF      ++DF  G+MFW K   L PL  L+L + +F EE    DG L HA+ER F
Sbjct: 244 QRLGFDINASEYIDFPAGSMFWAKVDALRPLYALNLELKDFPEEHGQIDGTLHHAMERMF 303

Query: 370 ACSVRYTEFSIESVDCVA 387
              VR+  + I  +    
Sbjct: 304 VAVVRHQHYRIGILPQDG 321


>gi|134297301|ref|YP_001121036.1| lipopolysaccharide biosynthesis protein-like protein [Burkholderia
            vietnamiensis G4]
 gi|134140458|gb|ABO56201.1| Lipopolysaccharide biosynthesis protein-like protein [Burkholderia
            vietnamiensis G4]
          Length = 1231

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 78/353 (22%), Positives = 143/353 (40%), Gaps = 19/353 (5%)

Query: 39   SGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSR 98
                + W    ++               ES+  WLR    F   +  +  S R+ F  + 
Sbjct: 890  PCVMMNWDNEARKPGKGHIFLGASP---ESYKSWLRRCFDFVLSN--NKQSERLVFINAW 944

Query: 99   KE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVH 156
             E  +  +L  +R    + +   ++  L  +       D            K++ A+V H
Sbjct: 945  NEWAEGTYLEPDRRYGYAYLHATAD--LLRQYYNSEDLDESIKINNQRFVKKNENALVAH 1002

Query: 157  CYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYFPSAQLYVMENKGRDVRP 215
             YY D   E+  ++ R N + D F+T+    +++   ++L    +  +  ++N+GRD+ P
Sbjct: 1003 LYYFDLLPELLSLIER-NVNLDAFITIPVHFSREQVGEILASLDNVYVLRVQNRGRDILP 1061

Query: 216  FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFE 275
            FL +  +     Y  L K+H KKS +      +G + R+    +LL    I   ++    
Sbjct: 1062 FLNIYPIIKSYSYANLVKVHSKKSPQ----RADGALLRKRALLELL-DPSIVPGVLRALN 1116

Query: 276  QNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKP 335
             +P +G+I           S +   +   +++     R G     L+ +F  G+MFW + 
Sbjct: 1117 TDPKIGLIAPSNSLCSLSNSDYLINNR--KQLNYCLSRLGLVDSSLNFEFIAGSMFWARV 1174

Query: 336  KCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVA 387
              L  L +L L   +FEEE    DG L HA+ER F    ++  +    VD + 
Sbjct: 1175 DALRMLSDLSLREEDFEEELGQLDGTLAHAIERLFCFLGKHVGYRTLPVDQIG 1227


>gi|13474020|ref|NP_105588.1| hypothetical protein mll4799 [Mesorhizobium loti MAFF303099]
 gi|14024772|dbj|BAB51374.1| mll4799 [Mesorhizobium loti MAFF303099]
          Length = 386

 Score =  256 bits (654), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 96/249 (38%), Positives = 134/249 (53%), Gaps = 4/249 (1%)

Query: 131 EGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDF 190
                +  +P++   T++ KIA+ +H +Y D W E   +L      F LF+T+   +   
Sbjct: 122 HFNGPQAEAPERLP-TVEPKIAVALHLHYPDLWPEFEALLEATGRQFQLFLTLTRPDAAL 180

Query: 191 EQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGI 250
            Q V   FP A++ V EN+GRDV PF+ LL  G FD +D +CK+HGKKS + G   + G 
Sbjct: 181 AQRVQARFPGAEITVYENRGRDVGPFIQLLREGKFDPFDLICKLHGKKSGQSGPRMVLGE 240

Query: 251 IWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFF-AKRSEVYRRVID 309
           IWR+   FDL+G   +  RII  FE++P   MIGSRR+R    W    +   E     ++
Sbjct: 241 IWRQVSAFDLIGSRGVVDRIIANFERSPDTQMIGSRRFRLPNEWKGEKSAWGENRAMALN 300

Query: 310 LAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERF 368
           L +  G P+    LDFF GTMFWV+   LEPLR L L +  F EE   +DG L+HA+ER 
Sbjct: 301 LLETMGMPSSS-RLDFFAGTMFWVRRGALEPLRRLDLPLAAFPEETGQQDGTLQHALERV 359

Query: 369 FACSVRYTE 377
                    
Sbjct: 360 LGMICTKIG 368


>gi|326772082|ref|ZP_08231367.1| rhamnan synthesis protein F [Actinomyces viscosus C505]
 gi|326638215|gb|EGE39116.1| rhamnan synthesis protein F [Actinomyces viscosus C505]
          Length = 652

 Score =  255 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 57/245 (23%), Positives = 101/245 (41%), Gaps = 10/245 (4%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP- 199
            +      K+A++ H YY D           +    D  +TV    K +  ++  K  P 
Sbjct: 327 VAREPKPQKVALIAHLYYMDLLEPTLAYARSMPEGTDFILTVGSQEKVELVEEACKDLPY 386

Query: 200 SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
           +  + ++EN+GRDV   L   +  V   YD +C IH KK  +   +   G  + R  F +
Sbjct: 387 NVTVRLIENRGRDVSALLVGCKDIV-SDYDLVCFIHDKKVTQLSPY-TVGEGFARKCFDN 444

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVYRRVIDLAKRAG 315
           LL   +    +I+TF+  P LG++          +      +    +  + +++      
Sbjct: 445 LLPTREFVENVISTFDSEPRLGLLSPTPPNHADYFPIYSYSWGPNFDRTKMLLEKELNLS 504

Query: 316 FPTKRL-HLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSV 373
            P      +    GTMFW +P  L+PL +      +F  E N  DG + HA+ER +    
Sbjct: 505 VPLDAHKEVIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEPNDIDGTILHAIERAYGYVA 564

Query: 374 RYTEF 378
           + + +
Sbjct: 565 QASGY 569


>gi|325067622|ref|ZP_08126295.1| hypothetical protein AoriK_07369 [Actinomyces oris K20]
          Length = 626

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 100/242 (41%), Gaps = 10/242 (4%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQ 202
                KIA++ H YY D        +  +    DL +TV    K +  ++  K  P +  
Sbjct: 304 EPKPQKIALIAHLYYMDLLEPTLAYVKSMPEGTDLILTVGSQEKAELVEEACKDLPYNVT 363

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           + ++EN+GRDV   L   +  + D YD +C  H KK  +   + + G  +    F +LL 
Sbjct: 364 VRLIENRGRDVSALLVGCKDIIHD-YDLVCFTHDKKVTQVKPYSV-GDGFAIKCFENLLA 421

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWS----FFAKRSEVYRRVIDLAKRAGFPT 318
             D    +I TF+  P LG++          +      +    E  + +++       P 
Sbjct: 422 TRDFVKNVIATFDAEPRLGLLAPTPPNHGDYFPVFSMGWGPNFERTKTLLEKELNLSVPI 481

Query: 319 KRLHLDF-FNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYT 376
                     GTMFW +P  L+PL +      +F  E N  DG + HA+ER +    + +
Sbjct: 482 DESRAPIAPLGTMFWFRPAALKPLFDHDWQWEDFPPEPNNIDGTILHAIERAYGYVAQAS 541

Query: 377 EF 378
            +
Sbjct: 542 GY 543


>gi|258591058|emb|CBE67353.1| protein of unknown function [NC10 bacterium 'Dutch sediment']
          Length = 1460

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 65/244 (26%), Positives = 108/244 (44%), Gaps = 12/244 (4%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYFPS 200
                I S+IA+  H YY D   E++  L  + F FDLFV+V  +  +D  +      P 
Sbjct: 584 PMPGDISSRIAVHAHAYYPDLTKELASYLKNMPFAFDLFVSVSNDEARDVCRQAFAGLPQ 643

Query: 201 AQ---LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLF 257
           A+   + V+ N+GRD+ P +     G    YDY+C +H KKS            W  +L 
Sbjct: 644 ARRVIVDVVANRGRDIAPMVCHFG-GRLATYDYICHLHTKKSMYAQGKM---DGWLEYLL 699

Query: 258 FDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF- 316
             L+G  D   RI + F+ +P  G+I  + Y     W      ++     +   ++ G  
Sbjct: 700 RQLMGSEDQVRRIFSMFQSDPRAGIIYPQNYEYLPYWGNTWLSNKALGAQM--CRQMGIT 757

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRY 375
                + D+  G+MFW + + +  L +  + + +F EE    DG+L H +ER      R+
Sbjct: 758 DVPEGYFDYPAGSMFWARSEAIRNLFSADIRLTDFPEEAGQTDGSLAHCIERLLVLVARH 817

Query: 376 TEFS 379
             + 
Sbjct: 818 AGYK 821


>gi|329944276|ref|ZP_08292535.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328531006|gb|EGF57862.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 636

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 64/241 (26%), Positives = 99/241 (41%), Gaps = 9/241 (3%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQ 202
              K KIA++ H YY D        +  +    D+F++     K +  +   K  P + +
Sbjct: 304 EPKKQKIALIAHLYYMDLVEPTLKYIRNMPEGIDIFLSTSSPEKVEQVEAACKGLPYNIE 363

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           + ++EN+GRDV PFL   +  V D YD +C  H KK  +  Y    G  +    F +LL 
Sbjct: 364 VRLVENRGRDVGPFLVAWKDVVHD-YDVVCYTHDKKVTQL-YPYSVGDGFAYKCFENLLP 421

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA-KRSEVYRRVIDLAKRAGFPTKRL 321
             D    +I TF+  P LG +          +  F       + R   L +  G      
Sbjct: 422 TRDFVKNVIATFDAEPRLGFLAPTPPNHADYFPVFTYGWGPNFDRTKALLRELGLDVPLD 481

Query: 322 HLD---FFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTE 377
                    G+MFW +P+ L+PL +      EF  E    DG L HA+ER      + + 
Sbjct: 482 PTKEPIAPLGSMFWFRPQALKPLFDHDWQWEEFPPEPCPIDGTLMHAIERSHGYVAQGSG 541

Query: 378 F 378
           +
Sbjct: 542 Y 542


>gi|225352528|ref|ZP_03743551.1| hypothetical protein BIFPSEUDO_04151 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225156722|gb|EEG70116.1| hypothetical protein BIFPSEUDO_04151 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 648

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 58/249 (23%), Positives = 104/249 (41%), Gaps = 10/249 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFP-S 200
           + +    +IA+++H YY D   +       +    D   TV  E N    ++  K  P +
Sbjct: 303 APIPTNKRIALIMHLYYMDLLDKTLEYAKSMPEGCDFIFTVGSEENATIVRERCKDLPYN 362

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
             + V++N+GRDV   L         +YDY+C  H KK  +   + I G  +    F ++
Sbjct: 363 VDVRVIQNRGRDVSALLVGAGKDCL-QYDYVCFAHDKKVTQLSPYSI-GDGFSYKCFENV 420

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVYRRVIDLAKRAGF 316
           LG   +   IIN FE +P  G++          +      +    E  +++++   +   
Sbjct: 421 LGSKALVSNIINHFENDPHAGVLAPAPPNHADYFGNFASLWGPNYEGTKKMLEETLQVKV 480

Query: 317 PTKRLHLDF-FNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVR 374
           P  +        GTMFW +PK L+   ++     +F  E N  DG++ H VER +    +
Sbjct: 481 PLDKSKEPIAPMGTMFWFRPKALQQFFDIDWKYEDFPPEPNKIDGSMLHFVERAYGYVPQ 540

Query: 375 YTEFSIESV 383
              +    +
Sbjct: 541 ANGYYTGYI 549


>gi|310829395|ref|YP_003961752.1| hypothetical protein ELI_3842 [Eubacterium limosum KIST612]
 gi|308741129|gb|ADO38789.1| hypothetical protein ELI_3842 [Eubacterium limosum KIST612]
          Length = 627

 Score =  252 bits (643), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 67/249 (26%), Positives = 107/249 (42%), Gaps = 10/249 (4%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLK 196
            S     +  + +IA + H Y++D   E    L  +  + D+++T   E  K   Q+  K
Sbjct: 300 FSYDSKKILCEKRIAAIFHLYFEDLIDETYRYLSSMPEEADIYITTDTEPKKKLIQEKFK 359

Query: 197 YFP--SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRR 254
            F   + ++ +++N+GRDV   L   +  +   YDY+C  H KK  +   + I G  +  
Sbjct: 360 DFSCRNFKVILIQNRGRDVSALLVATKAFIM-NYDYVCFAHDKKVTQTKPYSI-GGAFAY 417

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK-RSEVYRRVIDLAKR 313
             F + L   +  + IIN FE+NP LGM+          +          Y    +L   
Sbjct: 418 KCFENTLQNKNFVLNIINAFEKNPRLGMLMPAPPNNGPYYPTLGNEWMCNYEVTKNLIDE 477

Query: 314 AGFPTKRLHLD---FFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
            G               GTMFW +PK L+ L + +    +F EE N  DG L HA+ER +
Sbjct: 478 LGIKVPMDPGKEPISPLGTMFWFRPKALKVLFDKNWEYSDFPEEPNKVDGTLLHAIERAY 537

Query: 370 ACSVRYTEF 378
              V+   F
Sbjct: 538 GLIVQSEGF 546


>gi|3399709|dbj|BAA32094.1| rgpFc [Streptococcus mutans]
          Length = 583

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 105/247 (42%), Gaps = 18/247 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 283 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANGQEAQVFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLKNY--LSAYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G   K    
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGMTKKIDFN 455

Query: 324 DF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYT 376
            F       GT  W K   L+PL +L+L  +   E  L   ++ HA+ER         + 
Sbjct: 456 AFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLLIYIAWNEHY 515

Query: 377 EFSIESV 383
           +F I   
Sbjct: 516 DFRISKN 522


>gi|227546966|ref|ZP_03977015.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|227212567|gb|EEI80455.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
          Length = 631

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 62/248 (25%), Positives = 101/248 (40%), Gaps = 10/248 (4%)

Query: 144 GLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFP-SA 201
            L    KIA+ +H YY D      H +  +    D+ +TV  EAN +  ++  K FP + 
Sbjct: 304 PLPEGKKIALAIHVYYMDLLESTFHYIQSMPEGCDIIITVGSEANAETVREYCKQFPYNF 363

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            + V+EN+GRDV   L      +F +YDY+C  H KK  +     I G  +    F ++L
Sbjct: 364 DVRVIENRGRDVSALLVGCGEDLF-QYDYVCFAHDKKVTQLSPQSI-GDGFAYKCFENIL 421

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVYRRVIDLAKRAGFP 317
              +    +I+ FE+NP LG+           +      +       +  ++       P
Sbjct: 422 ASKEYVSNVIDLFERNPRLGIAMPTPPNHASYFPGYTFPWGPNFPGTKDFLEQTLNMHVP 481

Query: 318 TKRLHLDF-FNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRY 375
                      GTMFW +P+    L +      +F  E N  DG L H +ER +    + 
Sbjct: 482 LNADKEPVAPMGTMFWFRPEAFRGLLDHGWEYTDFPPEPNKVDGTLLHFIERAYGYVPQA 541

Query: 376 TEFSIESV 383
             +    +
Sbjct: 542 NGYYPAYI 549


>gi|331086190|ref|ZP_08335272.1| hypothetical protein HMPREF0987_01575 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406349|gb|EGG85863.1| hypothetical protein HMPREF0987_01575 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 592

 Score =  251 bits (641), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 67/244 (27%), Positives = 110/244 (45%), Gaps = 10/244 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFPS- 200
              T ++KIA+V+H Y++D   E  H +  +    D+++T   E  K   + V    P  
Sbjct: 250 QKQTTENKIALVMHLYFEDLLEESYHYVSAMPEKADIYLTTDTEKKKAAIEKVFAKLPCN 309

Query: 201 -AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
             ++ V++N+GRDV   L  ++  + D YD +C  H KK+ +     I G  +    F +
Sbjct: 310 KLEVRVIKNRGRDVSSLLVGVKDVIMD-YDLVCFAHDKKTAQVKPGTI-GASFAYKCFEN 367

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA-KRSEVYRRVIDLAKRAGFPT 318
            L        +INTF  NP +G++          ++    +    +    DLAK+ G   
Sbjct: 368 TLSNKAYVGNVINTFVNNPRMGLLCPPEPNHSTFFTTIGFEWGPNFNITRDLAKKLGLTV 427

Query: 319 KRLHLDFFN---GTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVR 374
                       GTMFW +PK ++PL N      +F  E N  DG L HA+ER +   V+
Sbjct: 428 PISVASPPVAPLGTMFWFRPKAMKPLYNKDWKYEDFPAEPNKIDGTLLHAIERIYPFIVQ 487

Query: 375 YTEF 378
            + +
Sbjct: 488 ESGY 491


>gi|285019449|ref|YP_003377160.1| hypothetical protein XALc_2689 [Xanthomonas albilineans GPE PC73]
 gi|283474667|emb|CBA17166.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 686

 Score =  250 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 85/367 (23%), Positives = 139/367 (37%), Gaps = 43/367 (11%)

Query: 35  PAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKL--SFPSCRI 92
           P    G    W    ++    +         +E        +L  + +++L       R+
Sbjct: 346 PGVNPG----WDNEARRPGNGRVYLHASPRGYE-------DWLRATIHTRLQGRRAEQRL 394

Query: 93  FFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSK 150
            F  +  E  + A L  +  + ++ +                      SP +        
Sbjct: 395 VFVNAWNEWAEGAVLEPDTRLGHAYLDATRRAL---------------SPARVREATAPH 439

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKY--FPSAQLYVMEN 208
            AIV H +Y +   E+ + L      + L VT         Q  L+   FP  ++ V+EN
Sbjct: 440 HAIV-HAWYPNVLPELLNPLAASALPWRLLVTTSPDQASAVQAQLRDCSFPY-EVMVLEN 497

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAI 268
           +GRD+ PFL+  E  + D  D + K+H K+S     H   G  WR  L   L G +D A 
Sbjct: 498 RGRDILPFLHAGERLLQDGVDVVLKLHTKRST----HLHNGDAWRSELLQRLAG-ADRAA 552

Query: 269 RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNG 328
           RI+  F Q+P LG++    +       F+         ++             H  F +G
Sbjct: 553 RILEAFAQDPMLGLVAPEGH-LLPLADFWGGNRMAADYLLRRTGYTDVCLDEAH--FISG 609

Query: 329 TMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVA 387
           +MFWV+   L PL + HL   EFE E+   DG L HA ER  A   ++  + + +   + 
Sbjct: 610 SMFWVRLHALRPLLDSHLCPSEFEPEQGQIDGTLAHAAERVTALLAQHRGYRVATAAELI 669

Query: 388 EYERLLH 394
                 H
Sbjct: 670 GAPSPPH 676


>gi|119026520|ref|YP_910365.1| hypothetical protein BAD_1502 [Bifidobacterium adolescentis ATCC
           15703]
 gi|118766104|dbj|BAF40283.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703]
          Length = 647

 Score =  250 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 103/256 (40%), Gaps = 10/256 (3%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKYFP-S 200
           + +    +IA+++H YY D   +       +    D   TV  E N    ++  K  P +
Sbjct: 302 TPIPEGKRIALIMHLYYMDLLDKTLEYAKSMPEGCDFIFTVGSEENAKLVRERCKGLPYN 361

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
             + V++N+GRDV   L         +YDY+C  H KK  +   + I G  +    F ++
Sbjct: 362 VDVRVIQNRGRDVSALLIGAGKDCL-KYDYVCFAHDKKVTQLSPYSI-GDGFAYKCFENI 419

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVYRRVIDLAKRAGF 316
           LG   +   IIN FEQ+P  G++          +      +    E  +++++       
Sbjct: 420 LGSKALVSNIINHFEQDPHAGLLAPTSPNHADYFGNFASLWGPNFEGTKKMLEETLGVKV 479

Query: 317 PTKRLHLDF-FNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVR 374
           P           GTMFW +PK L  L ++     +F  E N  DG++ H +ER +    +
Sbjct: 480 PLNPYKEPIAPLGTMFWFRPKALHQLFDIDWKYEDFPPEPNKIDGSMLHFIERAYGYLPQ 539

Query: 375 YTEFSIESVDCVAEYE 390
              +    V       
Sbjct: 540 ANGYYTGFVYSDHFAR 555


>gi|290580710|ref|YP_003485102.1| rhamnan synthesis protein F [Streptococcus mutans NN2025]
 gi|254997609|dbj|BAH88210.1| RgpFc protein [Streptococcus mutans NN2025]
          Length = 557

 Score =  250 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 105/247 (42%), Gaps = 18/247 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 257 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANSQEAQVFV 316

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 317 TGNIGRDVLPMLKLKNY--LSAYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 372

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G   K    
Sbjct: 373 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGMTKKIDFN 429

Query: 324 DF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYT 376
            F       GT  W K   L+PL +L+L  +   E  L   ++ HA+ER         + 
Sbjct: 430 AFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLLIYIAWNEHY 489

Query: 377 EFSIESV 383
           +F I   
Sbjct: 490 DFRISKN 496


>gi|30024644|dbj|BAC75698.1| rhamnosyltransferase [Streptococcus mutans]
          Length = 583

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 105/247 (42%), Gaps = 18/247 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 283 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANSQEAQVFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLKNY--LSTYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G   K    
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGMTKKIDFN 455

Query: 324 DF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYT 376
            F       GT  W K   L+PL +L+L  +   E  L   ++ HA+ER         + 
Sbjct: 456 AFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLLIYIAWNEHY 515

Query: 377 EFSIESV 383
           +F I   
Sbjct: 516 DFRISKN 522


>gi|30024633|dbj|BAC75688.1| rhamnosyltransferase [Streptococcus mutans]
          Length = 583

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 105/247 (42%), Gaps = 18/247 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K+A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 283 NQKVAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEVLSANSQEAQIFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLKNY--LSTYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G   K    
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGMTKKIDFN 455

Query: 324 DF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYT 376
            F       GT  W K   L+PL +L+L  +   E  L   ++ HA+ER         + 
Sbjct: 456 AFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLLIYIAWNEHY 515

Query: 377 EFSIESV 383
           +F I   
Sbjct: 516 DFRISKN 522


>gi|311063512|ref|YP_003970237.1| lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           PRL2010]
 gi|310865831|gb|ADP35200.1| lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           PRL2010]
          Length = 631

 Score =  249 bits (637), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 61/254 (24%), Positives = 100/254 (39%), Gaps = 10/254 (3%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLK 196
           S      L    KIA+ +H YY D        +  +    D+ +TV  EAN +  ++  K
Sbjct: 298 SQSLSVPLPEGKKIALAIHVYYMDLLESTFRYIQSMPEGCDIIITVGSEANAEIVREYCK 357

Query: 197 YFP-SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRW 255
            FP    + V+EN+GRDV   L      +F +YDY+C  H KK  +     I G  +   
Sbjct: 358 QFPYRFDVRVIENRGRDVSSLLVGCGEDLF-QYDYVCFAHDKKVTQLSPQSI-GDGFAYK 415

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVYRRVIDLA 311
            + ++L   +    +I+ FE+NP LG+           +      +       +  ++  
Sbjct: 416 CYENILASKEYVSNVIDLFEKNPRLGIAMPTPPNHASYFPGYTFPWGPNFPGTKDFLEQT 475

Query: 312 KRAGFPTKRLHLDF-FNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
                P           GTMFW +P+    L +      +F  E N  DG L H +ER +
Sbjct: 476 LNMHVPLNANKEPVAPMGTMFWFRPEAFRGLLDHGWKYEDFPPEPNKVDGTLLHFIERAY 535

Query: 370 ACSVRYTEFSIESV 383
               +   +    +
Sbjct: 536 GYVPQANGYYPAYI 549


>gi|310816773|ref|YP_003964737.1| lipopolysaccharide biosynthesis protein-like protein
           [Ketogulonicigenium vulgare Y25]
 gi|308755508|gb|ADO43437.1| lipopolysaccharide biosynthesis protein-like protein
           [Ketogulonicigenium vulgare Y25]
          Length = 726

 Score =  249 bits (637), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 66/253 (26%), Positives = 107/253 (42%), Gaps = 14/253 (5%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF 198
            P++        I + +H YYQ+     +  L ++     L+V+   A K  +  + +  
Sbjct: 455 QPRREAPAPARPIGVFLHLYYQELAPVFAKRLAQIPLPLSLYVSTDTAEKAAQ--IERAL 512

Query: 199 PSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFF 258
           P AQ+ V+ N+GRD+ P LY      +  +D +  +HGKKS            W   +  
Sbjct: 513 PQAQVRVLPNRGRDIFPKLYGFG-DAYADHDIVLHLHGKKSLHSSML----DEWLSHILD 567

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT 318
            LLG      RI++ F+  P LG++    +R     + +    ++     +LA R G  T
Sbjct: 568 CLLGDPADVNRILSLFDSVPRLGIVMPVVHRSVLNAAHWGFNRDIG---AELAYRMGMAT 624

Query: 319 K---RLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVR 374
                  L F  G+MFW +   L+P+ +L L    F  E    DG L HAVER      R
Sbjct: 625 PLPENDALQFPAGSMFWARTAALQPILDLALEASHFPPEAGQVDGTLAHAVERMLGVVCR 684

Query: 375 YTEFSIESVDCVA 387
              + +  V   +
Sbjct: 685 AGGYYMLPVAGSS 697


>gi|312962408|ref|ZP_07776899.1| lipopolysaccharide biosynthesis protein-like protein [Pseudomonas
            fluorescens WH6]
 gi|311283335|gb|EFQ61925.1| lipopolysaccharide biosynthesis protein-like protein [Pseudomonas
            fluorescens WH6]
          Length = 1308

 Score =  249 bits (637), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 82/345 (23%), Positives = 148/345 (42%), Gaps = 24/345 (6%)

Query: 42   YVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE- 100
             + W  + +++  S   H   L  ++    WL S       +       ++ F  +  E 
Sbjct: 985  MLSWDNTARKQYNSHTFHGFSLLRYKQ---WLSSITNNVFNNAKYSKDEKLVFVNAWNEW 1041

Query: 101  -QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYY 159
             +   L  +R      +    +         E    + S         ++  A+V+H +Y
Sbjct: 1042 AEGTHLEPDRKYGYGYLQATDDVLA------EYDISKVSRMAFKRSVRQADYAVVLHLHY 1095

Query: 160  QDTWIEISHILLRLN-FDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLY 218
             D W +I   L      ++DL+VTV  ++      V + +P A + ++EN+GRDV PFL 
Sbjct: 1096 DDLWDDIKSYLDSFGQLEYDLYVTVTSSSAGV--RVAQEYPKAHIQLVENRGRDVLPFLK 1153

Query: 219  LLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNP 278
            +L++     Y  +CKIH K+S        +G   R  L   LLG  +  + +++ FE+  
Sbjct: 1154 ILQVIKDMGYVAVCKIHSKRSLY----RDDGDKIRGELIGSLLGSKETILSVVDRFERQK 1209

Query: 279  CLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCL 338
             +G+I   +Y              +   V +L+ + GF     + +F  G+MFW +PK L
Sbjct: 1210 DIGVIVPVKYLIPHTDHNMTYCGAI---VTELSSKLGFNFS--YCEFIAGSMFWFRPKAL 1264

Query: 339  EPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESV 383
            E L ++     FE E  L DG + H +ER     V+   +++E++
Sbjct: 1265 EALLSID-ESSFEVEDGLADGTIAHGIERVLCNVVKKANYTVETI 1308


>gi|24379285|ref|NP_721240.1| RgpFc protein [Streptococcus mutans UA159]
 gi|24377204|gb|AAN58546.1|AE014924_6 RgpFc protein [Streptococcus mutans UA159]
          Length = 583

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 64/247 (25%), Positives = 104/247 (42%), Gaps = 18/247 (7%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             K A+ +H +Y D   E      + +F +DLF+T    +K  + E+ +      AQ++V
Sbjct: 283 NQKAAVHLHVFYVDLLEEFLTAFKQFHFSYDLFITTDSDDKKAEIEEILSANSQEAQVFV 342

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L        YD++   H KKS+   +    G  WR  L   L+  +D
Sbjct: 343 TGNIGRDVLPMLKLKNY--LSTYDFVGHFHTKKSKEADFWA--GQSWREELIDMLVKPAD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
               I+   +QNP +G++ +    + RY +         +   +  L ++ G   K    
Sbjct: 399 ---NILAQLQQNPKIGLVIADMPTFFRYNKIVDAWNEHLIAPEMNTLWQKMGMTKKIDFN 455

Query: 324 DF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYT 376
            F       GT  W K   L+PL +L+L  +   E  L   ++ HA+ER         + 
Sbjct: 456 AFHTFVMSYGTFVWFKYDALKPLFDLNLTDDDVPEEPLPQNSILHAIERLLIYIAWNEHY 515

Query: 377 EFSIESV 383
           +F I   
Sbjct: 516 DFRISKN 522


>gi|308235695|ref|ZP_07666432.1| hypothetical protein GvagA14_05663 [Gardnerella vaginalis ATCC
           14018]
 gi|311114292|ref|YP_003985513.1| rhamnan synthesis protein F [Gardnerella vaginalis ATCC 14019]
 gi|310945786|gb|ADP38490.1| rhamnan synthesis protein F [Gardnerella vaginalis ATCC 14019]
          Length = 637

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 64/278 (23%), Positives = 108/278 (38%), Gaps = 15/278 (5%)

Query: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLF 180
              L    + E      SS   S  T K K+A+ +H YY D   +  H +  +    D+ 
Sbjct: 291 RYILPQNHVVEN-----SSTATSESTAKPKVALCMHLYYMDLLDKSLHYIQSMPQGCDVI 345

Query: 181 VTV-VEANKDFEQDVLKYFP-SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK 238
           +TV  + N+   +  +++ P    + ++EN+GRDV  FL      +  +YDY+C  H KK
Sbjct: 346 LTVGSKENQQIVKQRVEHLPYDVDVRLIENRGRDVSAFLVGGGADLM-KYDYVCFAHDKK 404

Query: 239 SQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-- 296
             +     I G  +    F ++L   +    +IN FE +P LGM           +    
Sbjct: 405 VTQLSPRSI-GDGFAYKCFENILASKEYVQNVINLFETHPRLGMAMPTPPNHADYFPGFT 463

Query: 297 --FAKRSEVYRRVIDLAKRAGFPTK-RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEE 352
             +    E  ++ ++       P           GTMFW + K +  L +      +F  
Sbjct: 464 YTWGPNFEGTKKFLEKTLGISVPLDENKDAIAPLGTMFWFRTKAMRGLLDRKWTYEDFPA 523

Query: 353 ERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYE 390
           E    DG L H +ER +    +Y  +    +       
Sbjct: 524 EPLKIDGTLLHFIERAYGYVPQYNGYYDAYIFSDHFAR 561


>gi|312133751|ref|YP_004001090.1| protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773029|gb|ADQ02517.1| Hypothetical protein BBMN68_1492 [Bifidobacterium longum subsp.
           longum BBMN68]
          Length = 641

 Score =  247 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 68/253 (26%), Positives = 101/253 (39%), Gaps = 9/253 (3%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD-FEQDVLK 196
           S      +  K ++A+V+H YY D   +I      +    D+ +TV    K    ++  +
Sbjct: 298 SQDNAQPIPQKFRVALVLHLYYMDILDQILRYARSMPEGCDVIITVGSEEKACIVKERCE 357

Query: 197 YFP-SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRW 255
             P +  + V+EN+GRDV   L      V   YD +C  H KK ++     I G  + + 
Sbjct: 358 GMPYNIDVRVIENRGRDVSALLVGAGKDVL-NYDLVCFAHDKKVRQLRPETI-GDGFAKK 415

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKR-WSFFAKRSEVYRRVIDLAKRA 314
            F + L        IIN F  NP LG+            +S+       YR   DL    
Sbjct: 416 CFENTLASKAYVANIINLFADNPRLGVAMPSAPNHADYFYSYAFSWGPNYRGTKDLLDGL 475

Query: 315 GFPTK-RLHLDFFN--GTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFA 370
           G       H D     GTMFW +PK L  L +      +F  E N  DG+  H VER + 
Sbjct: 476 GIKVPLSPHADVIAPLGTMFWFRPKALHGLIDKSWEYSDFPPEPNPADGSFLHFVERAYC 535

Query: 371 CSVRYTEFSIESV 383
              +   +  E +
Sbjct: 536 YVAQSNGYYSEYI 548


>gi|317047360|ref|YP_004115008.1| family 2 glycosyl transferase [Pantoea sp. At-9b]
 gi|316948977|gb|ADU68452.1| glycosyl transferase family 2 [Pantoea sp. At-9b]
          Length = 1419

 Score =  246 bits (628), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 69/288 (23%), Positives = 112/288 (38%), Gaps = 31/288 (10%)

Query: 115 RMPFDSEKFLYVKELFE-----------GWNDRP---SSPKKSGLTIKSKIAIVVHCYYQ 160
               +  +      + E           G   RP    +P +        I + +H YY 
Sbjct: 549 YGHAEGRQPSATPRMLEAPFFRYGPSEYGAKGRPLLIDAPVQLNEGFARTIGVHLHLYYV 608

Query: 161 DTWIEISHILLRLNFDFDLFVTVVEANKDFEQ------DVLKYFPSAQLYVMENKGRDVR 214
           D   E    L  +   FDLF+++     + E+        +K      +   ENKGRD+ 
Sbjct: 609 DLADEFIKHLNTIPTGFDLFISLPRGKHNVEECERKFRSGIKTLKKLVVRETENKGRDIY 668

Query: 215 PFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTF 274
           PF+      +   Y+ +  IH KKS +          WRR+L    LG   I  +I+N+F
Sbjct: 669 PFIVEFGAELLS-YELILHIHSKKSPQA-----LSKGWRRFLLHYTLGTESITTQILNSF 722

Query: 275 EQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL-DFFNGTMFWV 333
           + +P LG++    +    R   +    E+ ++ +    R GF     +  D+  G+ FW 
Sbjct: 723 DNDPKLGVLFPAYFYGVTRQPNWGGNREIVKQQLA---RLGFSYDMTYCPDYPAGSFFWS 779

Query: 334 KPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
           +   L PL N    + +F+EE    DG L H  ER F        +S 
Sbjct: 780 RSDALRPLLNGEYRLEDFDEEAGQYDGTLAHGFERLFGTIPLLQNYST 827


>gi|190572709|ref|YP_001970554.1| putative glycosyltransferase protein [Stenotrophomonas maltophilia
           K279a]
 gi|190010631|emb|CAQ44240.1| putative glycosyltransferase protein [Stenotrophomonas maltophilia
           K279a]
          Length = 707

 Score =  245 bits (627), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 76/361 (21%), Positives = 136/361 (37%), Gaps = 44/361 (12%)

Query: 35  PAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSF--PSCRI 92
           P    G    W    ++    + +       +         +L  + + +L    P+ R+
Sbjct: 370 PGVNPG----WDNEARRPGRGRVLLHASPRGY-------SDWLHDTVHQRLRHVAPARRL 418

Query: 93  FFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSK 150
            F  +  E  + A L  +  + ++ +                    PS    S      +
Sbjct: 419 VFINAWNEWAESAVLEPDARLGHAWLQATRRALF------------PSQAAPS------R 460

Query: 151 IAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL-KYFPSAQLYVMENK 209
             IV+H +Y D   E+   +        L +T     +   Q ++     +A+++V +N 
Sbjct: 461 PCIVIHAWYLDALPELLQAVKDSGLQARLVITTTGERQAQVQSIIDAEGLTAEIWVYDNH 520

Query: 210 GRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIR 269
           GRDV PFL+  +  +      + K+H K+S     H   G  WRR +   LLG +  A  
Sbjct: 521 GRDVLPFLHAADRLLQQNESLVLKLHTKRST----HRDNGDQWRREMVDALLGTAQAAAN 576

Query: 270 IINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGT 329
           + +    NP +G++    +   K   +    ++   R+  L    G  +      F +G+
Sbjct: 577 LAHL-LANPSIGLMAPAGH-LLKVADYIGGNAQRMERLWAL---LGLDSAPGDGQFASGS 631

Query: 330 MFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAE 388
           MFWV+   L PL + HL+   F+ E    DG L HA+ER     V    F++     V  
Sbjct: 632 MFWVRLPALRPLLDAHLLPSMFDTEAGQIDGTLAHAIERATGAVVSAAGFTVADTSEVEG 691

Query: 389 Y 389
            
Sbjct: 692 A 692


>gi|260890973|ref|ZP_05902236.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
 gi|260859000|gb|EEX73500.1| conserved hypothetical protein [Leptotrichia hofstadii F0254]
          Length = 319

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 107/240 (44%), Gaps = 10/240 (4%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKY---FPSAQL 203
           +K K+ ++ H Y++D   E  H +  +    DL +T        + +       F + ++
Sbjct: 4   LKYKVLLIFHIYFEDLLDESIHYMKSMPETSDLLITTPRKELKEKIEEKVRGLNFRNIEV 63

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
            V+EN+GRDV   L   +  V   YDY+C +H KK+ +   +   G  +R   + + L  
Sbjct: 64  RVIENRGRDVSSLLVGAKDAVM-NYDYVCFMHDKKTAQLKPYS-SGQGFRYKCYENNLAT 121

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK-RSEVYRRVIDLAKRAGFPTK--- 319
                 +I TF++NP LGM+          +       S  +++   L K+ G       
Sbjct: 122 KKYVKNLIGTFKENPRLGMLMPPPPNHGNFFHIIGNEWSSNFKKTEKLIKKLGLNVDFHW 181

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
            L      GTMFW +P+ L+ L +      +F EE N  DG + HAVER +  +V+   +
Sbjct: 182 NLEPISPLGTMFWFRPRALKKLFDYGWEYSDFPEEPNEHDGTILHAVERVYGFAVQDAGY 241


>gi|260890969|ref|ZP_05902232.1| O-antigen export system ATP-binding protein RfbB [Leptotrichia
           hofstadii F0254]
 gi|260859295|gb|EEX73795.1| O-antigen export system ATP-binding protein RfbB [Leptotrichia
           hofstadii F0254]
          Length = 709

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 64/268 (23%), Positives = 112/268 (41%), Gaps = 11/268 (4%)

Query: 120 SEKFLYVKELFEGWNDRPSSPK-KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFD 178
           +     +K L       P+  + K+    + K+ ++ H Y++D   E  H +  +    D
Sbjct: 121 TSNMAAIKRLMHLNYILPTEYELKNYDLSEDKVLLIFHIYFEDLLDESIHYMKSMPETSD 180

Query: 179 LFVTVVEANKDFEQDVLKY---FPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIH 235
           L +T        + +       F + ++ V+EN+GRDV   L   +  V   YDY+C +H
Sbjct: 181 LLITTPRKELKEKIEEKVRGLNFRNIEVRVIENRGRDVSSLLVGAKDAVM-NYDYVCFMH 239

Query: 236 GKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWS 295
            KK+ +   +     ++  +     L        +I TF++NP LGM+          + 
Sbjct: 240 DKKTAQLKPYSSLNDVYINYC-KGTLATKKYVKNLIGTFKENPRLGMLMPPPPNHGNFFH 298

Query: 296 FFAK-RSEVYRRVIDLAKRAGFPTK---RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEF 350
                 S  +++   L K+ G        L      GTMFW +P+ L+ L +      +F
Sbjct: 299 IIGNEWSSNFKKTEKLIKKLGLNVDFHWNLEPISPLGTMFWFRPRALKKLFDYGWEYSDF 358

Query: 351 EEERNLKDGALEHAVERFFACSVRYTEF 378
            EE N  DG + HAVER +   V+   +
Sbjct: 359 PEEPNEHDGTILHAVERVYGFVVQDAGY 386


>gi|190572676|ref|YP_001970521.1| putative glycosyltransferase, fusion protein [Stenotrophomonas
           maltophilia K279a]
 gi|190010598|emb|CAQ44207.1| putative glycosyltransferase, fusion protein [Stenotrophomonas
           maltophilia K279a]
          Length = 566

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 81/241 (33%), Positives = 111/241 (46%), Gaps = 11/241 (4%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQL 203
            +KS+ AIV+H Y+ D    I   +  +  D DLFV+V      +   +   +    A +
Sbjct: 312 KLKSRFAIVLHLYHLDLIESIQGYMKNMIVDHDLFVSVKSVADRRVAVRFFEERKVRAFV 371

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
           +V  N GRDV PF+ LL  G+ DRYD +CKIH KKS         G  WR  L   LLG 
Sbjct: 372 FVHPNIGRDVGPFVSLLNTGLLDRYDAVCKIHSKKSVYHDG----GGQWRDELMKSLLGS 427

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
           S   ++I+  F  +   G++G   +       F+    E  RR   LA   G    R+ L
Sbjct: 428 SHTVLKILRAFRHDSSCGIVGPE-HAYVSNARFWGGNEERLRR---LAAETGIDDARIRL 483

Query: 324 DFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSIES 382
            FF GTMFW +P  L  LR   L + EF+ E    D  L H +ER F   V    +   +
Sbjct: 484 GFFAGTMFWFRPAALYALRERALALSEFDPEAGQLDATLAHVIERLFVLWVEQAGYFAAT 543

Query: 383 V 383
            
Sbjct: 544 T 544


>gi|323138318|ref|ZP_08073389.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
 gi|322396401|gb|EFX98931.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
          Length = 754

 Score =  242 bits (618), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 64/239 (26%), Positives = 110/239 (46%), Gaps = 13/239 (5%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFPS--A 201
           + +   +A +VH +Y D    I   L  +    DL+++   A K +    V++ +     
Sbjct: 365 INMDKPVAAIVHAFYPDLLEHILGYLENIPCAVDLYISTDSAEKAEIIGKVVRNWSKGST 424

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            + +MEN+GRD+ P +      VF ++D    +H K+S   G        WR +L   L 
Sbjct: 425 DVRIMENRGRDIAPMIVGFR-DVFAKHDIFLHVHTKRSPHAGDLL---YHWRDYLLNTLF 480

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT-KR 320
           G  DIA  +++ F  +P +G++  + +   +R   +    ++ R   +L  R G    K 
Sbjct: 481 GTGDIARSVLSLF-NDPKIGVVFPQHFFEVRRMLNWGFDYDLAR---NLLARVGVQLNKD 536

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
           L L+F +G+MFW +   + PL +L L   +F EE    DG L HA+ER          +
Sbjct: 537 LVLEFPSGSMFWGRTDAIRPLLDLDLQFSDFPEEAGQIDGTLAHAIERTLLMVAESKGY 595


>gi|90425670|ref|YP_534040.1| glycosyl transferase, group 1 [Rhodopseudomonas palustris BisB18]
 gi|90107684|gb|ABD89721.1| glycosyl transferase, group 1 [Rhodopseudomonas palustris BisB18]
          Length = 846

 Score =  242 bits (617), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 66/254 (25%), Positives = 114/254 (44%), Gaps = 17/254 (6%)

Query: 136 RPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDV 194
           RP  P++     + +IAI  H YY D       ++       DLF+T     +  + +  
Sbjct: 583 RP-EPRRESNAARPRIAIHGHFYYPDLLESFLKLIAANASSVDLFLTTSGPEQAAQIRKS 641

Query: 195 LKYF--PSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIW 252
           L+ F   +A ++ + N+GRD+ PFL  +       YD +   HGK+S+        G  W
Sbjct: 642 LRAFGIQNADVWSVPNRGRDIGPFLKEMP-DKLGSYDIVGHFHGKRSKHVD--STVGDQW 698

Query: 253 RRWLFFDLLGFSDIAIRIIN-TFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLA 311
           R + +  L+G +   I +I   F ++  LG++ +         + + +  ++  R   LA
Sbjct: 699 RDFAWQHLIGDAFPMIDVIADAFAEDAKLGLVFAEDPYL----NGWDENRDLAER---LA 751

Query: 312 KRAGFPTK-RLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFF 369
           +R         H DF  GTMFW +   L+PL  L+L   ++  E    DG + HA+ER  
Sbjct: 752 QRMKIEAPLPEHFDFPIGTMFWARVAALQPLFQLNLDWNDYPHEPLPIDGTILHALERIV 811

Query: 370 ACSVRYTEFSIESV 383
             +V+ + F   + 
Sbjct: 812 PFAVQKSGFEYATT 825


>gi|13476280|ref|NP_107850.1| hypothetical protein mlr7559 [Mesorhizobium loti MAFF303099]
 gi|14027041|dbj|BAB53995.1| mlr7559 [Mesorhizobium loti MAFF303099]
          Length = 644

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 68/251 (27%), Positives = 112/251 (44%), Gaps = 14/251 (5%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLKYFPSAQ---LYV 205
           KIA+  H YY D   EI  +   +   +D   T     K  E +  L   P  +   + V
Sbjct: 298 KIAVCAHIYYTDMLDEILGLTGNIPVPYDFIATTNTPEKKAEIETALANRPGVKNVIVRV 357

Query: 206 ME-NKGRDVRP-FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
           +E N+GRD+   F+ L +L V DRYD +C++H KKS +       G +++R +  +LL  
Sbjct: 358 VEQNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQ--VQSSMGNLFKRHMVDNLLNS 415

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRY---RRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
                 +++ F  NP +G+     +        +S+FA + +V      L     F    
Sbjct: 416 RGYVHNVLDMFHDNPSVGLAIPPIFHISYPTMGFSWFANKPKVEETARLLNINVKFDENT 475

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFS 379
               +  GTMFW +P+ L  +       E F  E +  DG   HA+ER  A +V+   ++
Sbjct: 476 PVAAY--GTMFWFRPRALRKMFEHKWKWEEFNAEPDHVDGGFAHALERLIAYAVQNAGYT 533

Query: 380 IESVDCVAEYE 390
            + + C  + E
Sbjct: 534 TQHIMCAHQAE 544


>gi|218455303|gb|AAX19606.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  240 bits (612), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 117/244 (47%), Gaps = 11/244 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV--VEANKDFEQDVLKYFPS 200
              ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V  +   +   +   ++   
Sbjct: 311 DAESLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIR 370

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS         G  WR  L   L
Sbjct: 371 ASVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSVYRDG----GGQWRDDLMKAL 426

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG S   +R++  F+ +P  G++G           F+    E   R+  LA   G   KR
Sbjct: 427 LGSSFDVLRVLRAFDDHPACGIVGPESAYLSN-ARFWGGNEE---RLRVLAAETGIEEKR 482

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
           + L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F 
Sbjct: 483 IRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFF 542

Query: 380 IESV 383
             + 
Sbjct: 543 AATT 546


>gi|218455307|gb|AAX19610.2| WxocB [Xanthomonas oryzae pv. oryzicola]
 gi|218455309|gb|AAX19612.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 117/244 (47%), Gaps = 11/244 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV--VEANKDFEQDVLKYFPS 200
              ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V  +   +   +   ++   
Sbjct: 311 DAESLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIR 370

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS         G  WR  L   L
Sbjct: 371 ASVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSVYHDG----GGQWRDDLMKAL 426

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG S   +R++  F+ +P  G++G           F+    E   R+  LA   G   KR
Sbjct: 427 LGSSFDVLRVLRAFDDHPACGIVGPESAYLSN-ARFWGGNEE---RLRVLAAETGIEEKR 482

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
           + L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F 
Sbjct: 483 IRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFF 542

Query: 380 IESV 383
             + 
Sbjct: 543 AATT 546


>gi|166713474|ref|ZP_02244681.1| hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 568

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 117/244 (47%), Gaps = 11/244 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV--VEANKDFEQDVLKYFPS 200
              ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V  +   +   +   ++   
Sbjct: 311 DAESLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIR 370

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS         G  WR  L   L
Sbjct: 371 ASVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSVYHDG----GGQWRDDLMKAL 426

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG S   +R++  F+ +P  G++G           F+    E   R+  LA   G   KR
Sbjct: 427 LGSSFDVLRVLRAFDDHPACGIVGPESAYLSN-ARFWGGNEE---RLRVLAAETGIEEKR 482

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
           + L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F 
Sbjct: 483 IRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFF 542

Query: 380 IESV 383
             + 
Sbjct: 543 AATT 546


>gi|319946716|ref|ZP_08020950.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           australis ATCC 700641]
 gi|319746764|gb|EFV99023.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           australis ATCC 700641]
          Length = 581

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 71/271 (26%), Positives = 109/271 (40%), Gaps = 30/271 (11%)

Query: 135 DRPSSP----------KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV 184
           DRP  P          +  G T   K+A+ +H +Y D   E        +F +DL++T  
Sbjct: 260 DRPDYPYLLSRKYLKDQDLGDTFDKKVAVHLHVFYVDLLEEFLDAFQAFHFAYDLWITTD 319

Query: 185 -EANKDFEQDVLKYFPS-AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
            E  K   +++L      A + V  N GRDV P L L E      YDY+   H KKS+  
Sbjct: 320 VEEKKQAIEEILSNRAQVATVVVTGNIGRDVLPMLLLKEQ--LSHYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKR 300
            +    G  WR+ L   L+  +D   +I+   E NP +G+  +    + RY R       
Sbjct: 378 DFWA--GESWRKELIDMLVKPAD---KILANMEANPKVGITIADIPTFFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEER 354
             +   +  L +R G      F      +  + GT  W K   L+PL +L+L        
Sbjct: 433 VLISPEMNKLWQRMGATKTIDFKNLNTFVMSY-GTFVWFKYDALKPLFDLNLKAADVPAE 491

Query: 355 NLKDGALEHAVERFFACSV--RYTEFSIESV 383
            L   ++ HA+ER        +  +F I   
Sbjct: 492 PLPQNSILHAIERLLVYIAWDQKYDFRISQN 522


>gi|322516362|ref|ZP_08069287.1| rhamnosyltransferase [Streptococcus vestibularis ATCC 49124]
 gi|322125095|gb|EFX96488.1| rhamnosyltransferase [Streptococcus vestibularis ATCC 49124]
          Length = 581

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 72/276 (26%), Positives = 113/276 (40%), Gaps = 34/276 (12%)

Query: 120 SEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDL 179
           S K+L  +EL E +                K+A+ +H +Y D   E        +F +DL
Sbjct: 269 SHKYLKGQELVENF--------------DRKVAVHLHVFYVDLLEEFLDAFQAFHFIYDL 314

Query: 180 FVTVV-EANKDFEQDVLK-YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGK 237
           ++T   E  K   + +L      A + V  N GRDV P L L E     RYDY+   H K
Sbjct: 315 WITTDVEEKKQAIEKILSNRVQDATVVVTGNIGRDVLPMLLLKEQ--LSRYDYVGHFHTK 372

Query: 238 KSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWS 295
           KS+   +    G  WR+ L   L+  +D+   I+   E NP +G+  +    + RY R  
Sbjct: 373 KSKEADFWA--GESWRKELIEMLVKPADL---ILANMEANPKVGITIADIPTFFRYNRIV 427

Query: 296 FFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE 349
                + +   +  L +R G      F +    +  + GT  W K   L+PL +L+L   
Sbjct: 428 VAWNEALISPEMNKLWQRMGATKTIDFKSLNTFVMSY-GTFVWFKYDALKPLFDLNLTAA 486

Query: 350 FEEERNLKDGALEHAVERFFACSV--RYTEFSIESV 383
                 L   ++ HA+ER        +  +F I   
Sbjct: 487 DVPAEPLPQNSILHAIERLLIYIAWDQKYDFRISQN 522


>gi|218455296|gb|AAV67426.2| glycosyltransferase [Xanthomonas oryzae pv. oryzicola]
 gi|218455299|gb|AAX19602.2| WxocB [Xanthomonas oryzae pv. oryzicola]
 gi|218455301|gb|AAX19604.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 78/244 (31%), Positives = 117/244 (47%), Gaps = 11/244 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV--VEANKDFEQDVLKYFPS 200
              ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V  +   +   +   ++   
Sbjct: 311 DAESLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIR 370

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A +++  N GRDV PF+ LL  G+ DRYD +CKIH KKS         G  WR  L   L
Sbjct: 371 ASVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKIHSKKSVYHDG----GGQWRDDLMKAL 426

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG S   +R++  F+ +P  G++G           F+    E   R+  LA   G   KR
Sbjct: 427 LGSSFDVLRVLRAFDDHPACGIVGPESAYLSN-ARFWGGNEE---RLRVLAAETGIEEKR 482

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
           + L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F 
Sbjct: 483 IRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFF 542

Query: 380 IESV 383
             + 
Sbjct: 543 AATT 546


>gi|218455305|gb|AAX19608.2| WxocB [Xanthomonas oryzae pv. oryzicola]
          Length = 568

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 77/244 (31%), Positives = 117/244 (47%), Gaps = 11/244 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV--VEANKDFEQDVLKYFPS 200
              ++ S+ AIV+H ++ D    I   +  +  D+D+FV+V  +   +   +   ++   
Sbjct: 311 DAESLSSRFAIVLHLFHIDLIDAICAYMRNVIVDYDVFVSVKSISDRRMAVRYFQEHKIR 370

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A +++  N GRDV PF+ LL  G+ DRYD +CK+H KKS         G  WR  L   L
Sbjct: 371 ASVFIHPNIGRDVGPFISLLNTGLLDRYDAVCKVHSKKSVYHDG----GGQWRDDLMKAL 426

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           LG S   +R++  F+ +P  G++G           F+    E   R+  LA   G   KR
Sbjct: 427 LGSSFNVLRVLRAFDDHPACGIVGPESAYLSN-ARFWGGNEE---RLRVLAAETGIEEKR 482

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
           + L FF GTMFW +P  L  LR   + + EF+ E   +D  L H +ER F   V    F 
Sbjct: 483 IRLGFFAGTMFWFRPAALSALRARSIGLSEFDPEAGQRDATLAHVIERLFVLWVEQAGFF 542

Query: 380 IESV 383
             + 
Sbjct: 543 AATT 546


>gi|55823377|ref|YP_141818.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           CNRZ1066]
 gi|55739362|gb|AAV63003.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           CNRZ1066]
          Length = 581

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 71/271 (26%), Positives = 110/271 (40%), Gaps = 30/271 (11%)

Query: 135 DRPSSP----------KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV 184
           DRP  P          ++       K+A+ +H +Y D   E        +F +DL++T  
Sbjct: 260 DRPDYPYLLSRKYLKNQELTGDFDKKVAVHLHVFYVDLLEEFLDAFQDFHFAYDLWITTD 319

Query: 185 --EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
             E  ++ EQ + +    A + V  N GRDV P L L E     RYDY+   H KKS+  
Sbjct: 320 IEEKKQEIEQILSRRSQDATIVVTGNIGRDVLPMLLLKEK--LSRYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKR 300
            +    G  WR+ L   L+  +D   +I+   E NP +G+       Y RY R       
Sbjct: 378 DFWA--GESWRKELIDMLVKPAD---QILANMEANPKVGITIGDIPTYFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEER 354
           + +   +  L +R G      F      +  + GT  W K   L+PL +L+L        
Sbjct: 433 ALISPEMNKLWQRMGATKNIDFKNLNTFVMSY-GTFVWFKYDALKPLFDLNLTVSDVPAE 491

Query: 355 NLKDGALEHAVERFFACSV--RYTEFSIESV 383
            L   ++ HA+ER        +  +F I   
Sbjct: 492 PLPQNSILHAIERLLVYIAWDQKYDFRISQN 522


>gi|296876714|ref|ZP_06900762.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           parasanguinis ATCC 15912]
 gi|296432216|gb|EFH18015.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           parasanguinis ATCC 15912]
          Length = 582

 Score =  239 bits (609), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 70/271 (25%), Positives = 111/271 (40%), Gaps = 30/271 (11%)

Query: 135 DRPSSP----------KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV 184
           DRP  P          ++       K+A+ +H +Y D   E        +FD+DL++T  
Sbjct: 260 DRPDFPYLLSRKYLKKQELAGDFDKKVAVHLHVFYVDLLEEFLDAFRDFHFDYDLWITTD 319

Query: 185 --EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
             E  +  EQ +      A++ V  N GRDV P L L E     +YDY+   H KKS+  
Sbjct: 320 VEEKKQAIEQILSNRAQDARVVVTGNIGRDVLPMLLLKEQ--LSKYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKR 300
            +    G  WR+ L   L+  +D   +I+   E NP +G+  +    + RY R       
Sbjct: 378 DFWA--GESWRKELIEMLVKPAD---QILANMEANPKVGITIADIPTFFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEER 354
           + +   +  L +R G      F      +  + GT  W K   L+PL +L+L        
Sbjct: 433 ALISPEMNKLWQRMGATKTIDFEKINTFVMSY-GTFVWFKYDALKPLFDLNLTAADVPAE 491

Query: 355 NLKDGALEHAVERFFACSV--RYTEFSIESV 383
            L   ++ HA+ER        +  +F I   
Sbjct: 492 PLPQNSILHAIERLLIYIAWDQKYDFRISQN 522


>gi|160894491|ref|ZP_02075267.1| hypothetical protein CLOL250_02043 [Clostridium sp. L2-50]
 gi|156863802|gb|EDO57233.1| hypothetical protein CLOL250_02043 [Clostridium sp. L2-50]
          Length = 646

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 58/246 (23%), Positives = 102/246 (41%), Gaps = 10/246 (4%)

Query: 141 KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE-ANKDFEQDVLKYFP 199
           K   +  K K+A+V+H Y+ D   +       +  + D+++T      K+    V K  P
Sbjct: 305 KMDEILKKRKLALVMHLYFPDLVEDSFQWASNVPKETDVYITTDTVEKKEAILKVFKNLP 364

Query: 200 S--AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLF 257
               ++ V+ N+GRDV   L  ++  V   YDY C +H KK+ +     + G  +    +
Sbjct: 365 CNHLEVRVIVNRGRDVSSILVGVK-DVIQNYDYACFVHDKKTAQAKPGSV-GDSFGYKCW 422

Query: 258 FDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK-RSEVYRRVIDLAKRAGF 316
            + L   +    ++ TFE N  LG++          +          + +  ++A + G 
Sbjct: 423 NNTLYNKEFVCNVLQTFEDNERLGILSPPEPNHGPFYQTLGNEWGCNFEKSREVADKLGI 482

Query: 317 PTK---RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACS 372
                         GT FW +P  L+ L +      EF EE N  DG + HA+ER +   
Sbjct: 483 TIPMSEDKEALAPYGTFFWFRPTALKVLFDHDWQYEEFPEEPNNFDGTILHAIERLYPIC 542

Query: 373 VRYTEF 378
           V+   +
Sbjct: 543 VQQAGY 548


>gi|116628171|ref|YP_820790.1| polysaccharide biosynthesis protein [Streptococcus thermophilus
           LMD-9]
 gi|116101448|gb|ABJ66594.1| Lipopolysaccharide biosynthesis protein [Streptococcus thermophilus
           LMD-9]
          Length = 581

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 71/271 (26%), Positives = 110/271 (40%), Gaps = 30/271 (11%)

Query: 135 DRPSSP----------KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV 184
           DRP  P          ++       K+A+ +H +Y D   E        +F +DL++T  
Sbjct: 260 DRPDYPYLLSRKYLKNQELTGDFDKKVAVHLHVFYVDLLEEFLDAFQDFHFAYDLWITTD 319

Query: 185 --EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
             E  ++ EQ + +    A + V  N GRDV P L L E     RYDY+   H KKS+  
Sbjct: 320 VEEKKQEIEQILSRRSQDATIVVTGNIGRDVLPMLLLKEK--LSRYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKR 300
            +    G  WR+ L   L+  +D   +I+   E NP +G+       Y RY R       
Sbjct: 378 DFWA--GESWRKELIDMLVKPAD---QILANMEANPKVGITIGDIPTYFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEER 354
           + +   +  L +R G      F      +  + GT  W K   L+PL +L+L        
Sbjct: 433 ALISPEMNKLWQRMGATKNIDFKNLNTFVMSY-GTFVWFKYDALKPLFDLNLTVSDVPAE 491

Query: 355 NLKDGALEHAVERFFACSV--RYTEFSIESV 383
            L   ++ HA+ER        +  +F I   
Sbjct: 492 PLPQNSILHAIERLLVYIAWDQKYDFRISQN 522


>gi|319939379|ref|ZP_08013739.1| RgpFc protein [Streptococcus anginosus 1_2_62CV]
 gi|319811365|gb|EFW07660.1| RgpFc protein [Streptococcus anginosus 1_2_62CV]
          Length = 587

 Score =  237 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 65/269 (24%), Positives = 104/269 (38%), Gaps = 22/269 (8%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE 185
            K L      + ++P         KI + +H +Y D   +        +F +DLF+T   
Sbjct: 270 FKYLLARKYIQTTAPTSLS---NKKIGVHLHVFYVDLLEDFLKAFENFHFAYDLFITTDN 326

Query: 186 ANKDFEQDVL--KYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG 243
             K  E + +  +   +A ++V  N GRDV P L L +      YDY+   H KKS+   
Sbjct: 327 DTKKLEIEAILNQNHKNAHIFVTGNIGRDVLPMLKLKKY--LSTYDYIGHFHTKKSKEAD 384

Query: 244 YHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRS 301
           +    G  WR  L   L+  +D    I+  FE +  LG++ S    + RY +        
Sbjct: 385 FWA--GESWRNELIDMLIKPAD---NILANFEND-KLGLVISDIPTFFRYNKIVDAWNEH 438

Query: 302 EVYRRVIDLAKRAGFPTKRLHLDF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNL 356
            +   + DL  +           F       GT  W K   L+PL +L L  +      L
Sbjct: 439 LIAPEMNDLWYKMKMTKPIDFNTFHTFVMSYGTFIWFKYDALKPLFDLDLTDKDVPIEPL 498

Query: 357 KDGALEHAVERFFACSV--RYTEFSIESV 383
              ++ HA+ER         + +F I   
Sbjct: 499 PQNSILHAIERLIVYVAWNEHYDFRISKN 527


>gi|299133415|ref|ZP_07026610.1| Rhamnan synthesis F [Afipia sp. 1NLS2]
 gi|298593552|gb|EFI53752.1| Rhamnan synthesis F [Afipia sp. 1NLS2]
          Length = 408

 Score =  237 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 92/241 (38%), Positives = 130/241 (53%), Gaps = 5/241 (2%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK 196
           P +PK   L  +    I+VH +Y D W +    L  L   F L VT+ E+N DF   V  
Sbjct: 153 PGAPKPLQLNGRIATGIIVHLHYCDVWPDFEKRLRNLTCPFSLIVTLNESNPDFAARVAG 212

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
            FP+A++ V  N+GRDV PF+ LL  G  D ++ +CK+HGKK+   G   I G IWRR L
Sbjct: 213 QFPNAKVLVYPNRGRDVGPFIQLLREGHLDDFELICKLHGKKTVSLGPRMIFGEIWRRLL 272

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF 316
             DL+G  ++   I+  F   P LG++GS  +R     ++           ++LAKR G 
Sbjct: 273 LNDLVGSDELVRAILQRFISQPGLGLVGSSHFRG----NYLGTWPRNAALTLELAKRLGC 328

Query: 317 PTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRY 375
           P +R  LDFF GTMFWV+ + L+ L++L+L   +F  E    DG L+HA+ER F      
Sbjct: 329 PEERFKLDFFAGTMFWVRRELLDLLKSLNLSQDDFPVEAGQTDGTLQHALERIFGALPGL 388

Query: 376 T 376
            
Sbjct: 389 A 389


>gi|297538440|ref|YP_003674209.1| Rhamnan synthesis F [Methylotenera sp. 301]
 gi|297257787|gb|ADI29632.1| Rhamnan synthesis F [Methylotenera sp. 301]
          Length = 782

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 64/259 (24%), Positives = 112/259 (43%), Gaps = 13/259 (5%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-V 184
                E     P S +         +A++ H +Y     +    L  + F+FD+++T   
Sbjct: 487 FARKIEYAMLVPFSYQVESPQNNPSLAVICHLFYHQMCEDYKVYLSNIPFNFDIYITTDT 546

Query: 185 EANKDFEQDVLKYFP--SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
           E  K + +     +     ++ +  N+GRD+ P L      ++  Y+Y+  IH K S   
Sbjct: 547 EDKKAYIEKSFSGWQRGKVEVRLAVNQGRDIAPKLIACR-DIYSAYEYILHIHSKNSPYS 605

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSE 302
             H      WR ++   LLG       I   F+ N  LG+I  + ++  K    + +  +
Sbjct: 606 SIHTG----WRDYILDTLLGSQKTVSSIFEAFQLNSNLGIIAPQHFKALKLDIGWDRNFK 661

Query: 303 VYRRVIDLAKRAGFP-TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGA 360
           + ++   LA R GF  +++  +DF +G+MFW +   L PL N  L + +F  E   KDG 
Sbjct: 662 IAKK---LAGRMGFDISRKAPIDFPSGSMFWARSAALLPLLNCSLSLQDFPREDGQKDGT 718

Query: 361 LEHAVERFFACSVRYTEFS 379
             H++ER +        FS
Sbjct: 719 TAHSIERLYFFICEKAGFS 737


>gi|84501312|ref|ZP_00999517.1| hypothetical protein OB2597_13143 [Oceanicola batsensis HTCC2597]
 gi|84390603|gb|EAQ03091.1| hypothetical protein OB2597_13143 [Oceanicola batsensis HTCC2597]
          Length = 741

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 81/305 (26%), Positives = 125/305 (40%), Gaps = 30/305 (9%)

Query: 102 KAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWND-------------RPSSPKKSGLTIK 148
            A+L LN  ++ + +P       +   L  G                R + P+      +
Sbjct: 72  GAYLGLNPDVAEAGLP----PLHHFLTLGRGEGRGTRAQPVESLPPIRTTIPRFDPRRPR 127

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE---ANKDFEQDVLKYFPSAQLYV 205
           ++ AI +H YY D W E S  L RL+  FDL+VT+       +     + +  P AQ++ 
Sbjct: 128 ARFAIHLHLYYPDLWPEFSERLDRLDLSFDLYVTLTWRGPETEWLADIIREAHPRAQVFP 187

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
           + N+GRD+ PFL LL  G FD Y+ +CK+HGKKS     H  +G  WRR L   +L    
Sbjct: 188 VANRGRDILPFLRLLNAGAFDGYEAICKLHGKKSP----HRDDGDAWRRHLVDGVLPGKA 243

Query: 266 IAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDF 325
           +   +            +   +    ++W  +        R   L +R          DF
Sbjct: 244 LWTSLSAFLADEDAALWVADGQRYSVRKW--WGSNRA---RTDALLRRVELDRSDTDFDF 298

Query: 326 FNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESVD 384
             G+M+W+KP  L  +R L L  + FE E    DG L HA ER      +     +    
Sbjct: 299 PAGSMYWMKPLLLGMIRALDLTEDLFEPESGQTDGTLAHAFERAIGALAKAAGQEVRQTS 358

Query: 385 CVAEY 389
            +   
Sbjct: 359 ELGRA 363


>gi|171779906|ref|ZP_02920810.1| hypothetical protein STRINF_01693 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281254|gb|EDT46689.1| hypothetical protein STRINF_01693 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 592

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 101/248 (40%), Gaps = 19/248 (7%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--VLKYFPSAQLY 204
              KIA+ +H +Y D   +        +F +DLF+T   A K  E +  +      AQ++
Sbjct: 288 ADKKIAVHLHVFYVDLLEDFLDAFENFHFVYDLFITTDNATKKQEIESILRSNGKDAQIF 347

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
           V  N GRDV P L L +      YDY+   H KKS+   +    G  WR  L   L+  +
Sbjct: 348 VTGNVGRDVLPMLKLKDY--LSDYDYIGHFHTKKSKEADFWA--GESWRNELIDMLIKPA 403

Query: 265 DIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLH 322
           D    I+  F  N  LG++ +    + R+ +         +   + DL ++ G       
Sbjct: 404 D---NILANF-DNDKLGIVIADIPTFFRFNKIVDAWNEHLIAPAMNDLWQQMGMTKAIDF 459

Query: 323 LDF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RY 375
            +F       GT  W K   L+PL +L L  E      L   ++ HA+ER         +
Sbjct: 460 NNFHNFVMSYGTYVWFKYDALKPLFDLGLTDEDVPAEPLPQNSILHAIERLLIYIAWNEH 519

Query: 376 TEFSIESV 383
            +F I   
Sbjct: 520 YDFRISKN 527


>gi|312133752|ref|YP_004001091.1| protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|311773032|gb|ADQ02520.1| Hypothetical protein BBMN68_1493 [Bifidobacterium longum subsp.
           longum BBMN68]
          Length = 651

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 59/254 (23%), Positives = 100/254 (39%), Gaps = 12/254 (4%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD-FEQDVLKY 197
               S       +A+V H YY D        +  +    D+ +TV    K    ++  + 
Sbjct: 299 QDHTSYEPNPKHVALVFHLYYIDLLDSSLQYISSMPEGCDVIITVGSEEKACIVKERCEG 358

Query: 198 FP-SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
            P +  + V+EN+GRDV   L      V   YD +C  H KK  +     + G  +    
Sbjct: 359 MPYNIDVRVIENRGRDVSALLVGAGKDVL-NYDLVCFAHDKKVTQIKPLSV-GDGFAYKC 416

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVY-RRVIDLA 311
           F ++L        II+ FE+ P LG++          +      +    +   + + D+ 
Sbjct: 417 FENILASKAYVANIIDQFEREPHLGVLMPNPPEHGNYFPVFTLSWGDNFDGTVQLLRDIH 476

Query: 312 KRAGFPTKRLHLDFFNGTMFWVKPKCL-EPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
           K      K+  +    GTMFW +PK L + L N +    +F +E N  DG + H +ER +
Sbjct: 477 KTVPLDKKKEVIA-PLGTMFWFRPKALSDGLLNHNWQYSDFPKEPNKIDGTILHYIERAY 535

Query: 370 ACSVRYTEFSIESV 383
               +   +    V
Sbjct: 536 CYVAQANGYYSGYV 549


>gi|312866008|ref|ZP_07726229.1| rhamnan synthesis protein F [Streptococcus downei F0415]
 gi|311098412|gb|EFQ56635.1| rhamnan synthesis protein F [Streptococcus downei F0415]
          Length = 584

 Score =  236 bits (603), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 61/256 (23%), Positives = 110/256 (42%), Gaps = 20/256 (7%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLK 196
             +   L  +SK+A+ +H +Y D   E        +F +DLF+T  +  K  + +  + +
Sbjct: 275 QAEAEELPAESKVAVHLHVFYVDLLQEFLDAFKTFHFAYDLFITTDKEEKRAEIQAILEQ 334

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
               AQ++V  N GRDV P L L +      YDY+   H KKS+   Y    G  WR+ L
Sbjct: 335 NQVLAQIFVTGNIGRDVLPMLKLKDQ--LKGYDYIGHFHTKKSKEADYWA--GQSWRQEL 390

Query: 257 FFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
              L+  ++   +I+    +N  LG++ +    + R+ +       + +   + +L ++ 
Sbjct: 391 IAMLVKPAN---QILAQMAKNDRLGIVIADMPSFFRFNKIVVAWNENLIAPEMEELWEKM 447

Query: 315 ------GFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERF 368
                  F      +  + GT  W K   L PL +L L  E+     L   ++ HA+ER 
Sbjct: 448 SLKKSIDFKAMDTFVMSY-GTYAWFKYDALSPLFDLDLTDEYVPAEPLPQNSILHAIERL 506

Query: 369 FACSV--RYTEFSIES 382
                  ++ ++ I  
Sbjct: 507 LIYIAWDKHYDYRISP 522


>gi|312867647|ref|ZP_07727853.1| rhamnan synthesis protein F [Streptococcus parasanguinis F0405]
 gi|311096710|gb|EFQ54948.1| rhamnan synthesis protein F [Streptococcus parasanguinis F0405]
          Length = 582

 Score =  236 bits (602), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 69/271 (25%), Positives = 109/271 (40%), Gaps = 30/271 (11%)

Query: 135 DRPSSP----------KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV 184
           DRP  P          ++       K+A+ +H +Y D   E        +F +DL++T  
Sbjct: 260 DRPDYPYLLSRKYVKNQELAENFDRKVAVHLHVFYVDLLEEFLDAFQAFHFVYDLWITTD 319

Query: 185 -EANKDFEQDVLK-YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQRE 242
            E  K   + +L      A + V  N GRDV P L L E     +YDY+   H KKS+  
Sbjct: 320 VEEKKQTIEKILSNRAQDATVVVTGNIGRDVLPMLLLKEQ--LSQYDYVGHFHTKKSKEA 377

Query: 243 GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKR 300
            +    G  WR+ L   L+  +D   +I+   E NP +G+  +    + RY R       
Sbjct: 378 DFWA--GESWRKELIEMLVKPAD---QILANMEANPKVGITIADIPTFFRYNRIVVAWNE 432

Query: 301 SEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEER 354
           + +   +  L +R G      F      +  + GT  W K   L+PL +L+L        
Sbjct: 433 ALISPEMNKLWERMGAAKTIDFKNLNTFVMSY-GTFVWFKYDALKPLFDLNLTAANVPAE 491

Query: 355 NLKDGALEHAVERFFACSV--RYTEFSIESV 383
            L   ++ HA+ER        +  +F I   
Sbjct: 492 PLPQNSILHAIERLLIYIAWDQKYDFRISQN 522


>gi|83582737|ref|YP_425043.1| glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
 gi|83578053|gb|ABC24603.1| Glycosyl transferase, group 1 [Rhodospirillum rubrum ATCC 11170]
          Length = 1236

 Score =  235 bits (601), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 67/263 (25%), Positives = 112/263 (42%), Gaps = 18/263 (6%)

Query: 130  FEGWNDRPSSPKKSGLTIK---SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEA 186
             +G    P    ++ L       K+ +  H YY D   +    ++  +F  DL +T  + 
Sbjct: 964  PKGNWTHPVIDLETSLPSPIEGGKVLLHGHFYYVDLIDDFLKKIIINDFSCDLIITTTDE 1023

Query: 187  NKDF-EQDVLKYFPS--AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG 243
            ++    +  L+ + +   ++ V+ N GRDV  F   L       YD +  IHGKKS    
Sbjct: 1024 DRAVFLRKKLEEYKNGSVEVRVVPNIGRDVGAFFTGLSDLKNSDYDVVGHIHGKKSIH-- 1081

Query: 244  YHPIEGIIWRRWLFFDLLGFSDIAIRI-INTFEQNPCLGMIGSRRYRRYKRWSFFAKRSE 302
                 G  WR +L+  L+G    A  I ++   +NP +G++ +     +          +
Sbjct: 1082 LSDGTGNKWRNFLWEHLIGGEKKAAAIAVSALIRNPDIGLVFAEEPFLF-------GWDK 1134

Query: 303  VYRRVIDLAKRAGF-PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGA 360
                  DLAK+ G   +     D+  GTMFW K K LEP+ +L+L   ++  E     G 
Sbjct: 1135 NKELANDLAKKMGIEKSLPRFFDWPIGTMFWAKRKALEPIFDLNLRWEDYPPEPIPVYGT 1194

Query: 361  LEHAVERFFACSVRYTEFSIESV 383
            + HA+ER    +V    FS  + 
Sbjct: 1195 MLHALERLLPFAVEKAGFSFATT 1217


>gi|225868697|ref|YP_002744645.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. zooepidemicus]
 gi|225701973|emb|CAW99527.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. zooepidemicus]
          Length = 581

 Score =  235 bits (601), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 73/286 (25%), Positives = 119/286 (41%), Gaps = 31/286 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L E    +P S  +S      KIA+ +H +Y D   E     
Sbjct: 256 MSQVHLP-DAKYLLAHKYLPE----QPISIDQS-----KKIAVHLHVFYVDLLSEFLEAF 305

Query: 171 LRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              +FD+DL +T     K  + ++ + +   SA + V  N GRDV P L L E     +Y
Sbjct: 306 SHFHFDYDLLITTDSKAKKAEIKEILRESGASADILVTGNIGRDVLPMLTLKER--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-- 286
           DY+   H KKS+   +    G  WR  L   ++  +D   +I+     +  +G++ +   
Sbjct: 364 DYIGHFHTKKSKEADFWA--GQSWRTELIDMMVKPAD---QILTALAAD-AIGIVIADIP 417

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLA------KRAGFPTKRLHLDFFNGTMFWVKPKCLEP 340
            + R+ +         +   +  L       KR  F T    +  + GT  W K   L+P
Sbjct: 418 SFFRFNKIVDAWNEHLIAPEMNQLWQAMGLTKRIDFQTMDTFVMSY-GTFVWFKYDALKP 476

Query: 341 LRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYTEFSIESVD 384
           L +L L         L   ++ HA+ER        R+ +F I   +
Sbjct: 477 LFDLDLSEADIPAEPLPQNSILHAIERLLIYIAWDRHYDFRISRNE 522


>gi|82703518|ref|YP_413084.1| glycosyl transferase, group 1 [Nitrosospira multiformis ATCC 25196]
 gi|82411583|gb|ABB75692.1| Glycosyl transferase, group 1 [Nitrosospira multiformis ATCC 25196]
          Length = 828

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 65/284 (22%), Positives = 108/284 (38%), Gaps = 22/284 (7%)

Query: 105 LRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP-------SSPKKSGLTIKSKIAIVVHC 157
                F+ ++    + +       L  G  D P       S      L+   ++A+ +H 
Sbjct: 541 FHPGVFLEHNAGKSEGDPLA--NYLRAGQPDGPWRYGLITSEEAARPLSSSIRVALHLHV 598

Query: 158 YYQDTWIEISHILLRLNFDFDLFVTVVEA-NKDFEQDVLKYFPS--AQLYVMENKGRDVR 214
           YY + + EI   L   N   DLF++V     ++    +L  +P     + ++ N+GRD+ 
Sbjct: 599 YYSELFPEIMARLKVNNVRPDLFISVPTECTRNEVTGLLNDYPGKVVDIQIVPNRGRDIG 658

Query: 215 PFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRII-NT 273
           P L        D YD +  +H KK+       I G  W  +L  +LLG       II   
Sbjct: 659 PLLTAFGSVFLDDYDAIGHLHTKKTADLSDEMI-GKRWYTFLLENLLGGKRNMADIILGR 717

Query: 274 FEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWV 333
              +P +G++       +     +            LA + G    + +  F  GTMFW 
Sbjct: 718 MTADPAIGIVFPDDPHVFD----WGNNKA---HADSLASKLGLGKLQENFVFPMGTMFWA 770

Query: 334 KPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYT 376
           + + L PL  L L   ++  E    DG + HA+ER         
Sbjct: 771 RTEALRPLFTLDLSWQDYPAEPLPYDGTILHALERLLPLIAAKQ 814


>gi|225350704|ref|YP_002720664.1| putative glycosyl transferase, group 1 [Brachyspira hyodysenteriae
           WA1]
 gi|225216388|gb|ACN85121.1| putative glycosyl transferase, group 1 [Brachyspira hyodysenteriae
           WA1]
          Length = 342

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 109/245 (44%), Gaps = 12/245 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYFP-- 199
           +    K KI I +H YY D        L     +FDLF+T   E NKD   +     P  
Sbjct: 19  TEEIKKLKIGIHIHLYYIDMMDMFIKYLKDSPIEFDLFITTSKEENKDICLNAFNKLPKL 78

Query: 200 -SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFF 258
            +  ++++EN GRD+ P+L      + + YD  C +H KKS     H      W  +L  
Sbjct: 79  KNITIFIVENIGRDIAPWLIECN-NIQNNYDLFCHLHTKKSL----HWESINEWGEYLIE 133

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAK-RAGFP 317
           +L+   +    I++ F  +  +G+I    Y     +  +  + +++   + L K    F 
Sbjct: 134 NLI-SEEAINNILSNFILDNNIGIISPHIYYYLFPYILYIDKDDMHHIKLLLNKLNINFE 192

Query: 318 TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYT 376
            K  +  F  G+M W +PK L+PL +L+L   +F +E   K G + HA+ER        +
Sbjct: 193 PKPENFVFPVGSMLWYRPKVLKPLFDLNLKYSDFPQEPIPKTGTIAHAIERIIGIICEQS 252

Query: 377 EFSIE 381
            +  +
Sbjct: 253 NYKFK 257


>gi|221634566|ref|YP_002523254.1| Lipopolysaccharide biosynthesis protein-like protein [Rhodobacter
           sphaeroides KD131]
 gi|221163439|gb|ACM04401.1| Lipopolysaccharide biosynthesis protein-like protein [Rhodobacter
           sphaeroides KD131]
          Length = 755

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 88/325 (27%), Positives = 140/325 (43%), Gaps = 33/325 (10%)

Query: 85  LSFPSCRIFFYGSRKE--------QKAFLRLNRFMSNSRMPFDSEKF---LYVKELFEGW 133
           L +P      YG R           +A+LR +  ++ + +P            + L +  
Sbjct: 54  LKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVPPFLHYVRVGHAEQRLTKEL 113

Query: 134 NDRPSSPKKSGLTIK-------SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-- 184
            +  + P +    ++       +  A+ VH YY D W E +  L RL   FDL+VT+   
Sbjct: 114 PEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVTLTYR 173

Query: 185 -EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG 243
            E      Q++   FP A +  M N+GRD+ PF+ LL  G FD Y  +CK H KKS    
Sbjct: 174 GEETDALAQEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKSP--- 230

Query: 244 YHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLG-MIGSRRYRRYKRWSFFAKRSE 302
            H  +G +WR+ L   +L  + +  + +  F + P  G  +   ++    +W  +    E
Sbjct: 231 -HRQDGDLWRKHLIEGILPETGLEEK-LEAFVEAPEAGFWVADGQHYTGTQW--WGSNVE 286

Query: 303 VYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGAL 361
             R    L +R   P  R  L F  G+++WVKP  L  LR+L L + +F+ E    DG L
Sbjct: 287 ATRH---LLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDIEEGQVDGTL 343

Query: 362 EHAVERFFACSVRYTEFSIESVDCV 386
            HA+ER            +     +
Sbjct: 344 AHAIERVLGYLTARAGQKVLQTSEL 368


>gi|126464825|ref|YP_001041801.1| lipopolysaccharide biosynthesis protein-like [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126106640|gb|ABN79165.1| Lipopolysaccharide biosynthesis protein-like [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 751

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 87/325 (26%), Positives = 140/325 (43%), Gaps = 33/325 (10%)

Query: 85  LSFPSCRIFFYGSRKE--------QKAFLRLNRFMSNSRMPFDSEKF---LYVKELFEGW 133
           L +P      YG R           +A+LR +  ++ + +P            + L +  
Sbjct: 50  LKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVPPFLHYVRVGHAEQRLTKEL 109

Query: 134 NDRPSSPKKSGLTIK-------SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-- 184
            +  + P +    ++       +  A+ VH YY D W E +  L RL   FDL+VT+   
Sbjct: 110 PEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVTLTYR 169

Query: 185 -EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG 243
            E      +++   FP A +  M N+GRD+ PF+ LL  G FD Y  +CK H KKS    
Sbjct: 170 GEETDALAEEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKSP--- 226

Query: 244 YHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLG-MIGSRRYRRYKRWSFFAKRSE 302
            H  +G +WR+ L   +L  + +  + +  F + P  G  +   ++    +W  +    E
Sbjct: 227 -HRQDGDLWRKHLIEGILPETGLEEK-LEAFVEAPEAGFWVADGQHYTGTQW--WGSNVE 282

Query: 303 VYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGAL 361
             R    L +R   P  R  L F  G+++WVKP  L  LR+L L + +F+ E    DG L
Sbjct: 283 ATRH---LLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDIEEGQVDGTL 339

Query: 362 EHAVERFFACSVRYTEFSIESVDCV 386
            HA+ER            +     +
Sbjct: 340 AHAIERVLGYLTARAGQKVLQTSEL 364


>gi|94990172|ref|YP_598272.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10270]
 gi|94543680|gb|ABF33728.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10270]
          Length = 581

 Score =  233 bits (594), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 114/273 (41%), Gaps = 29/273 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-- 286
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE N  +G+I +   
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETND-IGIIIADIP 417

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEP 340
            + R+ +         + + ++ L ++        F      +  + GT  W K   L+ 
Sbjct: 418 SFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKS 476

Query: 341 LRNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
           L +L L         L   ++ HA+ER      
Sbjct: 477 LFDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|94988294|ref|YP_596395.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS9429]
 gi|94992170|ref|YP_600269.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS2096]
 gi|94541802|gb|ABF31851.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS9429]
 gi|94545678|gb|ABF35725.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS2096]
          Length = 581

 Score =  233 bits (594), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 114/273 (41%), Gaps = 29/273 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-- 286
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE N  +G+I +   
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETND-IGIIIADIP 417

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEP 340
            + R+ +         + + ++ L ++        F      +  + GT  W K   L+ 
Sbjct: 418 SFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKS 476

Query: 341 LRNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
           L +L L         L   ++ HA+ER      
Sbjct: 477 LFDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|220924211|ref|YP_002499513.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium nodulans ORS 2060]
 gi|219948818|gb|ACL59210.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium nodulans ORS 2060]
          Length = 1366

 Score =  233 bits (594), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 72/251 (28%), Positives = 113/251 (45%), Gaps = 14/251 (5%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD-VLK 196
           SS    GL +  ++A++ H +Y D   E+S  L R+    DLF++    +K  +    L+
Sbjct: 690 SSIGDVGLELPERVAVIAHVFYTDFCSELSAYLARIPTQADLFISTDTEDKRQQIAFALQ 749

Query: 197 YFP--SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRR 254
            +      + VM N GRD+ P L   +  VF+ Y+Y   IH KKS  +         WR 
Sbjct: 750 SYNMGKLTVRVMPNIGRDIAPMLVGFD-DVFNSYEYFLHIHSKKSPHDPAF----GSWRE 804

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
           +L  +LLG  DI   I+     +   G++ S+ +   +    F    E  +    L  R 
Sbjct: 805 FLLENLLGSEDIIRSILYLLHAH-KTGIVFSQHFEPVRHLLNFGYNFETMK---GLLGRC 860

Query: 315 GFP-TKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACS 372
           G   +  L L+F + + FW +   L+PL +L+L   +F  E    DG L HA+ER     
Sbjct: 861 GIKISNDLVLEFPSSSFFWGRSSALKPLLDLNLDWSDFAAEAGQIDGTLAHAIERSVLYI 920

Query: 373 VRYTEFSIESV 383
           V  + F    V
Sbjct: 921 VEKSGFRWAKV 931


>gi|225870347|ref|YP_002746294.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. equi 4047]
 gi|225699751|emb|CAW93520.1| rhamnan synthesis protein F family protein [Streptococcus equi
           subsp. equi 4047]
          Length = 581

 Score =  232 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 73/286 (25%), Positives = 118/286 (41%), Gaps = 31/286 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS    P D++  L  K L E    +P S  +S      KIA+ +H +Y D   E     
Sbjct: 256 MSQVH-PPDAKYLLAHKYLPE----QPISIDQS-----KKIAVHLHVFYVDLLSEFLEAF 305

Query: 171 LRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              +FD+DL +T     K  + ++ + +   SA + V  N GRDV P L L E     +Y
Sbjct: 306 SHFHFDYDLLITTDSKAKKAEIKEILRESGASADILVTGNIGRDVLPMLTLKER--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-- 286
           DY+   H KKS+   +    G  WR  L   ++  +D   +I+     +  +G++ +   
Sbjct: 364 DYIGHFHTKKSKEADFWA--GQSWRTELIDMMVKPAD---QILTALAAD-AIGIVIADIP 417

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLA------KRAGFPTKRLHLDFFNGTMFWVKPKCLEP 340
            + R+ +         +   +  L       KR  F T    +  + GT  W K   L+P
Sbjct: 418 SFFRFNKIVDAWNEHLIAPEMNQLWQAMGLTKRIDFQTMDTFVMSY-GTFVWFKYDALKP 476

Query: 341 LRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYTEFSIESVD 384
           L +L L         L   ++ HA+ER        R+ +F I   +
Sbjct: 477 LFDLDLSEADIPAEPLSQNSILHAIERLLIYIAWDRHYDFRISRNE 522


>gi|21910063|ref|NP_664331.1| hypothetical protein SpyM3_0527 [Streptococcus pyogenes MGAS315]
 gi|28896239|ref|NP_802589.1| hypothetical protein SPs1327 [Streptococcus pyogenes SSI-1]
 gi|21904254|gb|AAM79134.1| putative protein [Streptococcus pyogenes MGAS315]
 gi|28811490|dbj|BAC64422.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1]
          Length = 581

 Score =  232 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 114/273 (41%), Gaps = 29/273 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-- 286
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE N  +G+I +   
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETND-IGIIIADIP 417

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEP 340
            + R+ +         + + ++ L ++        F      +  + GT  W K   L+ 
Sbjct: 418 SFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKS 476

Query: 341 LRNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
           L +L L         L   ++ HA+ER      
Sbjct: 477 LFDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|125654691|ref|YP_001033885.1| hypothetical protein RSP_3918 [Rhodobacter sphaeroides 2.4.1]
 gi|77386351|gb|ABA81780.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 751

 Score =  232 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 87/325 (26%), Positives = 140/325 (43%), Gaps = 33/325 (10%)

Query: 85  LSFPSCRIFFYGSRKE--------QKAFLRLNRFMSNSRMPFDSEKF---LYVKELFEGW 133
           L +P      YG R           +A+LR +  ++ + +P            + L +  
Sbjct: 50  LKYPEKHYIAYGERLGYRPNPDFSPQAYLRYHPDVAEAGVPPFLHYVRVGHAEQRLTKEL 109

Query: 134 NDRPSSPKKSGLTIK-------SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-- 184
            +  + P +    ++       +  A+ VH YY D W E +  L RL   FDL+VT+   
Sbjct: 110 PEVVALPARGMPQVRFEHGRQTAPYAVAVHVYYPDLWPEFAARLRRLRIPFDLYVTLTYR 169

Query: 185 -EANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG 243
            E      +++   FP A +  M N+GRD+ PF+ LL  G FD Y  +CK H KKS    
Sbjct: 170 GEETDALAEEIRADFPGAFVTPMPNRGRDILPFVTLLNAGAFDGYRAVCKFHTKKSP--- 226

Query: 244 YHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLG-MIGSRRYRRYKRWSFFAKRSE 302
            H  +G +WR+ L   +L  + +  + +  F + P  G  +   ++    +W  +    E
Sbjct: 227 -HRQDGDLWRKHLIEGILPETGLEEK-LEAFVEAPEAGFWVADGQHYTGTQW--WGSNVE 282

Query: 303 VYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGAL 361
             R    L +R   P  R  L F  G+++WVKP  L  LR+L L + +F+ E    DG L
Sbjct: 283 ATRH---LLQRIEIPLDREALSFPAGSIYWVKPLVLGLLRSLQLRLEDFDLEEGQVDGTL 339

Query: 362 EHAVERFFACSVRYTEFSIESVDCV 386
            HA+ER            +     +
Sbjct: 340 AHAIERVLGYLTARAGQKVLQTSEL 364


>gi|50913971|ref|YP_059943.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS10394]
 gi|50903045|gb|AAT86760.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS10394]
          Length = 581

 Score =  232 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 64/273 (23%), Positives = 114/273 (41%), Gaps = 29/273 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-- 286
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE N  +G+I +   
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETND-IGIIIADIP 417

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEP 340
            + R+ +         + + ++ L ++        F      +  + GT  W K   L+ 
Sbjct: 418 SFFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKS 476

Query: 341 LRNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
           L +L L         L   ++ HA+ER      
Sbjct: 477 LFDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|55821450|ref|YP_139892.1| polysaccharide biosynthesis protein [Streptococcus thermophilus LMG
           18311]
 gi|55737435|gb|AAV61077.1| polysaccharide biosynthesis protein [Streptococcus thermophilus LMG
           18311]
          Length = 594

 Score =  232 bits (592), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 66/249 (26%), Positives = 104/249 (41%), Gaps = 20/249 (8%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL--KYFPSAQLYVM 206
            KIA+ +H YY D   +        +F +DLF+T    +K  E   +  K    A++++ 
Sbjct: 287 KKIAVHLHTYYVDLLEDFLKQFENFHFTYDLFLTTDSEDKKAEIQSILDKNGKVARIFIT 346

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRDV P L L +      YDY+   H KKS    Y    G  WR  LF  L+  +D 
Sbjct: 347 GNRGRDVIPMLKLKDE--LSAYDYIGHFHTKKSPEYPYWV--GDSWRNELFSMLIQPAD- 401

Query: 267 AIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPT 318
              II   E++  LG++ +    + RY +       +     + DL +R        F  
Sbjct: 402 --NIIANLERDDRLGLVIADIPSFFRYTKIVDPWNENRFAEGMNDLWERMDLGRDIDFDK 459

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFAC--SVRYT 376
               +  + GT  W K   L+PL +L L  E      +    + H++ER        R  
Sbjct: 460 MNTFIMSY-GTFIWFKYDALKPLFDLDLQDEEIPAEPIPQHTILHSIERILVYLAWARRY 518

Query: 377 EFSIESVDC 385
           +++I   D 
Sbjct: 519 DYAIAKNDI 527


>gi|262282406|ref|ZP_06060174.1| rhamnosyltransferase [Streptococcus sp. 2_1_36FAA]
 gi|262261697|gb|EEY80395.1| rhamnosyltransferase [Streptococcus sp. 2_1_36FAA]
          Length = 582

 Score =  232 bits (592), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 102/248 (41%), Gaps = 20/248 (8%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYV 205
             KIA+ +H +Y D   E  H     +F +DLF+T     K  +    +      A++ V
Sbjct: 282 DKKIAVHLHVFYVDLLAEFLHAFESFHFSYDLFITTDSEKKKNEILDILEGKQAKAEVLV 341

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L       +YDY+   H KKS+   Y    G  WR+ L   L+  +D
Sbjct: 342 TGNVGRDVLPMLKLKRH--LSQYDYIGHFHTKKSKEADYWA--GESWRKELINMLVHPAD 397

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA------GFP 317
              +I++   Q+  LG++ +    + R+ R       + +   +  L +R        F 
Sbjct: 398 ---QIVSQLGQDDRLGLVIADIPSFFRFNRIVVAWNEALISPEMNKLWERMNCQKEVDFK 454

Query: 318 TKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RY 375
                +  + GT  W K   L PL +L+L  E      L   ++ HA+ER        + 
Sbjct: 455 QMNTFVMSY-GTFVWFKYDALSPLFDLNLTEEDVPSEPLPQNSILHAIERLLVYIAWDKQ 513

Query: 376 TEFSIESV 383
            +F I   
Sbjct: 514 YDFKISYN 521


>gi|195977971|ref|YP_002123215.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
 gi|195974676|gb|ACG62202.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus equi
           subsp. zooepidemicus MGCS10565]
          Length = 581

 Score =  232 bits (592), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 72/286 (25%), Positives = 119/286 (41%), Gaps = 31/286 (10%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L    +++P S   S      KIA+ +H +Y D   E     
Sbjct: 256 MSQVHLP-DAKYLLAHKYL----SNQPISIAPS-----KKIAVHLHVFYADLLSEFLEAF 305

Query: 171 LRLNFDFDLFVTVVEANK--DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              +FD+DL +T     K  + ++ + +   SA + V  N GRDV P L L E     +Y
Sbjct: 306 SHFHFDYDLLITTDSKAKKAEIKEILRESGASADILVTGNIGRDVLPMLTLKER--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-- 286
           DY+   H KKS+   +    G  WR  L   ++  +D   +I+     +  +G++ +   
Sbjct: 364 DYIGHFHTKKSKEADFWA--GQSWRTELIDMMVKPAD---QILTALAAD-AIGIVIADIP 417

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLA------KRAGFPTKRLHLDFFNGTMFWVKPKCLEP 340
            + R+ +         +   +  L       KR  F T    +  + GT  W K   L+P
Sbjct: 418 SFFRFNKIVDAWNEHLIAPEMNQLWQAMGLTKRIDFQTMDTFVMSY-GTFVWFKYDALKP 476

Query: 341 LRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYTEFSIESVD 384
           L +L L         L   ++ HA+ER        R+ +F I   +
Sbjct: 477 LFDLGLNEADIPAEPLPQNSILHAIERLLIYIAWDRHYDFRISRNE 522


>gi|13476281|ref|NP_107851.1| hypothetical protein mlr7560 [Mesorhizobium loti MAFF303099]
 gi|14027042|dbj|BAB53996.1| mlr7560 [Mesorhizobium loti MAFF303099]
          Length = 637

 Score =  232 bits (592), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 63/250 (25%), Positives = 108/250 (43%), Gaps = 14/250 (5%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDV----LKYFPSAQLYV 205
           KIA+  H YY D   EI  +   +   +D   T    +K  E +          +  + V
Sbjct: 298 KIAVCAHIYYTDMLEEILALTGNIPVPYDFIATTDTPDKKAEIEATLAKRPGVKNVIVRV 357

Query: 206 ME-NKGRDVRP-FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
           +E N+GRD+   F+ L +L V DRYD +C++H KKS +         +++R +  +LL  
Sbjct: 358 VEKNRGRDMSSLFISLRDLLVDDRYDLVCRLHTKKSPQVQASR--SNLFKRHMLENLLNT 415

Query: 264 SDIAIRIINTFEQNPCLGM-IGSRRYRRYKR--WSFFAKRSEVYRRVIDLAKRAGFPTKR 320
                 +++ F  NP +G+ +    +  Y     ++F  R +V      L  +  F    
Sbjct: 416 RGYVHNVLDMFHDNPSVGLAVPPVVHISYPTMGHAWFFNRPKVEETARLLNIKVKFDHDT 475

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTEFS 379
               +  GTMFW +P+ L  +        +F  E N  DG L H +ER  A + +   ++
Sbjct: 476 PVAAY--GTMFWFRPRALRKMFEHKWKWEDFNAEPNHVDGGLAHVLERLIAYAAQDAGYT 533

Query: 380 IESVDCVAEY 389
              + C  + 
Sbjct: 534 TRHIMCAHQA 543


>gi|329116186|ref|ZP_08244903.1| rhamnan synthesis protein F [Streptococcus parauberis NCFD 2020]
 gi|326906591|gb|EGE53505.1| rhamnan synthesis protein F [Streptococcus parauberis NCFD 2020]
          Length = 589

 Score =  232 bits (591), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 73/269 (27%), Positives = 113/269 (42%), Gaps = 22/269 (8%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV- 184
            K L      +   P      I  K+AI +H +Y D   E        +FD+DLF+T   
Sbjct: 270 FKYLLANKYLKSDLP---SEVINKKVAIHLHTFYVDLLQEFLSAFENFHFDYDLFITTDI 326

Query: 185 EANKDFEQDVL-KYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG 243
           E  K   ++VL +    A+++V  N GRDV P L L E      YDY+   H KKS+   
Sbjct: 327 EEKKTQIENVLNENNQKAEVFVTGNIGRDVLPMLLLKEK--LSVYDYIGHFHTKKSKEAD 384

Query: 244 YHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRS 301
           +    G  WR+ L   L+  +D    I+ T E+N  +G++ +    Y RY +       +
Sbjct: 385 FWA--GESWRKELIKMLVLPAD---SILATLEKN-KVGIVIADMPTYFRYNKIVTAWNEN 438

Query: 302 EVYRRVIDLAKRAGFPTKRLH-----LDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNL 356
            +   + +L K+ G                 GT  W K   L+PL +L+L  E      L
Sbjct: 439 LIAPEMNELWKKMGLTKSIDFNHLHTFVMSYGTFVWFKYDALKPLFDLNLTVEDVPAEPL 498

Query: 357 KDGALEHAVERFFACSV--RYTEFSIESV 383
              ++ HA+ER        ++ +F I   
Sbjct: 499 PQNSILHAIERLLIYIAWNQHYDFRISKN 527


>gi|291520004|emb|CBK75225.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 984

 Score =  231 bits (589), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 98/236 (41%), Gaps = 14/236 (5%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE-ANKDFEQDVLKYFPSAQ---LY 204
             +A+ +H +Y D   E       + F FDL+++  E A+    +  +K    A    + 
Sbjct: 327 PSVAVHLHLFYVDLLPEFVSYFANIPFRFDLYISCQEGADVSVIKSGVKELKMANKVVIR 386

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
            + N+GRD+ P        +  ++DY   +H KKS   G    E   WR++    LLG  
Sbjct: 387 PLPNRGRDLAPLYVGFADEI-RQHDYFLHVHSKKSLYSG---AEKGGWRQFSLELLLGSP 442

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVYRRVIDLAKRAGFPTKRLHL 323
           +    I N F +N   G++    +      ++ +   + + R++ D              
Sbjct: 443 EKVNSIFNLF-KNKNAGLVYPDIHEEVPMIAYSWLANAGLGRKLFD---EFELGEMPTVF 498

Query: 324 DFFNGTMFWVKPKCLEPLRNLH-LIGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
           ++  G+ FW +   L P+ N + +  +F EE    DG L HA+ER      R   +
Sbjct: 499 NYPAGSFFWARTDALMPIFNRNYIYEDFPEEAGQTDGTLAHALERIIPFVSRKLGY 554


>gi|145588508|ref|YP_001155105.1| methyltransferase type 11 [Polynucleobacter necessarius subsp.
            asymbioticus QLW-P1DMWA-1]
 gi|145046914|gb|ABP33541.1| Methyltransferase type 11 [Polynucleobacter necessarius subsp.
            asymbioticus QLW-P1DMWA-1]
          Length = 1082

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 84/342 (24%), Positives = 149/342 (43%), Gaps = 28/342 (8%)

Query: 42   YVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE- 100
             + W  + +++  S  +    +  ++    WL +  + +K S     + +  F  +  E 
Sbjct: 759  MLSWDNTARRKNNSHIMANFSIRRYKQ---WLSNIASCTKNSIRLNENEKFIFINAWNEW 815

Query: 101  -QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYY 159
             +   L  +       +    +               P   +    + ++ IAIVVH +Y
Sbjct: 816  AEGTHLEPDTKYGFKYLQATYDILKN--------YINPEHAEIIRESQENSIAIVVHIHY 867

Query: 160  QDTWIEISHILLRL--NFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFL 217
             DTW +I  I+ ++    D D+++T+   N +  Q +   FPSA + ++EN+GRD+ PF+
Sbjct: 868  MDTWEDIKKIIKKILSVHDSDIYITIT--NLEQYQSIKNDFPSANIELVENRGRDILPFI 925

Query: 218  YLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQN 277
             +L+  +   Y  +CKIH KKS+       +G + R+ L+F L+       +I   FE N
Sbjct: 926  NVLKKIIHKNYVAICKIHSKKSEY----RSDGEVIRKELYFSLINNEITLEKIPKFFEVN 981

Query: 278  PCLGMIGSRRYRR-YKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPK 336
              LGM+   +Y   +   + +  R  + +    +    G   K     F  G+MFW +P 
Sbjct: 982  KKLGMLVPGKYFLQHNDINMYFNRENISK----VCSVIGVNFKESK--FPAGSMFWARPA 1035

Query: 337  CLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
             L+ L  L     F+ E  L DG + HAVER F      + F
Sbjct: 1036 ALQKLLKLESGELFDVEEGLADGTVAHAVERLFGLVSESSGF 1077


>gi|289678438|ref|ZP_06499328.1| glycosyl transferase, group 1 [Pseudomonas syringae pv. syringae
           FF5]
          Length = 774

 Score =  230 bits (586), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 94/241 (39%), Gaps = 11/241 (4%)

Query: 144 GLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL----KYFP 199
               +  +A+ +H +Y+D   + SH L       D+F+T+ +A    +   +        
Sbjct: 260 PEAARLNVAVCLHIFYEDYIEKFSHALANFPTQVDVFITLADAKHQKKTIAVFSKHPRVK 319

Query: 200 SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
           + ++  + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   
Sbjct: 320 NLKVRCVPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEY 375

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           LL  ++I  R++N F  +  LG+     +     W      ++ +               
Sbjct: 376 LLRDANIITRLLNAFADHKDLGLYYPTTFWMMPSWVNHVTMNKSFMAAWH--NEWQIDPC 433

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEF 378
              L +  G MFW +P+ L+ +       + F +E    DG++ HA+ER          +
Sbjct: 434 DGFLSYPAGGMFWARPEALKDMLEKEYDYDFFPQEPLPNDGSMLHALERVIGLLAEKNGY 493

Query: 379 S 379
            
Sbjct: 494 K 494


>gi|269219069|ref|ZP_06162923.1| glycosyl transferase, group 2 family [Actinomyces sp. oral taxon
           848 str. F0332]
 gi|269211216|gb|EEZ77556.1| glycosyl transferase, group 2 family [Actinomyces sp. oral taxon
           848 str. F0332]
          Length = 687

 Score =  230 bits (586), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 70/253 (27%), Positives = 111/253 (43%), Gaps = 9/253 (3%)

Query: 132 GWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE 191
           G+ D+     +  +   S+IA+V+HC+Y D   E+   L  L  DFDLFVT         
Sbjct: 58  GFPDKWRIDPQFDIADPSRIAVVIHCFYADLMPELFDRLRNLPTDFDLFVTNASGADVAV 117

Query: 192 QDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP---IE 248
              L+    + +  +EN GRD+ P + L+  G+ D YD + K+H KKS     H      
Sbjct: 118 PKDLERMRHSVVVEVENHGRDIFPTVQLVNSGILDPYDLILKLHTKKSPWREEHADLDGS 177

Query: 249 GIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVI 308
           G  W+     DL+G  +    I+N F  +P LG++ +      K   F+     +  +  
Sbjct: 178 GAAWKDQFLSDLVGSREKVEEILNAFAADPTLGLVTAADSIVGKE--FWGGDQRIVEQ-- 233

Query: 309 DLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVER 367
            L  R         L+F +G+M+W +   L+ LR  +L   +F+EE+   D    HA+ER
Sbjct: 234 -LMLRIEMSIDPDELEFASGSMYWTRAFVLQGLRAFNLTSADFDEEKGQVDATTAHAIER 292

Query: 368 FFACSVRYTEFSI 380
                        
Sbjct: 293 IVGIVTDEAGLRT 305


>gi|322373386|ref|ZP_08047922.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus sp.
           C150]
 gi|321278428|gb|EFX55497.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus sp.
           C150]
          Length = 594

 Score =  229 bits (584), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 66/249 (26%), Positives = 103/249 (41%), Gaps = 20/249 (8%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL--KYFPSAQLYVM 206
            KIA+ +H YY D   +        +F +DLF+T     K  E   +  K+   A++++ 
Sbjct: 287 KKIAVHLHTYYVDLLDDFLRQFENFHFTYDLFLTTDSEEKKKEIQSILDKHGKEARIFIT 346

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRDV P L L +      YDY+   H KKS    Y    G  WR  LF  L+  +D 
Sbjct: 347 GNRGRDVIPMLKLKDE--LSAYDYIGHFHTKKSPEYPYWV--GDSWRNELFSMLIQPAD- 401

Query: 267 AIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA------GFPT 318
              II   E +  LG++ +    + RY +       +     + DL +R        F  
Sbjct: 402 --NIIANLEHDDRLGLVIADIPTFFRYTKIVDPWNENRFAEGMNDLWERMDLGRDIDFDK 459

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFAC--SVRYT 376
               +  + GT  W K   L+PL +L L  E      +    + H++ER        R  
Sbjct: 460 MNTFIMSY-GTFIWFKYDTLKPLFDLDLQDEEIPAEPIPQHTILHSIERILVYLAWARRY 518

Query: 377 EFSIESVDC 385
           +++I   D 
Sbjct: 519 DYAIAKNDI 527


>gi|157151529|ref|YP_001450315.1| rhamnosyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
 gi|157076323|gb|ABV11006.1| rhamnosyltransferase [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 582

 Score =  229 bits (584), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 65/248 (26%), Positives = 104/248 (41%), Gaps = 20/248 (8%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS--AQLYV 205
             KIA+ +H +Y D   E  H     +F +DLF+T     K  E   +       A+++V
Sbjct: 282 DKKIAVHLHVFYVDLLAEFLHAFESFHFSYDLFITTDSEKKKNEILGILEGKQAKAEVFV 341

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
             N GRDV P L L       +YDY+   H KKS+   Y    G  WR+ L   L+  +D
Sbjct: 342 TGNVGRDVLPMLKLKRH--LSQYDYIGHFHTKKSKEADYWA--GESWRKELINMLVHPAD 397

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA------GFP 317
              +I++   Q+ CLG++ +    + R+ R       + +   +  L +R        F 
Sbjct: 398 ---QIVSQLGQDDCLGLVIADIPSFFRFNRIVVAWNEALISPEMNKLWERMNCQKEVDFK 454

Query: 318 TKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RY 375
                +  + GT  W K   L PL +L++  E      L   ++ HA+ER        + 
Sbjct: 455 QMNTFVMSY-GTFVWFKYDALSPLFDLNMTEEDVPSEPLPQNSILHAIERLLVYIAWDKQ 513

Query: 376 TEFSIESV 383
            +F I   
Sbjct: 514 YDFKISYN 521


>gi|320095829|ref|ZP_08027469.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 178 str.
           F0338]
 gi|319977239|gb|EFW08942.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 178 str.
           F0338]
          Length = 619

 Score =  228 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 64/256 (25%), Positives = 105/256 (41%), Gaps = 12/256 (4%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDV 194
            ++P+        ++  + H +Y D   EI   L  L   + L  T  +  +    E+ +
Sbjct: 285 SAAPEAREKAASLRVVAIAHIFYADMADEIIDRLSVLPDGWRLVATTADEERKAAIEETM 344

Query: 195 LKYFPSAQLYVM-ENKGRDVRPFLYLLELGVF-DRYDYLCKIHGKKSQREGYHPIEGIIW 252
            +     Q+ V+  N+GRD+  FL      +  D YD + KIH KKS ++  +     ++
Sbjct: 345 ARRGAVGQVRVVASNRGRDISAFLVDCSDVLAGDDYDVVVKIHSKKSVQDEANAA--QLF 402

Query: 253 RRWLFFDLLGFSDIAIRIINTFEQNPCLGM-IGSRRYRRYKRWSFFAKRSEVYRRVIDLA 311
           +  L+ +LL   D    I+  F  +P LGM +    +  Y                 +LA
Sbjct: 403 KDHLYENLLDSKDHVANILAEFADHPGLGMALAPMPHMGYPTMGHA--WFANRPPARELA 460

Query: 312 KRAGF--PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERF 368
           KR G   P          G+MF  +P+ L PL    L   +F  E   +DG+L H +ER 
Sbjct: 461 KRIGITVPFDDHQPLAPYGSMFIARPRALRPLVEAGLTHDDFPPEGGYQDGSLAHVIERL 520

Query: 369 FACSVRYTEFSIESVD 384
            A +V    +    V 
Sbjct: 521 LAYAVLSEGYYARPVM 536


>gi|259414984|ref|ZP_05738907.1| glycosyl transferase, group 1 [Silicibacter sp. TrichCH4B]
 gi|259349435|gb|EEW61182.1| glycosyl transferase, group 1 [Silicibacter sp. TrichCH4B]
          Length = 680

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 73/259 (28%), Positives = 118/259 (45%), Gaps = 13/259 (5%)

Query: 132 GWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE---ANK 188
             +    +P +     ++  A+V+H YY D W E    L    F FDL+VT+ E     +
Sbjct: 55  AESGSAVAPLRGAGINQNLQAVVIHLYYTDLWDEFRDRLRSARFTFDLYVTLTEQGPETE 114

Query: 189 DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIE 248
           +    + + +P A++ V+ N+GRD+ PFL+LL  G  D Y  +CK+H KKS     H  +
Sbjct: 115 ETRARIAEDWPEARVLVLPNRGRDIYPFLHLLNAGWLDHYRAVCKLHSKKSP----HRQD 170

Query: 249 GIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVI 308
           G +WR  L   +L   + A  ++  F      G+  +   + Y+   ++        R  
Sbjct: 171 GDVWRTHLTEGILPEGETAE-LLERFLAAEDCGLWVADG-QHYEGARWWGSN---LERCR 225

Query: 309 DLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER 367
           +L  R         LDF  G+++W+KP  L+ LR L L   +F+ E+   DG L HA+ER
Sbjct: 226 NLLARLELAASADTLDFPAGSIYWLKPAILDMLRGLALGFDDFDIEQGQTDGTLAHALER 285

Query: 368 FFACSVRYTEFSIESVDCV 386
                       I     +
Sbjct: 286 ALGMICAAGGLQILQTTQL 304


>gi|148927812|ref|ZP_01811237.1| Lipopolysaccharide biosynthesis protein-like protein [candidate
           division TM7 genomosp. GTL1]
 gi|147886838|gb|EDK72383.1| Lipopolysaccharide biosynthesis protein-like protein [candidate
           division TM7 genomosp. GTL1]
          Length = 498

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 70/241 (29%), Positives = 111/241 (46%), Gaps = 9/241 (3%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVME 207
           ++A+VVH +Y +   EI  ++  +   FDL +T        +          S  + + E
Sbjct: 240 RLAVVVHIFYPELANEIYDVIKNIVEPFDLIITTPHEGAVSELIDTFAPLASSVAIALSE 299

Query: 208 NKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA 267
           N+GRDV PFL +   G+ +RYD + K+H KKS         G  W++ LF  L G S I 
Sbjct: 300 NRGRDVGPFLAVHRSGLLERYDAVLKLHSKKSTYSD----SGQQWQQSLFRQLCGNSQIV 355

Query: 268 IRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN 327
            R +    ++   GM+G   Y       + A R  V++ +  L        + + L FF 
Sbjct: 356 RRSVALL-RDGKTGMVGPHDYYLTHPHYWGANRPAVHKLLQSLTAT-PLKEEDVPLRFFA 413

Query: 328 GTMFWVKPKCLEPLRNL-HLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCV 386
           GTMFW  PK +  L ++   +  FE E   +DG L HA+ER F    +   +++ S+   
Sbjct: 414 GTMFWFAPKAIVALHDIPEALLNFESENGKQDGTLAHALERLFGIVPQLGGYNVTSLALA 473

Query: 387 A 387
            
Sbjct: 474 G 474


>gi|330899783|gb|EGH31202.1| hypothetical protein PSYJA_20361 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 626

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 94/241 (39%), Gaps = 11/241 (4%)

Query: 144 GLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL----KYFP 199
               +  +A+ +H +Y+D   + SH L       D+F+T+ +A    +   +        
Sbjct: 112 PEAARLNVAVCLHIFYEDYIEKFSHALANFPTQVDVFITLADAKHQKKTIAVFSKHPRVK 171

Query: 200 SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
           + ++  + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   
Sbjct: 172 NLKVRCVPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEY 227

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           LL  ++I  R++N F  +  LG+     +     W      ++ +               
Sbjct: 228 LLRDANIITRLLNAFADHKDLGLYYPTTFWMMPSWVNHVTMNKSFMAAWH--NEWQIAPC 285

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEF 378
              L +  G MFW +P+ L+ +       + F +E    DG++ HA+ER          +
Sbjct: 286 DGFLSYPAGGMFWARPEALKDMLEKEYDYDFFPQEPLPNDGSMLHALERVIGLLAEKNGY 345

Query: 379 S 379
            
Sbjct: 346 K 346


>gi|322385732|ref|ZP_08059376.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           cristatus ATCC 51100]
 gi|321270470|gb|EFX53386.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           cristatus ATCC 51100]
          Length = 598

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 104/248 (41%), Gaps = 18/248 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--VLKYFPSAQLYVM 206
            KIA+ +H YY D   +        +F +DLF+T     K  E +  +LK     ++Y+ 
Sbjct: 287 KKIAVHLHTYYVDLLEDFLKQFENFHFTYDLFLTTDSEKKKLEIEAVLLKRNQLGKIYIT 346

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            NKGRD+ P L L E      YDY+   H KKS    Y    G  WR  LF  LL  +D+
Sbjct: 347 GNKGRDIIPMLKLREE--LCTYDYIGHFHTKKSPEYPYWV--GDSWRNELFDMLLKPADL 402

Query: 267 AIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFP-----TK 319
              I+ + E +  LG++ +    + RY +       ++    +  L +R          K
Sbjct: 403 ---IMASLENDKRLGLVIADIPTFFRYTKIVDPWNENKFADDMNILWERMDINRSIDFNK 459

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RYTE 377
                   GT  W K   L+PL +L+L  E      L    + H++ER        +  +
Sbjct: 460 LNTFIMSYGTFIWFKYDALKPLFDLNLQDEDIPSEPLPQHTILHSIERILVYLAWSQRFD 519

Query: 378 FSIESVDC 385
           ++I   D 
Sbjct: 520 YAISKNDI 527


>gi|222152862|ref|YP_002562039.1| rhamnan synthesis protein F family protein [Streptococcus uberis
           0140J]
 gi|222113675|emb|CAR41606.1| rhamnan synthesis protein F family protein [Streptococcus uberis
           0140J]
          Length = 585

 Score =  226 bits (577), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 67/248 (27%), Positives = 107/248 (43%), Gaps = 19/248 (7%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE-QDVLKYFP-SAQLY 204
            +  IA+ +H +Y D   E  H      F FDL++T  ++ K+ E + +L  F  SA++ 
Sbjct: 284 SEHSIAVHLHVFYVDLLEEFLHAFTSFKFPFDLYITTDKSEKESEIKAILDSFRVSAKIV 343

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
           V  N GRDV P L L +     +YDY+   H KKS+   +    G  WR  L   L+  +
Sbjct: 344 VTGNIGRDVLPMLKLKDE--LSQYDYIGHFHTKKSKEADFWA--GESWRNELIDMLIKPA 399

Query: 265 DIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLH 322
           +    IIN FE +P +G+I +    + R+ +         +   +  L ++         
Sbjct: 400 NT---IINQFE-DPAIGIIIADIPSFFRFNKIVTPLNEHLIAPEMNKLWEKMNLSKTIDF 455

Query: 323 LDF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSV--RY 375
             F       GT  W K   L+PL +L+L      +  L   ++ HAVER         +
Sbjct: 456 EQFDTFVMSYGTFVWFKYDALKPLFDLNLKDGDVPKEPLPQNSILHAVERLLIYIAWDSH 515

Query: 376 TEFSIESV 383
            +F I   
Sbjct: 516 FDFRIAKN 523


>gi|32455988|ref|NP_861990.1| rb115 [Ruegeria sp. PR1b]
 gi|22726340|gb|AAN05136.1| RB115 [Ruegeria sp. PR1b]
          Length = 963

 Score =  225 bits (575), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 70/302 (23%), Positives = 121/302 (40%), Gaps = 27/302 (8%)

Query: 107 LNRF-MSNSRMPFDSEKFLYVK--ELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTW 163
           L RF  +  R P ++    Y     +    +DR           K ++ + +H YY D  
Sbjct: 116 LRRFGCARQRGPLETTPVEYGPVRHVLRFESDR------QPPLPKGRLVVQLHLYYVDMA 169

Query: 164 IEISHILLRLNFDFDLFVTVVEANKDFEQDVL-------KYFPSAQLYVMENKGRDVRPF 216
            E+  +L RL   F+L +++ E     +++++       +   +  L  + N+GRDV P+
Sbjct: 170 AEMIALLARLPVTFELLLSLPETAVVADEEMISLFRAGLERLGAITLRRVPNRGRDVAPW 229

Query: 217 LYLLELGV--FDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTF 274
           +      +      D +  +H KKS    YH      W R+L   LLG + +A +++  F
Sbjct: 230 MVSFRSELRALADRDLVLHLHSKKSPHGNYHVG----WGRYLGHSLLGSTAVAAQMLGLF 285

Query: 275 EQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF-PTKRLHLDFFNGTMFWV 333
            ++P LG++    +   +R   + K  ++      L +R G      +  DF  G+ F  
Sbjct: 286 AEDPELGLVAPAYWPALRRAPNYGKVGDLC---AHLFRRMGLGEVDPICADFPAGSFFCA 342

Query: 334 KPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERL 392
           +   L P   L L   +F  E     G L HAVER             + V     +E  
Sbjct: 343 RAAVLRPFLTLGLEARDFPAEAGQICGTLAHAVERLLGQVPARLGLRFDMVAVDLPFEEA 402

Query: 393 LH 394
            H
Sbjct: 403 AH 404


>gi|227497960|ref|ZP_03928140.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
 gi|226832618|gb|EEH65001.1| conserved hypothetical protein [Actinomyces urogenitalis DSM 15434]
          Length = 626

 Score =  225 bits (574), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 54/241 (22%), Positives = 100/241 (41%), Gaps = 11/241 (4%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFP-SAQL 203
             +SKIA+V+H Y+ D   ++ H    +    DL  TV    K    ++       + + 
Sbjct: 304 PEESKIALVMHVYHMDLLPQLLHYAASMPAGCDLIATVDTEAKAQQVREATAGLSLNVET 363

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
            ++EN+GRDV   L      + D YD +C IH KK  +     + G  + +  F ++L  
Sbjct: 364 ILIENRGRDVAALLVGARPRLLD-YDLVCFIHDKKVTQIRPGSV-GEGFAKRCFENVLAT 421

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF----FAKRSEVYRRVI-DLAKRAGFPT 318
            +    +I TF+  P LG++          +      +    +  + ++      A    
Sbjct: 422 PEFVCNVIATFQAEPRLGVLTPSAPHHGDYFPISAFSWGPNDKNTKELLASFGLHAPIDP 481

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTE 377
            +  +  F G++FW +P+ + PL        +F  E    DG + HA+ER +    +   
Sbjct: 482 DKEAIAPF-GSVFWFRPQAIRPLLERKWRYDDFPAEPLPIDGTISHAIERVYCYMAQARG 540

Query: 378 F 378
           +
Sbjct: 541 Y 541


>gi|306831662|ref|ZP_07464819.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325978600|ref|YP_004288316.1| rhamnosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|304426087|gb|EFM29202.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           gallolyticus subsp. gallolyticus TX20005]
 gi|325178528|emb|CBZ48572.1| rhamnosyltransferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 586

 Score =  225 bits (574), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 64/248 (25%), Positives = 103/248 (41%), Gaps = 18/248 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--VLKYFPSAQLYVM 206
            K+A+ +H +Y D   E  +     +FD+DLF+T     K  E +  + K    AQ+++ 
Sbjct: 287 KKVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIESILEKNGKIAQVFLT 346

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L E      YDY+   H KKS    Y    G  WR  L+  L+  +D 
Sbjct: 347 GNRGRDIIPMLKLKEE--LSSYDYIGHFHTKKSPEYPYWV--GDSWRNELYQMLIQSAD- 401

Query: 267 AIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGF--PTKRLH 322
              I+   E N  LG++ +    + RY +       +     + +L +R          +
Sbjct: 402 --NILANLENNDNLGLVIADIPSFFRYTKIVDPWNENRFADGMNELWERMNLERQIDFNN 459

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTE-- 377
           L  F    GT  W K   L+PL +L L  +      +    + H++ER            
Sbjct: 460 LSTFIMSYGTFIWFKRDTLKPLFDLELTDDEIPSEPIPQHTILHSIERILVYLAWANNYD 519

Query: 378 FSIESVDC 385
           ++I   D 
Sbjct: 520 YAIAKNDI 527


>gi|320330331|gb|EFW86314.1| hypothetical protein PsgRace4_09215 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 774

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 92/241 (38%), Gaps = 11/241 (4%)

Query: 144 GLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL----KYFP 199
               +  +AI +H +Y+D   + SH L       D+F+T+   N   +            
Sbjct: 260 PEAARLNVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNHKKKTIATFGQHPRVK 319

Query: 200 SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
           + ++  + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   
Sbjct: 320 NLKVSCVPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEY 375

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           LL  ++I  R++N F  +  LG+     +     W      ++ +               
Sbjct: 376 LLRDANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVTMNKAFMNAWH--NEWQIDPC 433

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEF 378
              L +  G MFW +P+ L+ +       + F +E    DG++ HA+ER          +
Sbjct: 434 EGFLSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIGLLAEKNGY 493

Query: 379 S 379
            
Sbjct: 494 K 494


>gi|288905572|ref|YP_003430794.1| polysaccharide biosynthesis protein (RgpF) [Streptococcus
           gallolyticus UCN34]
 gi|288732298|emb|CBI13867.1| Putative polysaccharide biosynthesis protein (RgpF) [Streptococcus
           gallolyticus UCN34]
          Length = 586

 Score =  224 bits (572), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 62/249 (24%), Positives = 103/249 (41%), Gaps = 20/249 (8%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--VLKYFPSAQLYVM 206
            K+A+ +H +Y D   E  +     +FD+DLF+T     K  E +  + K    AQ+++ 
Sbjct: 287 KKVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIESILEKNGKIAQVFLT 346

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L E      YDY+   H KKS    Y    G  WR  L+  L+  +D 
Sbjct: 347 GNRGRDIIPMLKLKEE--LSSYDYIGHFHTKKSPEYPYWV--GDSWRNELYQMLIQSAD- 401

Query: 267 AIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRS------EVYRRVIDLAKRAGFPT 318
              I+   E N  LG++ +    + RY +       +            ++L ++  F  
Sbjct: 402 --NILANLENNDNLGLVIADIPSFFRYTKIVDPWNENRFADGMNELWECMNLERQIDFNN 459

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTE- 377
               +  + GT  W K   L+PL +L L  +      +    + H++ER           
Sbjct: 460 LSTFIMSY-GTFIWFKRDTLKPLFDLELTDDEIPSEPIPQHTILHSIERILVYLAWANNY 518

Query: 378 -FSIESVDC 385
            ++I   D 
Sbjct: 519 DYAIAKNDI 527


>gi|260434430|ref|ZP_05788400.1| glycosyltransferase [Synechococcus sp. WH 8109]
 gi|260412304|gb|EEX05600.1| glycosyltransferase [Synechococcus sp. WH 8109]
          Length = 772

 Score =  224 bits (572), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 58/256 (22%), Positives = 104/256 (40%), Gaps = 20/256 (7%)

Query: 133 WNDRPSSPKKSGL-TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFE 191
           WN +   P +  L  I  K+ + +H +Y +   EI   +       +++++    N+   
Sbjct: 517 WNTKLIIPTEDVLMNIDEKVGLHIHVHYPELLDEILKAISMNKIRPEIYISCT--NQAIR 574

Query: 192 QDVLKYFPS-----AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP 246
              +K          ++ +  N+GRD+ P L  L   + ++Y     IH KKS     H 
Sbjct: 575 DLAIKNINEHGLILKKIILTPNRGRDIGPLLTCLGQELDEKYRIYGHIHTKKSIHIARH- 633

Query: 247 IEGIIWRRWLFFDLLGFSDIAIR--IINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVY 304
            +   WR +L  +L+G  +  +   II+   ++  +G+                     Y
Sbjct: 634 -QSYSWRTFLIENLIGNEENHMMDCIISAMIKDKTIGLAFPSDP-------HCPGWDANY 685

Query: 305 RRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEH 363
           R+   LA++    +     +F  GTMFW +   L PL +L+L   ++  E    DG L H
Sbjct: 686 RQAKLLAEKLNIKSLTNEFNFPIGTMFWARKNALSPLYSLNLGWDDYPSEPIGYDGTLLH 745

Query: 364 AVERFFACSVRYTEFS 379
           ++ER          FS
Sbjct: 746 SIERLIPFVAESQGFS 761


>gi|325276923|ref|ZP_08142610.1| hypothetical protein G1E_25356 [Pseudomonas sp. TJI-51]
 gi|324097938|gb|EGB96097.1| hypothetical protein G1E_25356 [Pseudomonas sp. TJI-51]
          Length = 758

 Score =  224 bits (572), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 93/242 (38%), Gaps = 11/242 (4%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQ----DVLKYF 198
           +      KIAI +H YY D     +  L     + DL +T+   +           ++  
Sbjct: 243 TPKASNQKIAICLHIYYDDYIERFAEALYTFPTEVDLLITIANESFRDRAYQTFSKIQAV 302

Query: 199 PSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFF 258
               +  + N+GR+  P L      +   YD LC +H KKS   G    E   W  +L  
Sbjct: 303 KKVTIKSVPNRGRNFGPLLVEFAQELL-TYDLLCHLHSKKSLYSGR---EQTQWADYLSE 358

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT 318
            LL    +  R++N F  NP  G+     +     W      ++ + R  +L    GF  
Sbjct: 359 YLLNDCSVVKRVLNAFSDNPQFGVYYPTTFWMMPSWVNHVTMNKPHMR--NLQTALGFGH 416

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNL-HLIGEFEEERNLKDGALEHAVERFFACSVRYTE 377
               L +  G MFW +PK L  + N  +   +F  E    DG++ HA+ER          
Sbjct: 417 FDDFLSYPAGGMFWARPKALVDILNKTYTYDDFPNEPLPNDGSMLHALERVIGPVCEKNG 476

Query: 378 FS 379
           + 
Sbjct: 477 YQ 478


>gi|306833804|ref|ZP_07466929.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus bovis
           ATCC 700338]
 gi|304423998|gb|EFM27139.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus bovis
           ATCC 700338]
          Length = 586

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 63/248 (25%), Positives = 104/248 (41%), Gaps = 18/248 (7%)

Query: 149 SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD--VLKYFPSAQLYVM 206
            K+A+ +H +Y D   E  +     +FD+DLF+T     K  E +  + K   +AQ+++ 
Sbjct: 287 KKVAVHLHTFYVDLLEEFLNQFENFHFDYDLFLTTDTEAKKAEIESILEKNGKTAQVFLT 346

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            N+GRD+ P L L E      YDY+   H KKS    Y    G  WR  L+  L+  +D 
Sbjct: 347 GNRGRDIIPMLKLKEE--LSSYDYIGHFHTKKSPEYPYWV--GDSWRNELYQMLIQSAD- 401

Query: 267 AIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRAGF--PTKRLH 322
              ++   E N  LG++ +    + RY +       +     + +L +R          +
Sbjct: 402 --NVLANLENNDNLGLVIADIPSFFRYTKIVDPWNENRFADGMNELWERMNLGRQIDFNN 459

Query: 323 LDFF---NGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTE-- 377
           L  F    GT  W K   L+PL +L L  +      +    + H++ER            
Sbjct: 460 LSTFIMSYGTFIWFKHDTLKPLFDLELTDDEIPSEPIPQHTILHSIERILVYLAWANNYD 519

Query: 378 FSIESVDC 385
           ++I   D 
Sbjct: 520 YAIAKNDI 527


>gi|160936495|ref|ZP_02083863.1| hypothetical protein CLOBOL_01386 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440580|gb|EDP18318.1| hypothetical protein CLOBOL_01386 [Clostridium bolteae ATCC
           BAA-613]
          Length = 674

 Score =  224 bits (570), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 64/249 (25%), Positives = 101/249 (40%), Gaps = 13/249 (5%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYF-----PSAQ 202
             KIA+V H +Y D   E    L  +  + DL++TV  AN + +  V  YF      + +
Sbjct: 290 NKKIAVVAHLFYPDLMDETLRYLQNIQENIDLYITV--ANIETKYKVYNYFESIRRSNVK 347

Query: 203 LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
           + +  N+GRD    L      +  +Y+YLC +H KK+ R G     G  +    + + L 
Sbjct: 348 VLLSGNRGRDAGSLLVACREYLM-QYEYLCFVHDKKTTRGGGPVTVGKAFMYHAWENTLR 406

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKR--SEVYRRVIDLAK--RAGFPT 318
                  II  FE+N  LG++           +       +  Y++  +LA+      P 
Sbjct: 407 SGGFVSSIIKLFEKNDRLGILTPPVPALGGYLTELVGNEWTCCYQKTKELAEILSLKVPM 466

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTE 377
                 F   T FW +P  L+PL        +F EE    DG L HA+ER      +   
Sbjct: 467 SPQKQPFALATAFWCRPAALKPLFEYPWRYEDFPEEPLASDGTLNHAIERIIIYVAQSEG 526

Query: 378 FSIESVDCV 386
           +    V+  
Sbjct: 527 YYTAMVESA 535


>gi|330882679|gb|EGH16828.1| hypothetical protein Pgy4_27710 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 608

 Score =  224 bits (570), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 52/241 (21%), Positives = 92/241 (38%), Gaps = 11/241 (4%)

Query: 144 GLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL----KYFP 199
               +  +AI +H +Y+D   + SH L       D+F+T+   N   +            
Sbjct: 94  PEAARLNVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNHKKKTIATFGQHPRVK 153

Query: 200 SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
           + ++  + N+GR+  P L      +   YD  C +H KKS   G    E   W  +L   
Sbjct: 154 NLKVSCVPNRGRNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEY 209

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           LL  ++I  R++N F  +  LG+     +     W      ++ +               
Sbjct: 210 LLRDANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVTMNKAFMNAWH--NEWQIDPC 267

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEF 378
              L +  G MFW +P+ L+ +       + F +E    DG++ HA+ER          +
Sbjct: 268 EGFLSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIGLLAEKNGY 327

Query: 379 S 379
            
Sbjct: 328 K 328


>gi|83950907|ref|ZP_00959640.1| hypothetical protein ISM_07395 [Roseovarius nubinhibens ISM]
 gi|83838806|gb|EAP78102.1| hypothetical protein ISM_07395 [Roseovarius nubinhibens ISM]
          Length = 752

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 79/305 (25%), Positives = 123/305 (40%), Gaps = 23/305 (7%)

Query: 104 FLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDR------PSSPKK----SGLTIKSKIAI 153
           +LRLN  ++ S +P         +        R      PS P           K++ A+
Sbjct: 76  YLRLNPDVAGSGIPPLMHYLTSGQGEGRSGQPRYATRPLPSCPLPRLRFDPGRPKARFAL 135

Query: 154 VVHCYYQDTWIEISHILLRLNFDFDLFVTVV---EANKDFEQDVLKYFPSAQLYVMENKG 210
             H YY D W E +     +    DL++T+    E  +    ++ + FP A +  + N+G
Sbjct: 136 HAHIYYPDLWPEFATRFDEIGDGIDLYITLTWRGEETRWLADEITERFPRAFVTPVPNRG 195

Query: 211 RDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRI 270
           RD+ PFL L   G FD YD LCKIH KKS     H  +G  WRR L   +L  + +  R+
Sbjct: 196 RDILPFLLLANAGAFDGYDALCKIHTKKSP----HRDDGDQWRRHLIDGVLPATGLQERL 251

Query: 271 INTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTM 330
            +    +     +   +    + W  +    +   +   + +R         L F  G++
Sbjct: 252 QHFLADDAAAFWVADGQAYAARDW--WGINRD---KTAAVLRRVELDPLLDALRFPAGSI 306

Query: 331 FWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEY 389
           +W+KP  L  ++ L L    FE E+   DG L HAVER            I     +   
Sbjct: 307 YWMKPLMLGMIKALDLDAPMFEPEKGQVDGTLAHAVERAIGGLALAAGQEIRETAALMRP 366

Query: 390 ERLLH 394
            R  H
Sbjct: 367 RRAGH 371


>gi|261367011|ref|ZP_05979894.1| putative polysaccharide biosynthesis protein [Subdoligranulum
           variabile DSM 15176]
 gi|282571129|gb|EFB76664.1| putative polysaccharide biosynthesis protein [Subdoligranulum
           variabile DSM 15176]
          Length = 646

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 56/253 (22%), Positives = 100/253 (39%), Gaps = 11/253 (4%)

Query: 141 KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVL--KY 197
           +   L  + +IA+ +H Y+ D   +      +     D+FV+   E  K+  +     + 
Sbjct: 300 QAEELCAQRRIALAMHLYFMDMLEQSVAFAAKFPPQTDVFVSTNSEEKKEQIEQAFSGQK 359

Query: 198 FPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLF 257
             S  + V+EN+GRDV  FL  L       YDY C +H KK+ +     + G  +     
Sbjct: 360 LHSVTVMVVENRGRDVGAFLCDLAPH-LRNYDYACFMHDKKAIQTKPGSV-GASFGYVCN 417

Query: 258 FDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFF--AKRSEVYRRVIDLAKRAG 315
            ++   +   + ++  FE +P LG++          +           +     L K  G
Sbjct: 418 ENVCKNAAHVLNVLCEFENDPYLGILCPPYPTHGLYFMNMCSGGWGPNFENTKKLLKELG 477

Query: 316 FPTKRLHLDFFN---GTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFAC 371
                   +      G++FW +PK LEPL        +F +E   +DG + HA+ER +  
Sbjct: 478 LDVPISGEESPIAPFGSVFWFRPKALEPLFAHGWQHTDFPQEPLPQDGTISHAIERVYPF 537

Query: 372 SVRYTEFSIESVD 384
             +   +    V 
Sbjct: 538 VAQAAGYYPAVVM 550


>gi|78184210|ref|YP_376645.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
 gi|78168504|gb|ABB25601.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
          Length = 1161

 Score =  223 bits (568), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 51/236 (21%), Positives = 90/236 (38%), Gaps = 16/236 (6%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFP---SAQLY 204
           + K  + +H +Y +    I+  + ++    D+ ++          ++ K      + Q+ 
Sbjct: 200 QKKFGVFLHIFYPELAPIIADYIRKIPVKIDIHISTTHDAISGLTEIFKGLENSLNVQVK 259

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
              N GRDV PF+      +  +YDY+ K+H KKS            W      +L+G  
Sbjct: 260 SFPNIGRDVAPFIVGFREEI-PKYDYILKLHSKKSPHSNALSG----WFEHCLDNLIGSI 314

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYR----RYKRWSFFAKRSEVYRRVIDLAKRAGFPT-- 318
           D+    I    +   + ++            K  S +      Y +   L K+ G     
Sbjct: 315 DVFYTNIQELNKED-ISIVYPVENYALSLGIKHDSCWGHEDGNYNKAKTLLKKLGLEQIN 373

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSV 373
           +     F  G MFW KP  L+P+ +  L   +F+ E    DG L H++ER      
Sbjct: 374 RNSEFLFPTGNMFWCKPDILKPILDWDLKFEDFDNEGGQIDGTLAHSIERLIGLCC 429


>gi|15674835|ref|NP_269009.1| hypothetical protein SPy_0792 [Streptococcus pyogenes M1 GAS]
 gi|71910421|ref|YP_281971.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS5005]
 gi|13621968|gb|AAK33730.1| conserved hypothetical protein - possibly involved in cell wall
           localization and side chain formation of
           rhamnose-glucose polysaccharide [Streptococcus pyogenes
           M1 GAS]
 gi|71853203|gb|AAZ51226.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS5005]
          Length = 581

 Score =  222 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 61/272 (22%), Positives = 111/272 (40%), Gaps = 27/272 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DTKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 ENWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQ-NPCLGMIGSRR 287
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE  +  + +     
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETDDIGIIIADIPS 418

Query: 288 YRRYKRWSFFAKRSEVYRRVIDLAKRA------GFPTKRLHLDFFNGTMFWVKPKCLEPL 341
           + R+ +         + + ++ L ++        F      +  + GT  W K   L+ L
Sbjct: 419 FFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSL 477

Query: 342 RNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
            +L L         L   ++ HA+ER      
Sbjct: 478 FDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|33862360|ref|NP_893920.1| glycosyltransferase [Prochlorococcus marinus str. MIT 9313]
 gi|33640473|emb|CAE20262.1| glycosyltransferase [Prochlorococcus marinus str. MIT 9313]
          Length = 738

 Score =  222 bits (567), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 70/267 (26%), Positives = 111/267 (41%), Gaps = 19/267 (7%)

Query: 123 FLYVKE-LFEGWNDRPSSPKKSGLTIK---SKIAIVVHCYYQDTWIEISHILLRLNFDFD 178
             Y+KE   +G  + P     S L  +   + IA+ VH +Y +    I + L       D
Sbjct: 470 IHYLKENQPKGEWNVPMITPASSLQQQDSETTIALHVHVHYPELLDTILNALNYNKIRPD 529

Query: 179 LFVTVVEANKDFEQDVLKYFPSAQ---LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIH 235
           LF++        E        +     +    N+GRD+ P L  +   +  +Y+    +H
Sbjct: 530 LFLSCTNHENHSEIQCKSAGANCTLKSIITTPNRGRDIGPLLTEIGKELDTKYEIYGHLH 589

Query: 236 GKKSQREGYHPIEGIIWRRWLFFDLLGFSDI--AIRIINTFEQNPCLGMIGSRRYRRYKR 293
            KKS        +G  WR +L  +L+G  DI  A RI+   ++NP LG++ +        
Sbjct: 590 TKKSALLPGK--QGCSWRDFLISNLVGMQDIAMADRIVTALKKNPKLGLVFADDPTCVG- 646

Query: 294 WSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEE 352
           WS   K +++      LA +          DF  GTMFW K   L  L NL+L   ++ +
Sbjct: 647 WSGNRKHADI------LANKLNLGPLPRCFDFPVGTMFWAKKGALTELYNLNLGWEDYPQ 700

Query: 353 ERNLKDGALEHAVERFFACSVRYTEFS 379
           E    DG + HA+ER          F+
Sbjct: 701 EPLGYDGTILHAIERLLPIIAAKQGFT 727


>gi|302337198|ref|YP_003802404.1| Rhamnan synthesis F [Spirochaeta smaragdinae DSM 11293]
 gi|301634383|gb|ADK79810.1| Rhamnan synthesis F [Spirochaeta smaragdinae DSM 11293]
          Length = 1808

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 58/247 (23%), Positives = 97/247 (39%), Gaps = 15/247 (6%)

Query: 141  KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD---FEQDVLKY 197
             +        I + +H +Y D   E+   L+ +   F LF++     KD    ++ V K 
Sbjct: 1009 IQLNPRFNLSIGVHLHLFYIDLAEELLSSLINIPVCFSLFISTSAGVKDQEYIKKIVNKK 1068

Query: 198  FP---SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRR 254
             P      +   EN+GRD+ PF+         ++D +   H KKS             RR
Sbjct: 1069 LPLCNECTVIQTENRGRDIAPFIVEFG-NSLSQFDLILHFHSKKSLHSDSLSDA----RR 1123

Query: 255  WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
            +L   +LG   I I+ +N F +N  +GM+    +   +    F  +    ++     K+ 
Sbjct: 1124 FLLHYILGNKAITIQNLNMFFENGSIGMVAPPYHPSLRNMPNFGLQEYETKQ---FLKKM 1180

Query: 315  GFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSV 373
            G        DF  G+ FW +   +  L   ++    F EE+   DG L H +ER      
Sbjct: 1181 GINYSGKCTDFPAGSFFWCRKDAIRQLLTSNIRWNSFPEEKGQIDGTLAHVIERSLGIIC 1240

Query: 374  RYTEFSI 380
            +   F I
Sbjct: 1241 KQNNFKI 1247


>gi|163853098|ref|YP_001641141.1| lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium extorquens PA1]
 gi|163664703|gb|ABY32070.1| Lipopolysaccharide biosynthesis protein-like protein
           [Methylobacterium extorquens PA1]
          Length = 916

 Score =  222 bits (566), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 65/251 (25%), Positives = 111/251 (44%), Gaps = 17/251 (6%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFP 199
           P++       K A +VH +Y +   EI   L + NF  D++V+  ++ K   + ++    
Sbjct: 240 PERLRSHPYKKAAAIVHGFYPELMEEILIYLGKSNFPIDIYVSTDDSKKA--EQIISMGK 297

Query: 200 -----SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRR 254
                   + ++ N+GRD+ P L      VFD Y+    IH KKS   G        WR 
Sbjct: 298 KYHNGQLDVRIISNRGRDIGPMLTGF-SDVFDNYEAFLHIHTKKSPHGGDGL---SSWRD 353

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
           +LF +L+G ++I    ++       +G +  +     +    +    +    V  L +R 
Sbjct: 354 YLFKNLIGSAEIIDSNLHILGTR-NVGFVYPQHLYALRGILNWGYNFDT---VSSLLRRV 409

Query: 315 GFPT-KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACS 372
           G    K + L+F +G+MFW +   L  L +L L + +F+ E    DG L HA+ER F   
Sbjct: 410 GVRLSKDMVLEFPSGSMFWARTAALHGLLSLDLKLEDFDNEAGQVDGTLGHAIERSFLYF 469

Query: 373 VRYTEFSIESV 383
              + +S   V
Sbjct: 470 AETSGYSWAKV 480


>gi|298346187|ref|YP_003718874.1| hypothetical protein HMPREF0573_11061 [Mobiluncus curtisii ATCC
           43063]
 gi|304390053|ref|ZP_07372007.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|298236248|gb|ADI67380.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 43063]
 gi|304326535|gb|EFL93779.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
          Length = 680

 Score =  222 bits (566), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 66/250 (26%), Positives = 108/250 (43%), Gaps = 14/250 (5%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN--KDFEQDVLKYFPSAQ-- 202
              ++A+V+H YY D   EI   L  +  +FD+F+T           Q + +  P  +  
Sbjct: 48  TDCRLAVVMHVYYPDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHL 107

Query: 203 -LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP---IEGIIWRRWLFF 258
            +  +EN GRD+ P + L+  G  D Y  + K+H KKS     HP     G  W+     
Sbjct: 108 VVVPVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRENHPDLEGSGAQWKDEFLD 167

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT 318
            LLG  D   +I++ F  +P LG++ +       +  F+     +     +L +R     
Sbjct: 168 ALLGSKDSVEKIMSAFGADPWLGLVTAPGNIVGPQ--FWGGDQALT---AELLRRLEMQL 222

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTE 377
           K   L F  G+M+WV+   ++ LR+L L   +FE E    D    HA+ER          
Sbjct: 223 KPSKLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALERAIGILTTEAG 282

Query: 378 FSIESVDCVA 387
             +   + +A
Sbjct: 283 LKLRETNQLA 292



 Score = 41.8 bits (97), Expect = 0.16,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 30/85 (35%), Gaps = 10/85 (11%)

Query: 39  SGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPS-CRIFFYGS 97
            G  V +  + +++      +     +F       R +LA +  S L  P+  RI F  +
Sbjct: 598 PGVMVNFDNTARRQWKPDVWYGANPYLF-------RRWLAAAARSVLDRPAPERIVFINA 650

Query: 98  RKE--QKAFLRLNRFMSNSRMPFDS 120
             E  + A L   +    + +    
Sbjct: 651 WNEWAEGAILEPTQRFGKTYLQAVR 675


>gi|315654770|ref|ZP_07907675.1| group 2 glycosyl transferase [Mobiluncus curtisii ATCC 51333]
 gi|315490731|gb|EFU80351.1| group 2 glycosyl transferase [Mobiluncus curtisii ATCC 51333]
          Length = 680

 Score =  222 bits (565), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 66/250 (26%), Positives = 108/250 (43%), Gaps = 14/250 (5%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN--KDFEQDVLKYFPSAQ-- 202
              ++A+V+H YY D   EI   L  +  +FD+F+T           Q + +  P  +  
Sbjct: 48  TDCRLAVVMHVYYPDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHL 107

Query: 203 -LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP---IEGIIWRRWLFF 258
            +  +EN GRD+ P + L+  G  D Y  + K+H KKS     HP     G  W+     
Sbjct: 108 VVVPVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRESHPDLEGSGAQWKDEFLD 167

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT 318
            LLG  D   +I++ F  +P LG++ +       +  F+     +     +L +R     
Sbjct: 168 ALLGSKDSVEKIMSAFGSDPWLGLVTAPGNIVGPQ--FWGGDQALT---AELLRRLEMQL 222

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTE 377
           K   L F  G+M+WV+   ++ LR+L L   +FE E    D    HA+ER          
Sbjct: 223 KPSKLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALERAIGILTTEAG 282

Query: 378 FSIESVDCVA 387
             +   + +A
Sbjct: 283 LKLRETNQLA 292



 Score = 41.8 bits (97), Expect = 0.16,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 30/85 (35%), Gaps = 10/85 (11%)

Query: 39  SGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPS-CRIFFYGS 97
            G  V +  + +++      +     +F       R +LA +  S L  P+  RI F  +
Sbjct: 598 PGVMVNFDNTARRQWKPDVWYGANPYLF-------RRWLAAAARSVLDRPAPERIVFINA 650

Query: 98  RKE--QKAFLRLNRFMSNSRMPFDS 120
             E  + A L   +    + +    
Sbjct: 651 WNEWAEGAILEPTQRFGKTYLQAVR 675


>gi|209559162|ref|YP_002285634.1| RgpFc protein [Streptococcus pyogenes NZ131]
 gi|209540363|gb|ACI60939.1| RgpFc protein [Streptococcus pyogenes NZ131]
          Length = 581

 Score =  222 bits (565), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 62/272 (22%), Positives = 111/272 (40%), Gaps = 27/272 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKKTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRR- 287
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE +    +I     
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETDDIGIIIADIPS 418

Query: 288 YRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPL 341
           + R+ +         + + ++ L ++        F      +  + GT  W K   L+ L
Sbjct: 419 FFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSL 477

Query: 342 RNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
            +L L         L   ++ HA+ER      
Sbjct: 478 FDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|332035169|gb|EGI71680.1| glycosyl transferase, group 1 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 672

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 55/252 (21%), Positives = 89/252 (35%), Gaps = 11/252 (4%)

Query: 133 WNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQ 192
           W  +  +   +G     K+A+  H +Y +        L +     D+FV+V       + 
Sbjct: 147 WYPKAIASSANGEPTTLKLAMCFHVFYGEFIDYYCGALAKFTQQVDVFVSVASEELAKKA 206

Query: 193 ----DVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIE 248
                         + V+ N GR+  P L          YD  C +H KKS   G     
Sbjct: 207 IHDFKACSKVNKVVVKVVPNHGRNFGPMLVEFASD-LQNYDLFCHMHSKKSLYSGRAQT- 264

Query: 249 GIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVI 308
              W  +L   LL    +  +++N F  NP  G+     +     W     +++      
Sbjct: 265 --QWADYLGEYLLNDPHVIKQVLNHFNDNPKSGLYYPTSFWMMPDWVNHWLKNKPA--AQ 320

Query: 309 DLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER 367
              K+     K   L +  G MFW +P+ L+ L N      +F  E    DG+  HA+ER
Sbjct: 321 KFTKKWNIELKDDFLAYPAGGMFWARPEALKQLLNKEYKYDDFPGEPLPNDGSQLHALER 380

Query: 368 FFACSVRYTEFS 379
                V    + 
Sbjct: 381 MLGLLVEKNGYK 392


>gi|298290915|ref|YP_003692854.1| Rhamnan synthesis F [Starkeya novella DSM 506]
 gi|296927426|gb|ADH88235.1| Rhamnan synthesis F [Starkeya novella DSM 506]
          Length = 633

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 109/249 (43%), Gaps = 13/249 (5%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYF 198
           P  + +    K+ +  H +Y D   E+   L       DLF+T     K +  + +   +
Sbjct: 385 PPAAPVASPLKVGLHGHFFYPDLLPELLERLAANASRPDLFLTTDTPAKVEQLRALTAAW 444

Query: 199 P-SAQLYVMENKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRWL 256
           P   ++ V+ N GRD+ PFL  L   +    YD L  +HGKK++  G     G  WR +L
Sbjct: 445 PAKVRIDVVPNSGRDIGPFLTALRDVLTGGEYDVLLHLHGKKTK--GRRRAIGDPWRNFL 502

Query: 257 FFDLLGFSDIAI-RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG 315
           + +L+G     +  ++     +P +G++          W+   +  E  RR + L +  G
Sbjct: 503 WENLIGGDHPMLDAVLAYMAAHPQVGLVYPED-THLLDWARNGRVVEELRRDMGLTEPMG 561

Query: 316 FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVR 374
                 ++DF  G MF V+P  L P+  L L   ++  E    DG + H +ER     VR
Sbjct: 562 -----TYVDFPVGNMFAVRPAALAPVLALDLKWSDYPVEPIPLDGTVLHGIERLLPTVVR 616

Query: 375 YTEFSIESV 383
              F+  +V
Sbjct: 617 KAGFTTAAV 625


>gi|56808559|ref|ZP_00366292.1| COG3754: Lipopolysaccharide biosynthesis protein [Streptococcus
           pyogenes M49 591]
          Length = 581

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 62/272 (22%), Positives = 111/272 (40%), Gaps = 27/272 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKKTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS-RR 287
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE +    +I     
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETDDIGIIIADIPS 418

Query: 288 YRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPL 341
           + R+ +         + + ++ L ++        F      +  + GT  W K   L+ L
Sbjct: 419 FFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSL 477

Query: 342 RNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
            +L L         L   ++ HA+ER      
Sbjct: 478 FDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|139474025|ref|YP_001128741.1| rhamnan synthesis protein F family protein [Streptococcus pyogenes
           str. Manfredo]
 gi|134272272|emb|CAM30524.1| rhamnan synthesis protein F family protein [Streptococcus pyogenes
           str. Manfredo]
          Length = 581

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 62/272 (22%), Positives = 111/272 (40%), Gaps = 27/272 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKKTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS-RR 287
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE +    +I     
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETDDIGIIIADIPS 418

Query: 288 YRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPL 341
           + R+ +         + + ++ L ++        F      +  + GT  W K   L+ L
Sbjct: 419 FFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSL 477

Query: 342 RNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
            +L L         L   ++ HA+ER      
Sbjct: 478 FDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|219670466|ref|YP_002460901.1| Rhamnan synthesis F [Desulfitobacterium hafniense DCB-2]
 gi|219540726|gb|ACL22465.1| Rhamnan synthesis F [Desulfitobacterium hafniense DCB-2]
          Length = 606

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 60/279 (21%), Positives = 109/279 (39%), Gaps = 10/279 (3%)

Query: 120 SEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDL 179
           ++ + ++K         PS      L  + K+ +  H YY+D      H +  +    D+
Sbjct: 262 TQHYAFIKNCLHLNYFLPSDYVVKPLKRQPKVVVCFHVYYEDLLDSCFHYMQSIPQFADI 321

Query: 180 FVTVVEAN-KDFEQDVLKYF--PSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHG 236
            +T  +       ++ +K +   +  + V+  +GR    FL   +  + D YDY C +H 
Sbjct: 322 VITTPKKELVGIIEEKIKSYELNNTTIKVINARGRAESAFLVATKDFILD-YDYACIVHD 380

Query: 237 KKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF 296
           KKS         G+ +       LL  S     I++ FE NP +G +             
Sbjct: 381 KKSSFLRPG-CVGVEFGLQNLDALLATSAYVENILSIFEDNPRIGALEPVHLLHANFRDL 439

Query: 297 FAK-RSEVYRRVIDLAKRAGFPT---KRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFE 351
           +       Y+   +  KRAG        +      G MFW +P C++ + ++     +F 
Sbjct: 440 YGGEWGANYKGTEEFLKRAGIDLLISPDVPPLAPMGAMFWFRPICMKRILDMEWEYEDFP 499

Query: 352 EERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYE 390
           EE    DG+L H +ER +   V+   +    V  + + E
Sbjct: 500 EEPLPLDGSLIHIIERAYPFIVQDAGYLTGWVSTIEDAE 538


>gi|306827605|ref|ZP_07460885.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes ATCC 10782]
 gi|304430168|gb|EFM33197.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes ATCC 10782]
          Length = 581

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 62/272 (22%), Positives = 111/272 (40%), Gaps = 27/272 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS-RR 287
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE +    +I     
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETDDIGIIIADIPS 418

Query: 288 YRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPL 341
           + R+ +         + + ++ L ++        F      +  + GT  W K   L+ L
Sbjct: 419 FFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSL 477

Query: 342 RNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
            +L L         L   ++ HA+ER      
Sbjct: 478 FDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|154509526|ref|ZP_02045168.1| hypothetical protein ACTODO_02058 [Actinomyces odontolyticus ATCC
           17982]
 gi|153799160|gb|EDN81580.1| hypothetical protein ACTODO_02058 [Actinomyces odontolyticus ATCC
           17982]
          Length = 620

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 69/259 (26%), Positives = 104/259 (40%), Gaps = 16/259 (6%)

Query: 138 SSPKKSGLTIKS----KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FE 191
            SP+    T+ +    KI  V H +Y D   EI   L  L   + L  T          E
Sbjct: 282 ISPRADQATLDAAASLKILAVAHIFYADMADEILDRLSVLPAGYHLVATTSNEENKALIE 341

Query: 192 QDVLKYFPSAQLYVME-NKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEG 249
               +    A + V+  N+GRD+  FL      +    YD + KIH KKS ++ Y+    
Sbjct: 342 ARAQERGVDADVRVVSSNRGRDIGAFLVDCNDVLTSGEYDIVVKIHSKKSVQDDYNAA-- 399

Query: 250 IIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMI-GSRRYRRYKRWSFFAKRSEVYRRVI 308
            +++  L+ +LL  SD    I+  F  +P LGM+     +  Y                 
Sbjct: 400 QLFKEHLYDNLLASSDHVASILAEFAAHPGLGMVIAPMPHMGYPTMGHA--WFANRAPAR 457

Query: 309 DLAKRAGF--PTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAV 365
           D AK+ G   P          G+MF  +P+ L  L    L   +F EE   KDG+L H +
Sbjct: 458 DFAKKVGITVPFDDHQPLAPYGSMFIARPEALSLLTGAGLVPEDFPEEGGYKDGSLAHVI 517

Query: 366 ERFFACSVRYTEFSIESVD 384
           ER  + +V    + +  V 
Sbjct: 518 ERLLSYAVLSRGYYVRPVM 536


>gi|19745874|ref|NP_607010.1| hypothetical protein spyM18_0853 [Streptococcus pyogenes MGAS8232]
 gi|19748025|gb|AAL97509.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232]
          Length = 581

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 62/272 (22%), Positives = 111/272 (40%), Gaps = 27/272 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS-RR 287
           DY+   H KKS+   +    G  WR+ L   L+  +D    I++ FE +    +I     
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPAD---SILSAFETDDIGIIIADIPS 418

Query: 288 YRRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPL 341
           + R+ +         + + ++ L ++        F      +  + GT  W K   L+ L
Sbjct: 419 FFRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSL 477

Query: 342 RNLHLIGEFEEERNLKDGALEHAVERFFACSV 373
            +L L         L   ++ HA+ER      
Sbjct: 478 FDLELTQNDIPSEPLPQNSILHAIERLLVYIA 509


>gi|94994091|ref|YP_602189.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10750]
 gi|94547599|gb|ABF37645.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus pyogenes
           MGAS10750]
          Length = 581

 Score =  220 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 60/271 (22%), Positives = 109/271 (40%), Gaps = 25/271 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKKTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRY 288
           DY+   H KKS+   +    G  WR+ L   L+  +D  + +  T +    +       +
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPADSILSVFETDDIGIII--ADIPSF 419

Query: 289 RRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLR 342
            R+ +         + + ++ L ++        F      +  + GT  W K   L+ L 
Sbjct: 420 FRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSLF 478

Query: 343 NLHLIGEFEEERNLKDGALEHAVERFFACSV 373
           +L L         L   ++ HA+ER F    
Sbjct: 479 DLELTQNDIPSEPLPQNSILHAIERLFVYIA 509


>gi|116071143|ref|ZP_01468412.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           BL107]
 gi|116066548|gb|EAU72305.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           BL107]
          Length = 1161

 Score =  220 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 57/248 (22%), Positives = 94/248 (37%), Gaps = 17/248 (6%)

Query: 138 SSPKKSGLTI---KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDV 194
           SSP    LT    + K  + +H +Y +    I+  L ++    D++++  E   D     
Sbjct: 187 SSPHPQKLTQAIEQKKFGVFLHIFYPELAKTIADYLAKIPVKIDIYISTTEKEVDELAKT 246

Query: 195 LKYFPS---AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGII 251
            +   +    Q+    N GRDV PF+      +  +YD++ K+H KKS            
Sbjct: 247 FRRLDNSEHVQVKSFSNTGRDVAPFVVGFREEIL-KYDFILKLHSKKSPHSDALSG---- 301

Query: 252 WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRY---RRYKRWSFFAKRSEVYRRVI 308
           W      +L+G  D+    I     N    +     Y      K  S +      Y +  
Sbjct: 302 WFEHCLDNLIGSKDVFYTNIFELMNNETAIIYPVENYALSLGIKHDSCWGHEDGNYDKAK 361

Query: 309 DLAKRAGFP--TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAV 365
            L  +       +     F  GTMFW K   L+P+ + +L   +F+ E    DG L H++
Sbjct: 362 PLLDKLNLKHIDRDSKFLFPTGTMFWCKSYILQPILDWNLGFHDFDNEGGQIDGTLAHSI 421

Query: 366 ERFFACSV 373
           ER      
Sbjct: 422 ERLIGLCC 429


>gi|71903253|ref|YP_280056.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS6180]
 gi|71802348|gb|AAX71701.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase [Streptococcus
           pyogenes MGAS6180]
          Length = 581

 Score =  220 bits (562), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 60/271 (22%), Positives = 109/271 (40%), Gaps = 25/271 (9%)

Query: 111 MSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHIL 170
           MS   +P D++  L  K L         + ++       K+A+ +H +Y D   E     
Sbjct: 256 MSQISLP-DAKYLLSQKYL---------NCQRLAKQTCQKVAVHLHVFYVDLLDEFLTAF 305

Query: 171 LRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY 228
              NF +DLF+T       K+ ++ + +   +A + V  N+GRD+ P L L +     +Y
Sbjct: 306 EDWNFHYDLFITTDSDIKRKEIKEILQRKGKTADIRVTGNRGRDIYPMLLLKDK--LSQY 363

Query: 229 DYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRY 288
           DY+   H KKS+   +    G  WR+ L   L+  +D  + +  T +      +     +
Sbjct: 364 DYIGHFHTKKSKEADFWA--GESWRKELIDMLVKPADSILSVFETDDIGII--IADIPSF 419

Query: 289 RRYKRWSFFAKRSEVYRRVIDLAKRAG------FPTKRLHLDFFNGTMFWVKPKCLEPLR 342
            R+ +         + + ++ L ++        F      +  + GT  W K   L+ L 
Sbjct: 420 FRFNKIVNAWNEHLIAQEMMSLWRKMDVKKQIDFQAMDTFVMSY-GTFVWFKYDALKSLF 478

Query: 343 NLHLIGEFEEERNLKDGALEHAVERFFACSV 373
           +L L         L   ++ HA+ER F    
Sbjct: 479 DLELTQNDIPSEPLPQNSILHAIERLFVYIA 509


>gi|315657309|ref|ZP_07910191.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|315491781|gb|EFU81390.1| group 2 glycosyl transferase [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 680

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 66/250 (26%), Positives = 108/250 (43%), Gaps = 14/250 (5%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN--KDFEQDVLKYFPSAQ-- 202
              ++A+V+H YY D   EI   L  +  +FD+F+T           Q + +  P  +  
Sbjct: 48  TDCRLAVVMHVYYSDLVTEIVQRLSNIPVEFDMFITNASGADLPLLPQQIHERLPLLKHL 107

Query: 203 -LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHP---IEGIIWRRWLFF 258
            +  +EN GRD+ P + L+  G  D Y  + K+H KKS     HP     G  W+     
Sbjct: 108 VVVPVENHGRDIFPLVQLVNFGALDPYQLILKVHTKKSAWRESHPDLEGSGAQWKDEFLD 167

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT 318
            LLG  D   +I++ F  +P LG++ +       +  F+     +     +L +R     
Sbjct: 168 ALLGSKDSVEKIMSAFGSDPWLGLVTAPGNIVGPQ--FWGGDQALT---AELLRRLEMQL 222

Query: 319 KRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTE 377
           K   L F  G+M+WV+   ++ LR+L L   +FE E    D    HA+ER          
Sbjct: 223 KPSKLKFAAGSMYWVRGFVIQGLRSLGLSATDFETEAGQIDATTAHALERAIGILTTEAG 282

Query: 378 FSIESVDCVA 387
             +   + +A
Sbjct: 283 LKLRETNQLA 292



 Score = 42.2 bits (98), Expect = 0.16,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 30/85 (35%), Gaps = 10/85 (11%)

Query: 39  SGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPS-CRIFFYGS 97
            G  V +  + +++      +     +F       R +LA +  S L  P+  RI F  +
Sbjct: 598 PGVMVNFDNTARRQWKPDVWYGANPYLF-------RRWLAAAARSVLDRPAPERIVFINA 650

Query: 98  RKE--QKAFLRLNRFMSNSRMPFDS 120
             E  + A L   +    + +    
Sbjct: 651 WNEWAEGAILEPTQRFGKTYLQAVR 675


>gi|296135664|ref|YP_003642906.1| glycosyl transferase family 2 [Thiomonas intermedia K12]
 gi|295795786|gb|ADG30576.1| glycosyl transferase family 2 [Thiomonas intermedia K12]
          Length = 1414

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 82/259 (31%), Positives = 114/259 (44%), Gaps = 19/259 (7%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLK 196
           PS    +G    +  A+++H YY D W E    L  L    D++V++ E  ++   D+++
Sbjct: 266 PSPVLHAGRPHGNGTAVLLHLYYPDLWPEFLAHLKTLPAPCDVYVSLSEGREELLTDIVR 325

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREG---------YHPI 247
             P A +    NKGRD+ P L LL L     Y  L  +HGKKS                 
Sbjct: 326 DLPDAVVMRHPNKGRDIAPRLALLRLARAHNYKQLLFLHGKKSPHLKEVENIHIPFLQHK 385

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRV 307
           +G  WRR L   LL   D + + I  F Q P LG+IG   +    R          + R+
Sbjct: 386 DGDRWRRELLAALL---DASEKTIAAFAQQPKLGLIGPHGFWLGLR------GDANFPRL 436

Query: 308 IDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVE 366
              A+R G         +F G+MFW +P+ L+PL  L L   +FE+E    DG L H VE
Sbjct: 437 SAQAQRMGITPDPARHGYFAGSMFWCRPQALDPLLALDLKDADFEDETGQTDGTLAHVVE 496

Query: 367 RFFACSVRYTEFSIESVDC 385
           R FA S     F I     
Sbjct: 497 RLFALSAEKAGFQIADTAG 515


>gi|320325880|gb|EFW81940.1| hypothetical protein PsgB076_04646 [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 774

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 51/241 (21%), Positives = 91/241 (37%), Gaps = 11/241 (4%)

Query: 144 GLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL----KYFP 199
               +  +AI +H +Y+D   + SH L       D+F+T+   N   +            
Sbjct: 260 PEAARLNVAICLHIFYEDYIEKFSHALANFPIAVDVFITLAAPNHKKKTIATFGQHPRVK 319

Query: 200 SAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD 259
           + ++  + N+ R+  P L      +   YD  C +H KKS   G    E   W  +L   
Sbjct: 320 NLKVSCVPNRERNFGPLLVEFSKDLM-AYDLFCHLHSKKSLYSGR---EQTQWADYLTEY 375

Query: 260 LLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
           LL  ++I  R++N F  +  LG+     +     W      ++ +               
Sbjct: 376 LLRDANIITRLLNAFVDHKDLGLYYPTTFWMMPSWVNHVTMNKAFMNAWH--NEWQIDPC 433

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSVRYTEF 378
              L +  G MFW +P+ L+ +       + F +E    DG++ HA+ER          +
Sbjct: 434 EGFLSYPAGGMFWARPEALKEMLEKEYTYDFFPQEPLPNDGSMLHALERVIGLLAEKNGY 493

Query: 379 S 379
            
Sbjct: 494 K 494


>gi|262038042|ref|ZP_06011449.1| lipopolysaccharide biosynthesis protein [Leptotrichia goodfellowii
           F0264]
 gi|261747934|gb|EEY35366.1| lipopolysaccharide biosynthesis protein [Leptotrichia goodfellowii
           F0264]
          Length = 629

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 63/275 (22%), Positives = 115/275 (41%), Gaps = 13/275 (4%)

Query: 120 SEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDL 179
           +E    +K       +   +     +    K+ +  H Y++D   E     L +    D+
Sbjct: 274 TENMYDIKNSLHLNYNLSENQVTKKIENSPKVGLFFHIYFEDLIEECYRYALNMPEYADI 333

Query: 180 FVTVVEANKDFEQDVL--KYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGK 237
           F+T  +  K  + + +  K      + V++N+GRDV  FL   +  +  +YDY C  H K
Sbjct: 334 FITTDKEEKKEKIEKIFSKMKNKIDIKVIQNRGRDVSAFLIPNKEEIL-KYDYACFAHDK 392

Query: 238 KSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFF 297
           K+++     I+G  ++   F ++LG  ++   II  F +NP LG++        + +   
Sbjct: 393 KTKQLQPE-IKGEDFKFRCFENILGSKELVENIIGLFIENPRLGLLSPPSPNHAEFYGNL 451

Query: 298 AKR-----SEVYRRVIDLAKRAGFPTK---RLHLDFFNGTMFWVKPKCLEPLRNLHL-IG 348
            +      ++ Y    +L K                  GT+FW +PK LE L        
Sbjct: 452 GREWGHSGNDNYEETCNLLKELVIEVNVDISKAPVAPYGTIFWFRPKSLEKLLKKGWKYE 511

Query: 349 EFEEERNLKDGALEHAVERFFACSVRYTEFSIESV 383
           +F +E N  DG L HA+ER +   V+   +   ++
Sbjct: 512 DFPKEPNKVDGTLLHAIERVYPFVVQGAGYYSANI 546


>gi|293189412|ref|ZP_06608132.1| rhamnan synthesis protein F [Actinomyces odontolyticus F0309]
 gi|292821502|gb|EFF80441.1| rhamnan synthesis protein F [Actinomyces odontolyticus F0309]
          Length = 620

 Score =  219 bits (559), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 68/259 (26%), Positives = 104/259 (40%), Gaps = 16/259 (6%)

Query: 138 SSPKKSGLTIKS----KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FE 191
            SP+    T+ +    K+  V H +Y D   EI   L  L   + L  T          E
Sbjct: 282 ISPRADQATLDAAASLKVLAVAHIFYADMADEILDRLSVLPAGYHLVATTSNEENKALIE 341

Query: 192 QDVLKYFPSAQLYVME-NKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEG 249
               +    A + V+  N+GRD+  FL      +    YD + KIH KKS ++ Y+    
Sbjct: 342 AHAQERGVDADVRVVSSNRGRDIGAFLVDCNDVLTSGEYDIVVKIHSKKSVQDDYNAA-- 399

Query: 250 IIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMI-GSRRYRRYKRWSFFAKRSEVYRRVI 308
            +++  L+ +LL  SD    I+  F  +P LGM+     +  Y                 
Sbjct: 400 QLFKEHLYDNLLASSDHVASILAKFAAHPGLGMVIAPMPHMGYPTMGHA--WFANRAPAR 457

Query: 309 DLAKRAGF--PTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAV 365
           D AK+ G   P          G+MF  +P+ L  L    L   +F EE   KDG+L H +
Sbjct: 458 DFAKKVGITVPFDDHQPLAPYGSMFIARPEALSLLTGAGLVPEDFPEEGGYKDGSLAHVI 517

Query: 366 ERFFACSVRYTEFSIESVD 384
           ER  + +V    + +  V 
Sbjct: 518 ERLLSYAVLSRGYYVRPVM 536


>gi|78213552|ref|YP_382331.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9605]
 gi|78198011|gb|ABB35776.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9605]
          Length = 1162

 Score =  219 bits (558), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 53/236 (22%), Positives = 90/236 (38%), Gaps = 16/236 (6%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS---AQL 203
           I  K+ I +H +Y +    I+  L  +    D+F++  E +    + +     +    ++
Sbjct: 201 INKKVGIFLHIFYPELGETIAAYLKNIPCSIDVFISTREDSVAALEKIFARVENTQKIEV 260

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
               N GRDV PF+      +   YDY+ K+H KKS            W      +L+G 
Sbjct: 261 RHFSNIGRDVAPFIVGFRDQIL-NYDYILKLHSKKSPHSNALSG----WFLHCLDNLIGS 315

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYR----RYKRWSFFAKRSEVYRRVIDLAKRAGFPT- 318
             I    +   +  P +G++            +  S +      Y +      R      
Sbjct: 316 EAITATNLKALQS-PEVGIVYPIENYALSLGIQHDSCWGHEDGNYAKARPFLNRYNLRQI 374

Query: 319 -KRLHLDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACS 372
            +     F  GTMFW KP  L+ + +  L    F+EE    DG + H++ER    S
Sbjct: 375 KRESQFQFPTGTMFWCKPAVLQSILDWGLNWNNFDEEGGQIDGTIAHSIERLIGIS 430


>gi|192359986|ref|YP_001983898.1| Capsule polysaccharide biosynthesis protein family [Cellvibrio
           japonicus Ueda107]
 gi|190686151|gb|ACE83829.1| Capsule polysaccharide biosynthesis protein family [Cellvibrio
           japonicus Ueda107]
          Length = 872

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 81/256 (31%), Positives = 109/256 (42%), Gaps = 14/256 (5%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE-ANKDFEQDVLK 196
           +  + +    + +IA+V H YY+D   EI   L  +   FDL VT+ +   +  EQ V +
Sbjct: 590 AEIRAALEHSQKRIAVVAHLYYRDLVPEILSALETIPEAFDLIVTLPDWGTRHIEQMVRE 649

Query: 197 YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYH--PIEGIIWRR 254
            +P A  Y   N+GRD+ PF+ LL L     YD L KI  K+         P  G +WR 
Sbjct: 650 AYPEAVFYRAVNRGRDIGPFVDLLPLITEKNYDALLKIQTKRGYYRSGRLLPQFGQLWRS 709

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
             F  LLG       I+     +P L M+G   Y       F +     Y    DLA+  
Sbjct: 710 ETFRALLGNKSRVTDILEALRTDPSLNMVGPSPY-------FLSLTKYPYHDQGDLAQTI 762

Query: 315 GFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIG--EFEEERNLKDGALEHAVERFFACS 372
                     FF GTMFWV+P CL PL     +    FE E    DGA  H +ER F+  
Sbjct: 763 L--NNPTGNGFFAGTMFWVRPSCLRPLTEPEHLSITAFEPESGANDGATAHLIERLFSQV 820

Query: 373 VRYTEFSIESVDCVAE 388
               +  I  V    E
Sbjct: 821 AFANDGKIAGVPSDPE 836


>gi|13476282|ref|NP_107852.1| hypothetical protein mlr7561 [Mesorhizobium loti MAFF303099]
 gi|14027043|dbj|BAB53997.1| mlr7561 [Mesorhizobium loti MAFF303099]
          Length = 609

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 98/249 (39%), Gaps = 11/249 (4%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVLK--YFPSAQL 203
             +IA++ H Y+ D   EI      +   +DL VT   A+K    +Q + K     +A +
Sbjct: 296 DCRIAVLAHVYHLDMIDEILGYAENVPKGYDLIVTTDNADKQALIQQAIAKATNASNAVV 355

Query: 204 YVMENKGRDVRPFLYLLELGVF-DRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLG 262
            V+ N GRD    L      V  DRYD +C++H K+S ++G     G +++   F +LL 
Sbjct: 356 LVVRNDGRDTSALLVGCRDYVLEDRYDLICRVHSKRSPQDGPR---GELFKLHTFENLLH 412

Query: 263 FSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF--PTKR 320
                  ++  F  NP LG++           +     +     V  LA++ G       
Sbjct: 413 TPGYVSNLLELFANNPALGLVMP-PLVHIGYPTIGNSWAGNKANVAKLARQLGLIVHLDD 471

Query: 321 LHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
                  G M+W +P  L  L             + +DG+L HA+ER  A       ++ 
Sbjct: 472 STPVAPYGGMYWFRPAALRKLFEERWNWNDFANMDYRDGSLVHAIERIIAYVAIDAGYTF 531

Query: 381 ESVDCVAEY 389
             V      
Sbjct: 532 RHVMTAGHA 540


>gi|254876593|ref|ZP_05249303.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254842614|gb|EET21028.1| predicted protein [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
          Length = 765

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 55/248 (22%), Positives = 103/248 (41%), Gaps = 13/248 (5%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKY- 197
           P  S   I  K AI +H +Y D   E +     L   +DL++T+    N +F ++     
Sbjct: 520 PINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSSS 579

Query: 198 -FPSAQLYVMENKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRW 255
              + ++  ++N GRD+ P ++ L+  + +R Y+ +   H KK+     H   G  WR +
Sbjct: 580 GAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTVSA--HDNLGDKWRAY 637

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG 315
           L  +L+G ++     I     +  +G++        + +    +       V +L    G
Sbjct: 638 LLNNLIGDNEQISNSILNLFNDEKIGLVFPED----RTYIDIGENKF---YVDELCTAIG 690

Query: 316 FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRY 375
                    F  G MFW +   +  + +L+     +EE   +DG+  HA+ER     V  
Sbjct: 691 LEKICETPLFPLGNMFWARVDAIRDIFSLNEDMILQEEPLPRDGSYMHALERIIPNIVEK 750

Query: 376 TEFSIESV 383
             +   +V
Sbjct: 751 NGYKYVTV 758


>gi|241668058|ref|ZP_04755636.1| glycosyl transferase, group 1 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 756

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 55/248 (22%), Positives = 103/248 (41%), Gaps = 13/248 (5%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKY- 197
           P  S   I  K AI +H +Y D   E +     L   +DL++T+    N +F ++     
Sbjct: 511 PINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSSS 570

Query: 198 -FPSAQLYVMENKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRW 255
              + ++  ++N GRD+ P ++ L+  + +R Y+ +   H KK+     H   G  WR +
Sbjct: 571 GAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTVSA--HDNLGDKWRAY 628

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG 315
           L  +L+G ++     I     +  +G++        + +    +       V +L    G
Sbjct: 629 LLNNLIGDNEQISNSILNLFNDEKIGLVFPED----RTYIDIGENKF---YVDELCTAIG 681

Query: 316 FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRY 375
                    F  G MFW +   +  + +L+     +EE   +DG+  HA+ER     V  
Sbjct: 682 LEKICETPLFPLGNMFWARVDAIRDIFSLNEDMILQEEPLPRDGSYMHALERIIPNIVEK 741

Query: 376 TEFSIESV 383
             +   +V
Sbjct: 742 NGYKYVTV 749


>gi|167627488|ref|YP_001677988.1| group 1 glycosyl transferase [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597489|gb|ABZ87487.1| glycosyl transferase, group 1 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 763

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 55/248 (22%), Positives = 103/248 (41%), Gaps = 13/248 (5%)

Query: 140 PKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTV-VEANKDFEQDVLKY- 197
           P  S   I  K AI +H +Y D   E +     L   +DL++T+    N +F ++     
Sbjct: 518 PINSEKNISHKFAIHLHLFYIDLADEFNEYFKLLPKGYDLYITIIDSNNSEFIKEKFSSS 577

Query: 198 -FPSAQLYVMENKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRW 255
              + ++  ++N GRD+ P ++ L+  + +R Y+ +   H KK+     H   G  WR +
Sbjct: 578 GAANVEIVAVDNIGRDIAPMIFGLKDQLLNRGYEIVGHFHSKKTVSA--HDNLGDKWRAY 635

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG 315
           L  +L+G ++     I     +  +G++        + +    +       V +L    G
Sbjct: 636 LLNNLIGDNEQISNSILNLFNDEKIGLVFPED----RTYIDIGENKF---YVDELCTAIG 688

Query: 316 FPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRY 375
                    F  G MFW +   +  + +L+     +EE   +DG+  HA+ER     V  
Sbjct: 689 LEKICETPLFPLGNMFWARVDAIRDIFSLNEDMILQEEPLPRDGSYMHALERIIPNIVEK 748

Query: 376 TEFSIESV 383
             +   +V
Sbjct: 749 NGYKYVTV 756


>gi|323135560|ref|ZP_08070643.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
 gi|322398651|gb|EFY01170.1| Rhamnan synthesis F [Methylocystis sp. ATCC 49242]
          Length = 812

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 61/242 (25%), Positives = 101/242 (41%), Gaps = 13/242 (5%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE-ANKDFEQDVLKYFPS 200
                 +  IA +VH +Y +    +   L  +    DLF +      K   +DV + +P 
Sbjct: 138 APKPARERPIAAIVHGFYPEIAPLVLEKLKNVTGPVDLFFSTDTQEKKHALEDVCRDWPK 197

Query: 201 --AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFF 258
              ++ +  N+GRD+    +     V+  YD    +H K+S   G        WR +LF 
Sbjct: 198 GRVEIRICPNRGRDIAAKFFGFR-DVYADYDLFIHLHTKRSPHGGAALA---RWRDYLFD 253

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT 318
           +LLG  +I   I++ F  +P +G++  +     +    +      Y     L KR G   
Sbjct: 254 NLLGSPEIVNSILSLF-DDPKIGVVFPQHLFELRGILNWGYD---YDHARALMKRMGVEI 309

Query: 319 -KRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEF-EEERNLKDGALEHAVERFFACSVRYT 376
            K L L+F +G+MFW +     PL +L +  +   +E    DG L HA+ER         
Sbjct: 310 DKNLVLEFPSGSMFWGRSAAFRPLLDLDIDFDDFPQEGGQVDGTLAHAIERSLLMIAESR 369

Query: 377 EF 378
            F
Sbjct: 370 GF 371


>gi|304309760|ref|YP_003809358.1| hypothetical protein HDN1F_01080 [gamma proteobacterium HdN1]
 gi|301795493|emb|CBL43691.1| hypothetical protein HDN1F_01080 [gamma proteobacterium HdN1]
          Length = 1315

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 125/328 (38%), Gaps = 33/328 (10%)

Query: 77  LAFSKY--SKLSFPSCRIFFYGSRKEQKAFLR----LNRFMSNSRMPFDSEKFL---YVK 127
           L F++Y   + S  +  + F   R   + FL       R+   + +   + + L      
Sbjct: 354 LRFTRYLMDRNSQEAAAMLFPRLRTITRTFLEKLPTPLRYRLQAFLRTLAHRLLPNAVQG 413

Query: 128 ELFEGWNDRPSSPKKSGL--------TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDL 179
            L +   + P   +   L        T  + IAI +H YY D        L R+   FDL
Sbjct: 414 RLAQTATNHPYPEQLKQLHELTLPKHTSNATIAIHIHLYYADLAPTFVQALSRMERPFDL 473

Query: 180 FVTV-VEANKDFEQDVLKYFPS---AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIH 235
           ++++ V AN    + V++  P      +    N GRD+ PF+ +       +YD +  +H
Sbjct: 474 YISIQVRANPVEIEAVVRKIPCLRGLDIRATPNLGRDLYPFVCIFGE-ALRKYDIIAHLH 532

Query: 236 GKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRY--RRYKR 293
            KKS    Y+      W  ++   L    +   RI+         G++  + +    Y  
Sbjct: 533 SKKSL---YNQGATAGWLEYILDSLFRSPEDIARILERLSDASQTGIVYPQNFSGLPYMA 589

Query: 294 WSFFAKRSEVYRRVIDLAKRAGF-PTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFE 351
           +++ A RS    R   +  R G       + D+  G+MFW +   + P     L   +FE
Sbjct: 590 YTWLANRS----RAQQVQARFGLTSLPSGYFDYPAGSMFWARADAIAPFFEAQLNEDDFE 645

Query: 352 EERNLKDGALEHAVERFFACSVRYTEFS 379
            E    DG L H +ERF         F 
Sbjct: 646 NESGQTDGTLAHTLERFLVLVPESLGFR 673


>gi|291516581|emb|CBK70197.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           subsp. longum F8]
          Length = 688

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 56/270 (20%), Positives = 101/270 (37%), Gaps = 19/270 (7%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE 185
           +++        PS         + + A + H Y+ D   +  H +  L  + DL++T  E
Sbjct: 302 IRKAMHLDYVLPSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYITSTE 361

Query: 186 ANKDFEQDVLKYF---PSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS-- 239
                 ++ ++       A    + N+GRDV   L      V   +YD +   H KKS  
Sbjct: 362 DKIPQIREYMQQHGISHQATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKKSSQ 421

Query: 240 -QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-- 296
            Q  G+H  E   +   L  + LG       I+  F +NP LG +          ++   
Sbjct: 422 NQENGHHGTESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFAHTI 481

Query: 297 ---FAKRSEVYRRVIDLAKRAGFP---TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGE 349
              +    E+ + +  L  R G     +         G+ +W + + L+PL        +
Sbjct: 482 PHDWGANYEITKEL--LEDRLGIHVPLSPTKPTASAMGSCYWFRVEALKPLFEYGWKYED 539

Query: 350 FEEE-RNLKDGALEHAVERFFACSVRYTEF 378
           F  E +  +DG + HA+ER      +   +
Sbjct: 540 FLPEGQMGEDGTISHAIERANGYICQSRGY 569


>gi|322690050|ref|YP_004209784.1| hypothetical protein BLIF_1872 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|320461386|dbj|BAJ72006.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 672

 Score =  210 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 56/270 (20%), Positives = 101/270 (37%), Gaps = 19/270 (7%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE 185
           +++        PS         + + A + H Y+ D   +  H +  L  + DL++T  E
Sbjct: 280 IRKAMHLDYVLPSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYITSTE 339

Query: 186 ANKDFEQDVLKYF---PSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS-- 239
                 ++ ++       A    + N+GRDV   L      V   +YD +   H KKS  
Sbjct: 340 DKIPQIREYMQQHGISHQATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKKSSQ 399

Query: 240 -QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-- 296
            Q  G+H  E   +   L  + LG       I+  F +NP LG +          ++   
Sbjct: 400 NQENGHHGTESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFAHTI 459

Query: 297 ---FAKRSEVYRRVIDLAKRAGFP---TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGE 349
              +    E+ + +  L  R G     +         G+ +W + + L+PL        +
Sbjct: 460 PHDWGANYEITKEL--LEDRLGIHVPLSPTKPTASAMGSCYWFRVEALKPLFEYGWKYED 517

Query: 350 FEEE-RNLKDGALEHAVERFFACSVRYTEF 378
           F  E +  +DG + HA+ER      +   +
Sbjct: 518 FLPEGQMGEDGTISHAIERANGYICQSRGY 547


>gi|189440434|ref|YP_001955515.1| lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           DJO10A]
 gi|317482688|ref|ZP_07941702.1| rhamnan synthesis protein F [Bifidobacterium sp. 12_1_47BFAA]
 gi|189428869|gb|ACD99017.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium longum
           DJO10A]
 gi|316915934|gb|EFV37342.1| rhamnan synthesis protein F [Bifidobacterium sp. 12_1_47BFAA]
          Length = 666

 Score =  210 bits (536), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 56/270 (20%), Positives = 101/270 (37%), Gaps = 19/270 (7%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE 185
           +++        PS         + + A + H Y+ D   +  H +  L  + DL++T  E
Sbjct: 280 IRKAMHLDYVLPSQAINPQTHDRPRSAFIYHVYFMDLLEDTCHYIASLPEETDLYITSTE 339

Query: 186 ANKDFEQDVLKYF---PSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS-- 239
                 ++ ++       A    + N+GRDV   L      V   +YD +   H KKS  
Sbjct: 340 DKIPQIREYMQQHGISHQATFIPVINRGRDVSALLVAACPVVLSGKYDVIGFAHDKKSSQ 399

Query: 240 -QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-- 296
            Q  G+H  E   +   L  + LG       I+  F +NP LG +          ++   
Sbjct: 400 NQENGHHGTESQGFAYKLMENTLGSEAYVKNILTLFAENPRLGQVTPPPPYHALYFAHTI 459

Query: 297 ---FAKRSEVYRRVIDLAKRAGFP---TKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGE 349
              +    E+ + +  L  R G     +         G+ +W + + L+PL        +
Sbjct: 460 PHDWGANYEITKEL--LEDRLGIHVPLSPTKPTASAMGSCYWFRVEALKPLFEYGWKYED 517

Query: 350 FEEE-RNLKDGALEHAVERFFACSVRYTEF 378
           F  E +  +DG + HA+ER      +   +
Sbjct: 518 FLPEGQMGEDGTISHAIERANGYICQSRGY 547


>gi|281490695|ref|YP_003352675.1| bifunctional alpha-L-Rha
           alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Lactococcus lactis
           subsp. lactis KF147]
 gi|281374464|gb|ADA63985.1| Alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Lactococcus lactis
           subsp. lactis KF147]
          Length = 589

 Score =  210 bits (536), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 63/241 (26%), Positives = 100/241 (41%), Gaps = 17/241 (7%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVLKYFPS 200
           S   +   +A+ +H YY +   E        +FD+DL++T     K+   ++ +      
Sbjct: 281 SKTVLHQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLTTNTDEKEEIIKEMLKCKDAR 340

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A+L    N GRD+ PFL L E     +YD +   H K+S    +    G  WR  L   L
Sbjct: 341 AKLVRTPNHGRDIVPFLALKEE--LKKYDIVGHFHTKRSLEAAFFA--GESWRTELISML 396

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAK-RSEVYRRVIDLAKRAGFP 317
           +  +D    I+  FEQ   LG++ +    + R+ +         ++   + D+ KR    
Sbjct: 397 IEPAD---NIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKQIAPIMNDIWKRMKMN 453

Query: 318 TKRLHLDF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACS 372
            K    DF       GT FW K + LEPL NL ++        L    + HA+ER     
Sbjct: 454 KKVNFHDFNTFTMSYGTFFWAKTEVLEPLFNLEIMDREIPNEPLPQNTILHAIERVLIYL 513

Query: 373 V 373
            
Sbjct: 514 A 514


>gi|261868364|ref|YP_003256286.1| lipopolysaccharide biosynthesis protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|3132260|dbj|BAA28137.1| unnamed protein product [Actinobacillus actinomycetemcomitans]
 gi|261413696|gb|ACX83067.1| lipopolysaccharide biosynthesis protein [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 632

 Score =  210 bits (534), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 104/251 (41%), Gaps = 13/251 (5%)

Query: 138 SSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD---- 193
            S K   +    KI +V H YY D   EI      +   +DL +T        E +    
Sbjct: 283 DSSKVEKVRSDIKILVVAHIYYSDMLDEIISYTQNIPCSYDLLITTANEKSKLEIESNPI 342

Query: 194 -VLKYFPSAQLYVME-NKGRDVRP-FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGI 250
             +       + V+E N+GRD+   F+   +  + +RYD++C++H KKS +  ++    I
Sbjct: 343 LKMSGAKGINVKVVEQNRGRDMSSLFITCKQEIISERYDWVCRLHSKKSPQNSHNM--SI 400

Query: 251 IWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDL 310
            ++  ++ ++L       ++IN  ++N  +G             +            I +
Sbjct: 401 HFKEMMYLNILKDKAYISKVINYLDKNKSIGFAMP-SMVHIGHPTLGHAWFTNRDLAIKI 459

Query: 311 AKRAGFPTKRLHLDFFN--GTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVER 367
           A+R G       +  F   GTMFW +P+ L+ L   +    +F +E   +D +L H +ER
Sbjct: 460 AERVGIKLPFDDISPFAAYGTMFWFRPEALKKLFEYNWKFEDFNKEPMHQDSSLAHILER 519

Query: 368 FFACSVRYTEF 378
               +     +
Sbjct: 520 LLVYAAHDAGY 530


>gi|15672189|ref|NP_266363.1| polysaccharide biosynthesis protein [Lactococcus lactis subsp.
           lactis Il1403]
 gi|12723062|gb|AAK04305.1|AE006258_8 polysaccharide biosynthesis protein [Lactococcus lactis subsp.
           lactis Il1403]
          Length = 589

 Score =  209 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 63/241 (26%), Positives = 100/241 (41%), Gaps = 17/241 (7%)

Query: 143 SGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVLKYFPS 200
           S   +   +A+ +H YY +   E        +FD+DL++T     K+   ++ +      
Sbjct: 281 SKTVLHQTVAVHLHVYYPELLEEFLDAFKNFSFDYDLYLTTNTDEKEEIIKEMLKCKDAK 340

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
           A+L    N GRD+ PFL L E     +YD +   H K+S    +    G  WR  L   L
Sbjct: 341 AKLVRTPNHGRDIVPFLALKEE--LKKYDIVGHFHTKRSLEAAFFA--GESWRTELISML 396

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAK-RSEVYRRVIDLAKRAGFP 317
           +  +D    I+  FEQ   LG++ +    + R+ +         ++   + D+ KR    
Sbjct: 397 IEPAD---NIMAHFEQKQKLGIVIADIPSFFRFNKIVNADNENKQIAPIMNDIWKRMKMN 453

Query: 318 TKRLHLDF-----FNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACS 372
            K    DF       GT FW K + LEPL NL ++        L    + HA+ER     
Sbjct: 454 KKVNFHDFNTFTMSYGTFFWAKIEVLEPLFNLEIMDREIPNEPLPQNTILHAIERVLIYL 513

Query: 373 V 373
            
Sbjct: 514 A 514


>gi|116071634|ref|ZP_01468902.1| hypothetical protein BL107_05779 [Synechococcus sp. BL107]
 gi|116065257|gb|EAU71015.1| hypothetical protein BL107_05779 [Synechococcus sp. BL107]
          Length = 934

 Score =  207 bits (527), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 55/247 (22%), Positives = 102/247 (41%), Gaps = 15/247 (6%)

Query: 142 KSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFV-TVVEANKDFEQDVLK---- 196
           K+ +  + ++AI +H YY ++  E    L  L     L + T     K+   ++L+    
Sbjct: 37  KTSIFQECQVAIYLHIYYPESLHEFLEYLTVLPSQIRLVITTTTSEKKELIIEILERALL 96

Query: 197 --YFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRR 254
                   +Y  ENKGRD+  F+ + +  +  +YD +CK+H KKS   G     G  W R
Sbjct: 97  INRLDLCHVY-HENKGRDIGAFINIYDELI--KYDVVCKLHAKKSPHLG---EFGKSWFR 150

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314
           +L    +G       I+N    +  +G++    ++       +A   ++ + + D    +
Sbjct: 151 YLIRSTIGNQSAIENIVNILYHSKDIGILAPTSFQGTNNHD-WASNFDISQSISDHIFNS 209

Query: 315 GFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHAVERFFACSV 373
                +  L + + T+FW KP+ L   +   +  + F EE    DG   H++ER      
Sbjct: 210 ELDINKEKLRYPSATVFWFKPEALNQQQFRSIQPDFFPEEPIPIDGTTAHSLERLIPYIS 269

Query: 374 RYTEFSI 380
                  
Sbjct: 270 ILNGLKT 276


>gi|258654317|ref|YP_003203473.1| Rhamnan synthesis F [Nakamurella multipartita DSM 44233]
 gi|258557542|gb|ACV80484.1| Rhamnan synthesis F [Nakamurella multipartita DSM 44233]
          Length = 631

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 68/259 (26%), Positives = 108/259 (41%), Gaps = 18/259 (6%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE-ANKDFEQDVL 195
           P            +I ++ H +Y+D   E+   +  +   FDL VT    A K+  +  L
Sbjct: 284 PDVDTGFRPDPPLRICVLAHIFYEDMTDEMMGWIGNIPVPFDLVVTTTSAAKKEAIESAL 343

Query: 196 KYF--PSAQLYVME-NKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGII 251
           + +   S ++ ++E N+GR    FL      +    YD + KIH KKS + G +   G +
Sbjct: 344 EAYALKSVEVRLVESNRGRAESAFLIACRDVLTSGEYDLVLKIHSKKSPQNGANL--GQL 401

Query: 252 WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKR---WSFFAKRSEVYRRVI 308
           ++     +LL        I+  F+  P LGM+              S+F  R   +    
Sbjct: 402 FKHHSVDNLLSSPGYVASILGMFQSQPSLGMVFPPVVNIGFPTLGHSWFTNREAAH---- 457

Query: 309 DLAKRAGFPT--KRLHLDFFNGTMFWVKPKCLEPL-RNLHLIGEFEEE-RNLKDGALEHA 364
           +LA + G  T   R      NGTMFW +P+ L  L R+     +F  E     DG L H 
Sbjct: 458 ELADQLGIHTIFDRTTPLAPNGTMFWARPESLAKLARHDFDYSQFAAEHEGWSDGMLGHV 517

Query: 365 VERFFACSVRYTEFSIESV 383
           +ER +  +V      I+ V
Sbjct: 518 IERLYGYAVLDAGLRIQCV 536


>gi|116511036|ref|YP_808252.1| lipopolysaccharide biosynthesis protein [Lactococcus lactis subsp.
           cremoris SK11]
 gi|116106690|gb|ABJ71830.1| Lipopolysaccharide biosynthesis protein [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 588

 Score =  202 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 113/249 (45%), Gaps = 22/249 (8%)

Query: 141 KKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS 200
           K+       KI I +H +Y D   E  +   +   ++DL++T     K   +++LK +P 
Sbjct: 290 KEVSAKTNLKIGIHLHAFYLDLIPEYLNYFDKYVQNYDLYITTDTEEK--YEEILKNYPL 347

Query: 201 AQ---LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLF 257
            Q   + V  NKGRDV P++ + E  +   YD     H KKS+   +  I G  WRR + 
Sbjct: 348 PQIKKVIVTGNKGRDVLPWMQVSE--LMTDYDLCGHFHTKKSKDNDW--IVGESWRRDIE 403

Query: 258 FDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRW--SFFAKRSEVYRRVIDLAKRAG 315
           + LL   + A  I   FE+NP LG+I +     ++ +    +    +++  + ++ ++  
Sbjct: 404 YSLL---EPAQAIFQEFEKNPKLGLIIADVPSFFEHFYGPTYITERDIWPDMQEIWQKID 460

Query: 316 F------PTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFF 369
           F        K  ++  + GTM W +P+ L  L N+++  +  EE      ++ HA ER  
Sbjct: 461 FENSKELKQKDSYVMSY-GTMIWYRPQALNNLLNVNIQADVPEEPLPY-NSILHAFERLL 518

Query: 370 ACSVRYTEF 378
                   +
Sbjct: 519 VYVSWANGY 527


>gi|23009067|ref|ZP_00050256.1| COG3754: Lipopolysaccharide biosynthesis protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 486

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 92/224 (41%), Gaps = 13/224 (5%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANK-DFEQDVLKYFPS--AQL 203
             ++I +  H ++ D    +      + FD  ++VT   A+K DF +           ++
Sbjct: 271 ANARIGVFAHIFHTDLCEYVLKYTNNIPFDTTVYVTTSSASKADFIRKTFGRLSKHRYEI 330

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
            +  N+GRD+ P L       F   DY   +H KKS            WR +LF   LG 
Sbjct: 331 VIAPNRGRDIAPMLVGYR-NAFQNCDYAVHVHTKKSLHYSSGF---DAWRDYLFEMNLGS 386

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLH- 322
           +++   I+N   ++  +G +    Y    +   +    +    ++      G      + 
Sbjct: 387 AELITGIVNVLSRS-NIGAVAPDHYAPIAKLIQWGGNIDAINGLLSFT---GLSVASENV 442

Query: 323 LDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAV 365
           LDF +G+MFW KP  L  L  +HL    F+ E    DG L HA+
Sbjct: 443 LDFPSGSMFWFKPDALSKLMEIHLQSYHFDPELGQVDGTLAHAI 486


>gi|269978088|ref|ZP_06185038.1| lipopolysaccharide biosynthesis protein [Mobiluncus mulieris 28-1]
 gi|306818459|ref|ZP_07452182.1| rhamnan synthesis protein F [Mobiluncus mulieris ATCC 35239]
 gi|307700705|ref|ZP_07637730.1| rhamnan synthesis protein F [Mobiluncus mulieris FB024-16]
 gi|269933597|gb|EEZ90181.1| lipopolysaccharide biosynthesis protein [Mobiluncus mulieris 28-1]
 gi|304648632|gb|EFM45934.1| rhamnan synthesis protein F [Mobiluncus mulieris ATCC 35239]
 gi|307613700|gb|EFN92944.1| rhamnan synthesis protein F [Mobiluncus mulieris FB024-16]
          Length = 613

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 70/246 (28%), Positives = 106/246 (43%), Gaps = 10/246 (4%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVLKYFPSAQL 203
             K +IA V H +Y D   EI      L     +F+T     K    EQ +      A++
Sbjct: 293 NAKLRIAGVAHVFYADMTAEIMKRFSYLGDHAQIFLTTSTPEKKTQIEQQLQTMGRQAEV 352

Query: 204 YVME-NKGRDVRPFLYLLELGVF-DRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            ++E N+GRDV  FL      +   R+D + KIH KKS ++ Y+  E  +++R LF +LL
Sbjct: 353 RIVESNRGRDVSAFLVTCADVLEPGRFDVVAKIHSKKSAQDAYNAAE--LFKRHLFENLL 410

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF--PTK 319
                   +++ F   P LGM+              A      +  + L +R G   P  
Sbjct: 411 PSPGYTANLLHLFATEPYLGMVFPPAVSLGYPTLGHA-WFANKKPALALCERLGIKLPFD 469

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
                   G+MF+ +P+ L PL   H    +F EE    DG+L H +ER F+ S      
Sbjct: 470 DTTPLSPYGSMFFARPEALLPLTKAHFTFNDFPEEGQYSDGSLAHVIERIFSYSSLSEGL 529

Query: 379 SIESVD 384
             +SV 
Sbjct: 530 ICKSVM 535


>gi|227875198|ref|ZP_03993340.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Mobiluncus mulieris
           ATCC 35243]
 gi|227844103|gb|EEJ54270.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase / alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Mobiluncus mulieris
           ATCC 35243]
          Length = 613

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 68/246 (27%), Positives = 105/246 (42%), Gaps = 10/246 (4%)

Query: 146 TIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD--FEQDVLKYFPSAQL 203
             K +IA V H +Y D   EI      L     +F+T     K    EQ +      A++
Sbjct: 293 NAKLRIAGVAHVFYADMTAEIMKRFSYLGDHAQIFLTTSTPEKKTQIEQQLQTMGRQAEV 352

Query: 204 YVME-NKGRDVRPFLYLLELGVFDR-YDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
            ++E N+GRDV  FL      +    +D + KIH KKS ++ Y+  E  +++R LF +LL
Sbjct: 353 RIVESNRGRDVSAFLVTCADVLEPGCFDVVAKIHSKKSAQDAYNAAE--LFKRHLFENLL 410

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF--PTK 319
                   +++ F   P LGM+           +         +  + L +R G   P  
Sbjct: 411 PSPGYTANLLHLFATEPYLGMVFPPA-VSLGYPTLGHAWFANKKPALALCERLGIKLPFD 469

Query: 320 RLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
                   G+MF+ +P+ L PL   H    +F EE    DG+L H +ER F+ S      
Sbjct: 470 DTTPLSPYGSMFFARPEALLPLTKAHFTFNDFPEEGQYSDGSLAHVIERIFSYSSLSEGL 529

Query: 379 SIESVD 384
             +SV 
Sbjct: 530 ICKSVM 535


>gi|310286583|ref|YP_003937841.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           S17]
 gi|309250519|gb|ADO52267.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           S17]
          Length = 662

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 55/275 (20%), Positives = 99/275 (36%), Gaps = 17/275 (6%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE 185
           +++        P+  +        + A + H Y+ D   +    +  L  + DL++T  E
Sbjct: 281 IRKALHLDYVLPTVTRNPRTGADVRSAFIYHIYFLDLLGDTCRYISALPEETDLYITTTE 340

Query: 186 ANKDFEQDVLK----YFPSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS- 239
              D  +D +       P   + V+ N+GRDV   L      V   +YD +   H KKS 
Sbjct: 341 DKIDAIRDYMASHGVNHPVTFISVV-NRGRDVSALLVAACDVVLSGKYDVIGFAHDKKSS 399

Query: 240 --QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF- 296
             Q  G+H  E   +   L  + L   D    I+  F   P LG +          ++  
Sbjct: 400 QNQENGHHGTESQGFAYKLMENTLASRDYVENILTLFSNEPRLGQVAPPPPFHALYFAHT 459

Query: 297 ----FAKRSEVYRRVIDLAKRAGFPTKR-LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEF 350
               +    E+ + +++       P           G+ +W + + L+PL        +F
Sbjct: 460 LPHDWGANFEITKELLEDRFDIHVPLSPGKPSASAIGSCYWFRVEALKPLFEYGWKYEDF 519

Query: 351 EEE-RNLKDGALEHAVERFFACSVRYTEFSIESVD 384
             E    +DG + HA+ER      +   +    V 
Sbjct: 520 LPEGEMGEDGTVSHAIERANGYICQSQGYYPAWVM 554


>gi|224284010|ref|ZP_03647332.1| Lipopolysaccharide biosynthesis protein [Bifidobacterium bifidum
           NCIMB 41171]
 gi|313141164|ref|ZP_07803357.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313133674|gb|EFR51291.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 662

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 55/275 (20%), Positives = 99/275 (36%), Gaps = 17/275 (6%)

Query: 126 VKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE 185
           +++        P+  +        + A + H Y+ D   +    +  L  + DL++T  E
Sbjct: 281 IRKALHLDYVLPTVTRNPRTGADVRSAFIYHIYFLDLLGDTCRYISALPEETDLYITTTE 340

Query: 186 ANKDFEQDVLK----YFPSAQLYVMENKGRDVRPFLYLLELGVFD-RYDYLCKIHGKKS- 239
              D  +D +       P   + V+ N+GRDV   L      V   +YD +   H KKS 
Sbjct: 341 DKIDAIRDYMASHGVNHPVTFISVV-NRGRDVSALLVAACDVVLSGKYDVIGFAHDKKSS 399

Query: 240 --QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF- 296
             Q  G+H  E   +   L  + L   D    I+  F   P LG +          ++  
Sbjct: 400 QNQENGHHGTESQGFAYKLMENTLASRDYVENILTLFSNEPRLGQVAPPPPFHALYFAHT 459

Query: 297 ----FAKRSEVYRRVIDLAKRAGFPTKR-LHLDFFNGTMFWVKPKCLEPLRNLHL-IGEF 350
               +    E+ + +++       P           G+ +W + + L+PL        +F
Sbjct: 460 LPHDWGANFEITKELLEDRFDIHVPLSPGKPSASAIGSCYWFRVEALKPLFEYGWKYEDF 519

Query: 351 EEE-RNLKDGALEHAVERFFACSVRYTEFSIESVD 384
             E    +DG + HA+ER      +   +    V 
Sbjct: 520 LPEGEMGEDGTVSHAIERANGYICQSQGYYPAWVM 554


>gi|222148479|ref|YP_002549436.1| hypothetical protein Avi_2007 [Agrobacterium vitis S4]
 gi|221735467|gb|ACM36430.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 513

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 64/244 (26%), Positives = 110/244 (45%), Gaps = 14/244 (5%)

Query: 145 LTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVLKYF---PS 200
           + ++  + I VHC+Y + + EI+  L  L   F L VTV  E++    +++L  F    +
Sbjct: 251 VALQLSLCIHVHCFYVELFNEIADRLQCLTLPFYLVVTVCNESDAKVVENLLVDFNQRQN 310

Query: 201 AQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
             + V+EN+GRD+ PFL      ++ + D +  +H KKS     H   G  WRR+LF   
Sbjct: 311 THILVVENRGRDIAPFLIDASP-IWRKSDLVLHLHTKKSP----HITWGDNWRRYLFDQT 365

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKR 320
           +G+  +   II+ F+    +GM+    +   K ++   K  +  R    +A++       
Sbjct: 366 IGYEPLLKGIIDQFQDRDDMGMMYPENFCMIKHFTEEEKNKDAIRY---IAQKLRLECSF 422

Query: 321 LHLD-FFNGTMFWVKPKCLEPLRNLH-LIGEFEEERNLKDGALEHAVERFFACSVRYTEF 378
             L  +  G+M + + K L  +     L   F  E+   DG   H +ER     VR   F
Sbjct: 423 EALGAYAAGSMAFYRVKALASVLEYDALENLFGPEQGQLDGTAAHVLERLLPEMVRLNGF 482

Query: 379 SIES 382
             + 
Sbjct: 483 ETQP 486


>gi|71735705|ref|YP_273244.1| hypothetical protein PSPPH_0972 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71556258|gb|AAZ35469.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 1262

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 54/238 (22%), Positives = 94/238 (39%), Gaps = 15/238 (6%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEA-----NKDFEQDVLKYFPSAQLY 204
           +I + +H YY D    IS  L  +   FDLF++          +    D +       + 
Sbjct: 211 RIGVYLHLYYTDLLGAISKHLNNIPLAFDLFISTPHELDHKKLRKIVSDSVTNVKEISIK 270

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
            + N+GRD+ PF+          YD +C IH KKS+           W   +   LLG  
Sbjct: 271 HVPNRGRDIAPFIIEFG-NELQAYDAICHIHTKKSEHTKGLSD----WGDDILSSLLGSR 325

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWS-FFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
           +   +I+   + +    +I       Y +    +++  E+ + ++         +     
Sbjct: 326 EDVKKILTLLKGDAK--IIYPEGQNYYMKDPTGWSENHEIAKHILSDHLETDI-SNFPKA 382

Query: 324 DFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
           +F  G+MFW + + ++   N+ L   +F EE    DG L HA+ER    S       I
Sbjct: 383 EFPEGSMFWARQEGIQSFLNIPLDWEDFPEEPIPTDGTLAHALERIILISAYAAPGRI 440



 Score = 41.8 bits (97), Expect = 0.17,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 52/142 (36%), Gaps = 28/142 (19%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCR-IFFYGSRKE--Q 101
           W  + +    S  VH      F+    WL   +AF+K +    P  R +    +  E  +
Sbjct: 742 WDNTARYGSESYVVHESTPEKFQG---WLEQSIAFTKAN---LPEDRHLVVINAWNEWAE 795

Query: 102 KAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD 161
            A L  + +   + +         +K L    +D+P++     L   +K+ + +      
Sbjct: 796 GAHLEPDTYSGYAYLNSVGRVLSGIKYL----DDKPTA-----LGTNAKLIVEI------ 840

Query: 162 TWIEISHILLRLNFDFDLFVTV 183
              E+   L   N + D FV+ 
Sbjct: 841 ---ELPTYLTN-NLELDKFVST 858


>gi|125623094|ref|YP_001031577.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|124491902|emb|CAL96823.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris MG1363]
 gi|300069842|gb|ADJ59242.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase RgpF [Lactococcus
           lactis subsp. cremoris NZ9000]
          Length = 588

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 61/246 (24%), Positives = 108/246 (43%), Gaps = 22/246 (8%)

Query: 144 GLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQ- 202
                 KIAI +H +Y D   E      +   ++DLF+T    +K   + ++K +P  Q 
Sbjct: 293 NKKSNLKIAIHLHAFYLDLIPEYLDYFDKYVQNYDLFITTDTKDK--YEQIIKSYPLNQI 350

Query: 203 --LYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDL 260
             + V  NKGRDV P++ + E  +   YD     H KKS+   +  I G  WRR + + L
Sbjct: 351 KKVLVTGNKGRDVLPWMEISE--LMADYDLCGHFHTKKSKDNDW--IVGESWRRDIEYSL 406

Query: 261 LGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRW--SFFAKRSEVYRRVIDLAKRA---- 314
           L  +     I   FE+NP LG++ +     ++ +    +    +++  + ++ K+     
Sbjct: 407 LKPAQ---AIFQEFEKNPKLGLMIADVPSFFEHFYGPTYITERDIWPDMEEIWKKINFEN 463

Query: 315 --GFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACS 372
             G   K  ++  + GTM W +P+ L  L  + +     EE      ++ HA ER    +
Sbjct: 464 PRGLKQKDSYVMSY-GTMIWYRPQALNNLLKVDIEAAVPEEPLPY-NSILHAFERLLVYT 521

Query: 373 VRYTEF 378
                +
Sbjct: 522 SWANGY 527


>gi|209524107|ref|ZP_03272658.1| glycosyl transferase family 2 [Arthrospira maxima CS-328]
 gi|209495482|gb|EDZ95786.1| glycosyl transferase family 2 [Arthrospira maxima CS-328]
          Length = 2819

 Score =  195 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 69/241 (28%), Positives = 109/241 (45%), Gaps = 13/241 (5%)

Query: 148  KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVL-KYFPSAQLYVM 206
              KIA+V+H YY +   E+   L  L  D+DLFVT+ E   D     L KY  + Q+ ++
Sbjct: 1736 NPKIAVVLHAYYPELLPELFSKLDNL-SDYDLFVTIPENVVDSVTSALDKYTKNYQVSIV 1794

Query: 207  ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
            +N G D+ PFL ++       Y Y+CKIH K+      HP  G +WR  L   +LG  +I
Sbjct: 1795 KNIGYDILPFLEVISELDTLGYKYVCKIHTKR-----DHPDFGSLWRECLLDAVLGDKNI 1849

Query: 267  AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFF 326
              +II  F+ NP L ++G          + +    ++ + + D  +            FF
Sbjct: 1850 TEQIITAFDNNPSLQIVGPALLYMSMLGTIYDGHEKMKKMIHDFMEPLNL---IEDWGFF 1906

Query: 327  NGTMFWVKPKCLEPLRNLHLIGEFEEERN---LKDGALEHAVERFFACSVRYTEFSIESV 383
             G+MFW +   L+ + +  L+   + + +   L  G   H VER         E  +  V
Sbjct: 1907 GGSMFWSRITPLKYIADQILLKPIDWQASKSWLTTGFYYHIVERLLGLVSYINEGQVGLV 1966

Query: 384  D 384
            D
Sbjct: 1967 D 1967


>gi|158422520|ref|YP_001523812.1| putative lipopolysaccharide biosynthesis protein [Azorhizobium
           caulinodans ORS 571]
 gi|158329409|dbj|BAF86894.1| putative lipopolysaccharide biosynthesis protein [Azorhizobium
           caulinodans ORS 571]
          Length = 661

 Score =  193 bits (490), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 82/333 (24%), Positives = 135/333 (40%), Gaps = 20/333 (6%)

Query: 63  LSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDS 120
             + + +  WL   LA ++   ++     + F  +  +    + L  +    ++ +   +
Sbjct: 313 PDLGDDYARWLTEVLAIARARPVA--GASLVFINAWNDWLNGSHLLPDARYGHALLRATA 370

Query: 121 EKFLYVKELFEGWNDRPSSPKKSGLTIKS-KIAIVVHCYYQDTWIEISHILLRLNFDFDL 179
                          RP++   +   +++  +A VVH YY+D    +   L        L
Sbjct: 371 STCA--PYAGAIGARRPAAAPVTPRPVRTGSLASVVHGYYEDLLPGLIAGLD----PAHL 424

Query: 180 FVTVVEANKDFEQDVLKYFPSAQLYV-MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK 238
           FVT      +  + VL     A     +EN+GRDVRPFL LL     + YD + K+H K+
Sbjct: 425 FVTTPPEKAEAVRAVLARAAPAARLRVVENRGRDVRPFLSLLPELEAEGYDLVLKVHTKR 484

Query: 239 SQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA 298
           S  +G    EG  W + L   LL  +  + R+   FE +P +G++G+  +        +A
Sbjct: 485 SPHQGK---EGSDWLQRLSGPLLKLA-RSERLAPVFEAHPQMGLLGAAGHVLDGA--LYA 538

Query: 299 KRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNL-HLIGEFEEERNLK 357
             +     +  LA   G     L   +  GTMF  +     PLR    L+  F+ +  LK
Sbjct: 539 GSAGNAAWMRRLAAELGTGA-PLTSPYVAGTMFVARLGIFAPLRGASELLDLFDTDMGLK 597

Query: 358 DGALEHAVERFFACSVRYTEFSIESVDCVAEYE 390
           DG L HA ERFF         S+  V      E
Sbjct: 598 DGTLAHAFERFFGVLAAEAGLSVGEVAADGHVE 630


>gi|221634514|ref|YP_002523202.1| hypothetical protein RSKD131_4489 [Rhodobacter sphaeroides KD131]
 gi|221163387|gb|ACM04349.1| Hypothetical Protein RSKD131_4489 [Rhodobacter sphaeroides KD131]
          Length = 1042

 Score =  192 bits (487), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 58/230 (25%), Positives = 98/230 (42%), Gaps = 11/230 (4%)

Query: 152 AIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEA-NKDFEQDVLKYFPSAQLYVMENKG 210
           A ++H ++ D   +++  L  L+   D FVT+  +  ++    V   FP A +  +EN+G
Sbjct: 8   AAIIHVWHLDVLDDLTEALEHLHGSADQFVTLPSSFRQEQRDRVTAAFPKATIVEVENRG 67

Query: 211 RDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRI 270
           +D+     L++     RYD++CKIH KK             WRR L   +LG       I
Sbjct: 68  QDIGALFQLMQKVNLGRYDFICKIHTKKGPNMP------EEWRRALLDGVLGSKRQVTHI 121

Query: 271 INTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTM 330
           + +F  +P + + G+R+   Y          +V      L     F  +     F  GT 
Sbjct: 122 VESFRADPKVMLAGARQLFVYGPAYLEPNADKVAEDYASLIG--DFDVRSEDWGFIAGTC 179

Query: 331 FWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSI 380
           FW++   L+ +    +  +F     + DGA  HA ER F   V     ++
Sbjct: 180 FWIRTSILQEMAACAV--DFLPADYVTDGAPAHAAERMFGLCVALRGGTV 227


>gi|78184217|ref|YP_376652.1| lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
 gi|78168511|gb|ABB25608.1| Lipopolysaccharide biosynthesis protein-like [Synechococcus sp.
           CC9902]
          Length = 519

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 61/263 (23%), Positives = 110/263 (41%), Gaps = 16/263 (6%)

Query: 137 PSSPKKS-GLTIKSKIAIVVHCYYQDTWIEISHILLRL-----NFDFDLFVTVVEANKDF 190
           PS+ ++S G +    +A+++H +Y D   +I   L            DL+V+      D 
Sbjct: 253 PSTDERSWGESSPGHLALMIHGFYPDVLDDILLKLPSFCAGMVGTQLDLYVSTSMDQIDQ 312

Query: 191 EQDVLKY--FPSAQLYVMENKGRDVRPFL-YLLELGVFDRYDYLCKIHGKKSQREGYHPI 247
            +  L+   F   +L+ +EN+GRDV PFL +LL       + +  K+H KKS + G   +
Sbjct: 313 VEKKLRDLDFACVRLFGVENRGRDVAPFLLHLLPAVAAAGHHFFVKLHTKKSLQFGIDGL 372

Query: 248 EGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRV 307
           +   W R L   LL  +     I   F  +  LG +           + F  ++ ++  +
Sbjct: 373 D--KWSRHLIESLL-SAAGLEAIRYQFLDDEDLGCLCPSGTLLPLAIALFKNKTHLHHLL 429

Query: 308 IDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVE 366
                   +   +    F  G+MF  + +    L +    + +FE E    DG   HA+E
Sbjct: 430 SHSEINGRWALMQT---FVAGSMFAGRVEAFRSLLDQGFSLDDFELEGGQFDGTFAHALE 486

Query: 367 RFFACSVRYTEFSIESVDCVAEY 389
           R  +  V+ + + I+ +    E 
Sbjct: 487 RLISLEVKRSGWQIKEMSGSPEA 509


>gi|88808074|ref|ZP_01123585.1| Glycosyl transferase, group 1 [Synechococcus sp. WH 7805]
 gi|88788113|gb|EAR19269.1| Glycosyl transferase, group 1 [Synechococcus sp. WH 7805]
          Length = 512

 Score =  186 bits (472), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 59/262 (22%), Positives = 99/262 (37%), Gaps = 12/262 (4%)

Query: 139 SPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-----EANKDFEQD 193
           +     L    KI +V+H YY ++   I   L  +   FDL VTV      E  K++ + 
Sbjct: 39  TDDPESLGHPLKILVVIHAYYPESLATIFPSLRHMPCHFDLVVTVCSCGDKEVVKEYLEK 98

Query: 194 VLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDR--YDYLCKIHGKKSQREGYHPIEGII 251
           V        + V+ N GRD+ PF+ +++        YD++ K+H K+S         G  
Sbjct: 99  VDLPIDVLDIKVLTNLGRDLLPFVQVIKGLKLQNKAYDFVLKLHTKRSVASSKGKEFGGK 158

Query: 252 WRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLA 311
           W      +LLG  +    I+    Q     ++         R+  +         +  L 
Sbjct: 159 WLEGSLSNLLGSPENVKYILLELLQTTNCALVSPLISLDVFRFCKWKNN---LAPISHLL 215

Query: 312 KRAGFPTKRLHLD-FFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFA 370
            R G          F  G+MFWV  K    + +         E    +G+  HA ER   
Sbjct: 216 DRFGVRESPEDFICFPAGSMFWVDFKAAVLIASCFEESRVPPEPLPSNGSYLHAFERLVP 275

Query: 371 CSVRYTEFSIESVDCVAEYERL 392
             +  T+  ++S  C  + ++L
Sbjct: 276 YILESTQKRMQS-HCNLDLDQL 296


>gi|302337197|ref|YP_003802403.1| glycosyl transferase family 2 [Spirochaeta smaragdinae DSM 11293]
 gi|301634382|gb|ADK79809.1| glycosyl transferase family 2 [Spirochaeta smaragdinae DSM 11293]
          Length = 1100

 Score =  185 bits (471), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 68/241 (28%), Positives = 102/241 (42%), Gaps = 16/241 (6%)

Query: 137 PSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVV-EANKDFEQDVL 195
           P+ P +    +   I +V H Y++D        +  + + FDL VT   E N D    V 
Sbjct: 175 PAFPLQDHSALS--IVVVFHIYHEDLVGSCLQYISHIPYPFDLIVTTPLEENNDAILQVK 232

Query: 196 KYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRW 255
             +P A++   +N GRD+ PFL + +  +  +YD  CK+H KK      +     IWR  
Sbjct: 233 SLYPDAEIVRSKNAGRDIGPFLQVWDRVL--QYDLCCKVHTKK-----GNSAYSEIWRDL 285

Query: 256 LFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAG 315
               +L   D    I+  FEQ   L + G+     Y  + F   +++       L K   
Sbjct: 286 SLRGILETVDTVHGILRMFEQEDSLALAGAE--LLYGSYQFLLGKNK--DLSNSLIKDYN 341

Query: 316 FPTKR-LHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVR 374
            P     +  FF GTMFW++ K    L NL  +  F  E    DG  EHA+ER       
Sbjct: 342 IPVNSYSNNGFFMGTMFWMRVKKFIFLSNLKQLQ-FPIEDGKNDGKYEHALERLLGSLSL 400

Query: 375 Y 375
           +
Sbjct: 401 H 401


>gi|148556902|ref|YP_001264484.1| glycosyl transferase family protein [Sphingomonas wittichii RW1]
 gi|148502092|gb|ABQ70346.1| glycosyl transferase, family 2 [Sphingomonas wittichii RW1]
          Length = 1301

 Score =  181 bits (459), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 67/238 (28%), Positives = 103/238 (43%), Gaps = 14/238 (5%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFP-SAQLYVMEN 208
           K A+V+H +Y +  +E+   +  +    D+FVT   A  +     L   P  A++  + N
Sbjct: 2   KAALVLHLFYPEVAVELIDRVAAIGASVDIFVTHSVALDETVLAALDRLPRKAEVVTVAN 61

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAI 268
           +G D+ P   LL L     YD + K+H KK    GY P     WRR  +  ++G   +  
Sbjct: 62  RGWDIGPLFELLPLLAERGYDLIGKLHSKKGG-SGYAPE----WRRLAYDGMIGSPALVA 116

Query: 269 RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPT-KRLHLDFFN 327
            I+  F+ +P L ++G++   +      F         + DLA R   P        FF 
Sbjct: 117 DIVAAFDAHPDLSLLGAKPLYKSVASHLFRN----AELLSDLAPRLTAPAYPPADWGFFA 172

Query: 328 GTMFWVKPKCLEPLRNLHLIGEFEEERNL-KDGALEHAVERFFACSVRYTEFSIESVD 384
           GT FW +   LE +  L    +     N  +DGAL HAVER F  +       I  V+
Sbjct: 173 GTFFWARRTLLEKVAALADFRD--AAPNQDRDGALGHAVERLFGLAPIGLGGKIGLVE 228


>gi|160936497|ref|ZP_02083865.1| hypothetical protein CLOBOL_01388 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440582|gb|EDP18320.1| hypothetical protein CLOBOL_01388 [Clostridium bolteae ATCC
           BAA-613]
          Length = 373

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 98/243 (40%), Gaps = 9/243 (3%)

Query: 158 YYQDTWIEISHILLRLNFDFDL-FVTVVEANKDFEQDVLKYFP--SAQLYVMENKGRDVR 214
           +Y+D   +    + ++    D+ FVT         +  +      + ++ V EN+GRD+ 
Sbjct: 2   FYEDLLNQCYLYIEQIPKYIDVCFVTSNPKIAFKVKKYINNTKKINYKVLVKENRGRDMA 61

Query: 215 PFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTF 274
             L      + + Y+YLC +H KKS + G +  +G  +   ++ +L+G + +   I+   
Sbjct: 62  ALLVTCHDFIME-YEYLCFVHDKKSLQMG-NDNDGCKFMELIWKNLIGSTGLIENILRYL 119

Query: 275 EQNPCLGMIGSRRYRRYKRWS-FFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN--GTMF 331
             N  +G++             F    +  Y  VI+L  +        +   +   G  F
Sbjct: 120 GNNRDVGLMVPPIPYWGNYIGVFINPWTCNYDNVINLGNQLKLKKNVCYEKEYVTIGGAF 179

Query: 332 WVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYE 390
           W +   L+PL      + +F +E    DG + HA+ER          + +  +  +   +
Sbjct: 180 WCRTNALKPLFEYKWKLEDFCQEPMAVDGTISHAIERILGFVALNNGYDVLEIINLDYAK 239

Query: 391 RLL 393
           + L
Sbjct: 240 QRL 242


>gi|14090418|gb|AAK53494.1| putative methyltransferase [Xanthomonas campestris pv. campestris]
          Length = 212

 Score =  176 bits (447), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 77/214 (35%), Gaps = 22/214 (10%)

Query: 92  IFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKS 149
           + F  +  E  + A L  +  +  + +    +                 +P  +      
Sbjct: 1   MVFINAWNEWAEGAVLEPDARLGYAWLDATRQALTR-------------APDVATEICSP 47

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQD-VLKYFPSAQLYVMEN 208
              +V+H +Y D   E+   ++       + +T            + +    A++   EN
Sbjct: 48  SACVVLHAWYLDVLDEMLDAIVECGTPLRIIITTDLTKVIEVTKCIQRRGIQAEVEGFEN 107

Query: 209 KGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAI 268
           +GRD+ PFL++    + +    + K+H KKS     H  +G  WR  +   LLG      
Sbjct: 108 RGRDILPFLHVANRLLDENVQLVLKLHTKKST----HRDDGNAWRGEMLTALLGPQ-RVD 162

Query: 269 RIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSE 302
            I+N F  +P +G+     +       F    +E
Sbjct: 163 AIVNAFSTDPLVGLAAPEDH-LLPVTEFIGGNAE 195


>gi|146279467|ref|YP_001169625.1| hypothetical protein Rsph17025_3443 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557708|gb|ABP72320.1| hypothetical protein Rsph17025_3443 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 823

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 62/292 (21%), Positives = 96/292 (32%), Gaps = 23/292 (7%)

Query: 98  RKEQKAFLRLNR----FMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIK----S 149
           R EQ AF  L R         R+  D  +        + W  R                 
Sbjct: 529 RPEQAAFRILEREKMQRYGRRRVWRDLAEVEETLSASDNWVHRALRLAPYATVADSSDLP 588

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA--QLYVME 207
             A+ VH +Y D                 + +T     K  E            ++ ++ 
Sbjct: 589 PFALHVHAFYTDDLAADVRSHRAFRLARRIVITTDNERKASEIRTRMGAEGLYPEVILVP 648

Query: 208 NKGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
           N+GRD+ PF+ L    G   + +  C +H KKS         G +WR +L   LLG    
Sbjct: 649 NRGRDILPFMQLFLPGGPAGKDEIWCHLHQKKSLAT---SDSGDVWRAFLLRILLGDDAG 705

Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFF 326
               +    ++P +G++            + A R+ + R     A R   P     L F 
Sbjct: 706 LSDAVGHL-RDPAVGLVAPFDPYHVP---WDASRALLPR----FAPRLPGPLPDNPLLFP 757

Query: 327 NGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTE 377
            G MFWV+   +  + +L      +  E    DG   H VER +        
Sbjct: 758 VGNMFWVRAGVVRAMNDLFGPSYPWPNEPIANDGTEFHLVERLWPTMAARCG 809


>gi|221218294|ref|YP_002524321.1| glycosyltransferase [Rhodobacter sphaeroides KD131]
 gi|221163321|gb|ACM04287.1| glycosyltransferase [Rhodobacter sphaeroides KD131]
          Length = 821

 Score =  162 bits (411), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 64/297 (21%), Positives = 108/297 (36%), Gaps = 20/297 (6%)

Query: 92  IFFYGSRKEQKAFLRLNRFM--SNSRMPFDSEKFLYVKELFEGWNDRP--SSPKKSGLTI 147
           + F+   + +   L   + M     RM  D  +        + W  R    +P  +    
Sbjct: 524 MLFHEPEQAEFRILEREKMMRYGRRRMWRDLAEVEERLADADNWVHRKLRIAPYGTAEAT 583

Query: 148 K-SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA--QLY 204
           +  + ++ VH +Y D   +             + VT     K  E   L        ++ 
Sbjct: 584 ELPRFSLHVHAFYTDDLAQDVRRHAAYRCASRIVVTTDSDRKADEIRTLMAAVGLAPEVL 643

Query: 205 VMENKGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
           V  N+GRD+ PFL L    G     +  C +H KKS         G IWR +L   LLG 
Sbjct: 644 VRPNRGRDILPFLQLFLPGGAAGEDEIWCHLHQKKSLAT---TDSGDIWRAFLLRILLGD 700

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
            + ++    T  +NP +G++            + A R+ + R    +A R   P     L
Sbjct: 701 -EASLSDAATHLRNPGVGLVAPFDPYFIP---WDASRALLPR----VAPRLPGPLPDNPL 752

Query: 324 DFFNGTMFWVKPKCLEPLRNLHLI-GEFEEERNLKDGALEHAVERFFACSVRYTEFS 379
            F  G MF+V+ + +  + +L      +  E    DG   H +ER +         +
Sbjct: 753 LFPVGNMFFVRSRVVRAMNDLFGAGYPWPNEPIPNDGTEFHLIERLWPAMAAQCGLT 809


>gi|50982351|gb|AAT91804.1| hypothetical protein [Yersinia enterocolitica]
          Length = 358

 Score =  159 bits (402), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 60/255 (23%), Positives = 99/255 (38%), Gaps = 16/255 (6%)

Query: 131 EGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDF 190
              ND      K      +K  I+VH +YQ    EI + L+    D+D+ +T    N   
Sbjct: 109 HVSNDGSFELNKIKPNTDNKKLIIVHAFYQREAEEIFNRLVAF-TDYDIVITSPYNNIIC 167

Query: 191 EQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGI 250
           +   +        ++M N GRD+ PFL  L+L V ++Y+Y  K+H K+SQ    H  +  
Sbjct: 168 KAKEILGQERVIGFIMPNYGRDILPFLICLQLIVIEKYEYFVKVHTKRSQ----HLNDNG 223

Query: 251 IWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDL 310
            W       L+G  +    + +    +        + Y  Y        +  +   +  L
Sbjct: 224 AWFNNNLDYLVGNKNATDGLFSIMSDDE------PQIYGEY----ILPIQDHIANNIHWL 273

Query: 311 AKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFF 369
                     +   F  GTMF      L  +R+L L + + E+E    DG   HA+ER+F
Sbjct: 274 TYLLEKEPASVEASFIPGTMFIGNRAFLVLIRDLQLHLFQIEKENGQLDGCCVHAIERYF 333

Query: 370 ACSVRYTEFSIESVD 384
                       S++
Sbjct: 334 GYIASVNGGKCCSIE 348


>gi|297182567|gb|ADI18727.1| lipopolysaccharide biosynthesis protein [uncultured Rhizobiales
           bacterium HF4000_32B18]
          Length = 887

 Score =  146 bits (368), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/236 (23%), Positives = 81/236 (34%), Gaps = 21/236 (8%)

Query: 153 IVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQL--YVMENKG 210
           + VH +Y D + E             +  T     K  E           +   V+ N+G
Sbjct: 648 VHVHAHYTDGFAEDLAGFAAWRHAARVVATTDTEAKAAEIAAAGRNGGVAIETRVVANRG 707

Query: 211 RDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRI 270
           RDV PFL L +    D     C +H KKS   G     G +WR +L   LLG  +     
Sbjct: 708 RDVLPFLELFDGSEDDN-ALWCHVHLKKSVGLGPTS-PGAVWRAFLMRILLGGPERLSTA 765

Query: 271 INTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF--------PTKRLH 322
           +    + P  G++G+               +   R +  L  R           P     
Sbjct: 766 L-ALIRAPEAGLVGAFDPYVM-------GWTGSRRLLAPLQARLDGWEADGGRRPLPDHP 817

Query: 323 LDFFNGTMFWVKPKCLEPLRNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTE 377
           L F  G MFWVK   +  +R L      +  E    DG + H +ER +  +     
Sbjct: 818 LLFPVGDMFWVKAGVVNAMRRLFGADYPWPGEPLPGDGTVYHLIERLWPTAAALAG 873


>gi|291520449|emb|CBK75670.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 486

 Score =  145 bits (367), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 44/174 (25%), Positives = 73/174 (41%), Gaps = 6/174 (3%)

Query: 150 KIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKD---FEQDVLKYFPSAQLYVM 206
           K+A+V H YY + +      L ++ +  D+ +T    +K     E    K     ++ V 
Sbjct: 291 KVAVVAHLYYVEMFELCMDYLAKVPYGIDIIITTNSDDKKQNIIEVASEKGVKLTEVIVA 350

Query: 207 ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDI 266
           EN+GR++   L      +  +Y Y C +H KKS     H   G+ +R  L+   L     
Sbjct: 351 ENRGRELAALLVGCGKFLL-KYKYFCFVHDKKSS-AKEHLSVGLAFRDILWDSSLYSEGY 408

Query: 267 AIRIINTFEQNPCLGM-IGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTK 319
              II+ FEQN C+G+ +    Y     + F       Y + I+L+K       
Sbjct: 409 IRNIIDMFEQNECMGLAVPPTVYCGSYFYPFPDYWVGNYEKTIELSKILNINVD 462


>gi|77404644|ref|YP_345218.1| glycosyltransferase [Rhodobacter sphaeroides 2.4.1]
 gi|77390294|gb|ABA81477.1| possible glycosyltransferase [Rhodobacter sphaeroides 2.4.1]
          Length = 793

 Score =  132 bits (332), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 93/262 (35%), Gaps = 19/262 (7%)

Query: 92  IFFYGSRKEQKAFLRLNRFM--SNSRMPFDSEKFLYVKELFEGWNDRP--SSPKKSGLTI 147
           + F+   + +   L   + M     RM  D  +        + W  R    +P  +    
Sbjct: 524 MLFHEPEQAEFRILEREKMMRYGRRRMWRDLAEVEERLADADNWVHRKLRIAPYGTAEAT 583

Query: 148 K-SKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSA--QLY 204
           +  + ++ VH +Y D   +             + VT     K  E   L        ++ 
Sbjct: 584 ELPRFSLHVHAFYTDDLAQDVRRHAAYRCASRIVVTTDSDRKADEIRTLMAAVGLAPEVL 643

Query: 205 VMENKGRDVRPFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGF 263
           V  N+GRD+ PFL L    G     +  C +H KKS         G IWR +L   LLG 
Sbjct: 644 VRPNRGRDILPFLQLFLPGGAAGEDEIWCHLHQKKSLAT---TDSGDIWRAFLLRILLGD 700

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
                       +NP +G++            + A R+ + R    +A R   P     L
Sbjct: 701 EASLSDAATNL-RNPGVGLVAPFDPYFIP---WDASRALLPR----VAPRLPGPLPDNPL 752

Query: 324 DFFNGTMFWVKPKCLEPLRNLH 345
            F  G MF+V+   +  + +L 
Sbjct: 753 LFPVGNMFFVRSAVVRAMNDLF 774


>gi|301632931|ref|XP_002945533.1| PREDICTED: o-antigen export system ATP-binding protein rfbB-like,
           partial [Xenopus (Silurana) tropicalis]
          Length = 367

 Score =  131 bits (331), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/148 (29%), Positives = 63/148 (42%), Gaps = 10/148 (6%)

Query: 227 RYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR 286
           RY  + ++H K+S         G  WR  L+  L G       I++TF  +P LGM+   
Sbjct: 203 RYALILRLHSKRSLHIP--GQVGEEWRALLYTSLAGSRQRVNAIVDTFNTHPKLGMLCPA 260

Query: 287 RYRRYKRWSFFAKRSEVYRRVIDLAKRAGFP-TKRLHLDFFNGTMFWVKPKCLEP-LRNL 344
               Y     F      Y+R+  L +  G        +DF  G+MFW +P+ L   L   
Sbjct: 261 VIDHYADCLHFGGN---YKRMCALLQPHGITLPPDQPIDFPMGSMFWCRPQALSVWLEPG 317

Query: 345 HLIGEFEEERNL---KDGALEHAVERFF 369
               +F    +L   +DG L HA+ER F
Sbjct: 318 FTFDDFTPTNDLDTDRDGTLAHALERLF 345


>gi|291520444|emb|CBK75665.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 424

 Score =  105 bits (263), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 52/139 (37%), Gaps = 4/139 (2%)

Query: 249 GIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVYRRV 307
           G  +   ++  LLG  ++   +++ F     LG++        + +       +  Y   
Sbjct: 7   GRDFNNRIWQSLLGSKELVEEVLSAFSDEKYLGLLMPSMVTHGEYFHTAIDSWTICYDGT 66

Query: 308 IDLAKRAGFPTKRLHLDFFN--GTMFWVKPKCLEPLRNLHLIGE-FEEERNLKDGALEHA 364
           ++LAK+ G              GT FW + K LE L   +   + F  E    DG++ H 
Sbjct: 67  VELAKKIGLNVPIYGDRNPLSLGTAFWARTKALEKLFEYNFSYDMFPGEPFPVDGSISHY 126

Query: 365 VERFFACSVRYTEFSIESV 383
           +ER F        +    V
Sbjct: 127 IERIFPYVALDAGYYTGIV 145


>gi|148238469|ref|YP_001223856.1| sulfotransferase [Synechococcus sp. WH 7803]
 gi|147847008|emb|CAK22559.1| Possible sulfotransferase [Synechococcus sp. WH 7803]
          Length = 476

 Score =  101 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/159 (20%), Positives = 51/159 (32%), Gaps = 6/159 (3%)

Query: 222 LGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLG 281
                 +D +   H K++         G  WR+ L        D       T    P  G
Sbjct: 4   RDRLKEFDLVVHCHTKRTPHAP--DGFGESWRQSLLQCTFPNPDRCQE-FQTLLHKPEAG 60

Query: 282 MIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPL 341
           +I    +R       +       R +++L        +   L F  G+ FW +   L  L
Sbjct: 61  LIMPWPHRFVAHNVNWGSNFTQTRALMNLMGHT--IRRDTLLAFPAGSFFWARVDSLLAL 118

Query: 342 RNLHLIG-EFEEERNLKDGALEHAVERFFACSVRYTEFS 379
            +L L   +F  E    DG L H++ER         +  
Sbjct: 119 LDLTLRWEDFAAEPLPGDGRLAHSLERCLGLLPMLNDRR 157


>gi|308813905|ref|XP_003084258.1| conserved domain protein (ISS) [Ostreococcus tauri]
 gi|116056142|emb|CAL58323.1| conserved domain protein (ISS) [Ostreococcus tauri]
          Length = 684

 Score = 80.7 bits (198), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 70/227 (30%), Gaps = 43/227 (18%)

Query: 192 QDVLKYFPSAQLYVMENKGRDVRPFLYLLEL--GVFDRYDYLCKIHGKKSQREGYHPIEG 249
           +  L+   + ++  ++++G D+  FL  L         + Y+ K+H K            
Sbjct: 126 ERFLRNEKNIRVVHVKDEGYDIGAFLKQLHRFRHELQVHQYILKVHSKSDP--------- 176

Query: 250 IIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGS------------RRYRRYKRWSFF 297
            IW       L G       I+  FE    L ++                +   KR  F 
Sbjct: 177 -IWLERAVESLCGSEHQVKSILKAFETQSTLDIVSPMGSTFSATTSKDAVFPHLKRKYFN 235

Query: 298 ------AKRSEVYRRVIDLAKRAGFPTKRLHLDFF----NGTMFWVKPKCLEPLRNLHLI 347
                 A   +    +  L  + G         +      GTMFW +      L   HL 
Sbjct: 236 KVDLATAFDDKTMHTMERLCAQLGLEACPYFEKYLASITAGTMFWARN---SRLYTEHLP 292

Query: 348 GEFE---EERNL---KDGALEHAVERFFACSVRYTEFSIESVDCVAE 388
             FE    E +     +  +EHA+ER      R     I  +    +
Sbjct: 293 RLFESIRNELSQDYSNNNRIEHALERLIPTLSRLNGRMIGDIQPAPK 339


>gi|291520445|emb|CBK75666.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 109

 Score = 79.6 bits (195), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 148 KSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFV-TVVEANKDFEQDVLKYF---PSAQL 203
           +++ A+  + ++ D + E       L    D++V T  E   D     +       + ++
Sbjct: 13  QNRYAVFAYLFFDDLFEESLRYFSNLPNYVDIYVATNTEEKVDVINGYIPKMLFRHNVKV 72

Query: 204 YVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGK 237
            +  NKGRDV   L LL+   +  YD +C +H K
Sbjct: 73  LLHNNKGRDVSALLVLLKR-YYSNYDVICFVHDK 105


>gi|329944274|ref|ZP_08292533.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328531004|gb|EGF57860.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 699

 Score = 72.6 bits (177), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 32/212 (15%), Positives = 64/212 (30%), Gaps = 43/212 (20%)

Query: 163 WIEISHILLRLNFDFDLFVTVVEA--NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLL 220
             +++  L  L   + + VT        D E+   +     ++  ++ +G     FL   
Sbjct: 341 ADDLAERLASLPEHWRVVVTSPSELNAADLERVTGRRTTFRKVRDLDPRG--TIAFLTEC 398

Query: 221 ELGVF------------------------DRYDYLCKIHGKKS--QREGYHPIEGIIWRR 254
           +                            DR D +  I    S     G       + RR
Sbjct: 399 DDLWDPAHAGDVGASDGGDGTDTTDTAEVDRVDLVLTI----SAGPLSGSSERADDVARR 454

Query: 255 WLFFDLLGFSDIAIRIINTFEQNPCLGMIGSR-----RYRRYKRWSFFAKRSEVYRRVID 309
            +   LL        +++ F ++P LG++        +     +W      ++   R + 
Sbjct: 455 QVLDCLLASPGYVAGLLDLFGRHPSLGVVMPAACHIGQPYVGPQWDGLVGAADALSRRLG 514

Query: 310 LAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPL 341
           L          +      G+MF  +P+ L  L
Sbjct: 515 LTAAL----DEIAPVAPVGSMFLARPEALRTL 542


>gi|324991549|gb|EGC23482.1| rhamnosyltransferase [Streptococcus sanguinis SK353]
          Length = 556

 Score = 66.5 bits (161), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 42/270 (15%), Positives = 84/270 (31%), Gaps = 29/270 (10%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  +   
Sbjct: 258 YHFGPDLPCLLEDKYLSQATSNYRAALPVLLHIHV--TDFPIFQQYQDKLFSLSSQYQYL 315

Query: 181 VTVVEANK-DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS 239
           VT  +       Q  L +  +    V+  K R     L   +  +   Y Y+  +   + 
Sbjct: 316 VTTDQPEVLKQLQTALGHLGNKVQIVLSQKSRAWLAMLE--QKEILQDYAYIGHLSTHR- 372

Query: 240 QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK 299
              G   +     R  L   ++   D A   I   E+   +G++     R  +      +
Sbjct: 373 -LVGNQAVFDQAMRSDLINMMV---DYADASIEALEKESAVGLVIPDLPRLVR--DGLFE 426

Query: 300 RSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLR---NLHLIGEFE 351
                 R+  + + AG       +   +     G+  W K   L  L    +L  +  FE
Sbjct: 427 SEPPRPRLAAVWQEAGLHKSFDFIITPSLTRVYGSFVWFKYSALASLFQMKSLESLPSFE 486

Query: 352 EERNLKDGALEHAVERFFACSVRYTEFSIE 381
           +E  L D      +E         + +  +
Sbjct: 487 QE--LSD-----VLEHLLVYLAWDSHYDFK 509


>gi|320531345|ref|ZP_08032317.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320136436|gb|EFW28412.1| rhamnan synthesis protein F [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 678

 Score = 66.1 bits (160), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 38/248 (15%), Positives = 71/248 (28%), Gaps = 41/248 (16%)

Query: 128 ELFEGWNDRPSSPKKSGLTIKSKI--AIVVHCYYQD--------TWIEISHILLRLNFDF 177
           E+       P  P     +        +VVH                 ++  L  L   +
Sbjct: 280 EVVVEAAPAPDEPDPEAGSTAPTPSGCVVVHV--PAGGEGVERAEADGLAQRLASLPAHW 337

Query: 178 DLFVTVVEA-NKDFEQDVLKYFPSAQ-------------LYVMENKGRDVRPFLYLLEL- 222
            + VT     +    + +    P+ +             +  ++ +G    PFL      
Sbjct: 338 RVVVTSPTHLDAADLERLTGRRPADEAAAPGGAAVAFRAVRDLDPRG--TIPFLTECGDL 395

Query: 223 -------GVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFE 275
                  G     D + +I    S        +  + RR +   LL        +I+ FE
Sbjct: 396 WDPGRATGSDGGGDLVLRI-TVGSPSGPESKAD-DVARRQVLDCLLASPGYTAGLIDLFE 453

Query: 276 QNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGF--PTKRLHLDFFNGTMFWV 333
           ++P LG+          +         +      L++R G       +      G MF  
Sbjct: 454 RHPGLGVAMPAA-SHIGQAHGGPTWDGLAGAAKTLSRRLGLTVELDPVAPVVPVGAMFMA 512

Query: 334 KPKCLEPL 341
           +P+ L  L
Sbjct: 513 RPEALRTL 520


>gi|291520448|emb|CBK75669.1| Lipopolysaccharide biosynthesis protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 625

 Score = 64.2 bits (155), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 21/56 (37%), Gaps = 1/56 (1%)

Query: 329 TMFWVKPKCLEPLRNLHL-IGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESV 383
           + FW + + L+ L         F +E    +    HA+ER F        +   ++
Sbjct: 4   SCFWCRTEALKKLLEYDFSYNFFPKEPMDANLTTSHAIERIFPYVACDAGYYTSTI 59



 Score = 42.6 bits (99), Expect = 0.099,   Method: Composition-based stats.
 Identities = 20/103 (19%), Positives = 41/103 (39%), Gaps = 14/103 (13%)

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF-FAKRSEVY----RRVI 308
           ++ F +L+  +     I   F++N  +G++G      Y    F       +Y      ++
Sbjct: 421 QYTFDELIKNNGYISAICEVFKENQSVGVVG----NIYGEIIFQINSNMNIYSKYEDEIL 476

Query: 309 DLAKRAGFPTK---RLHLDFFNGTMFWVKPKCLEPLRNLHLIG 348
           +  KR  F      +  L  +NG  FW++   L+ + +   I 
Sbjct: 477 EFEKRFNFDFNRGGKHSLLNYNG--FWLRRDALQMIADCEDIY 517


>gi|324993910|gb|EGC25829.1| rhamnosyltransferase [Streptococcus sanguinis SK405]
 gi|324994771|gb|EGC26684.1| rhamnosyltransferase [Streptococcus sanguinis SK678]
          Length = 556

 Score = 60.7 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 38/268 (14%), Positives = 80/268 (29%), Gaps = 25/268 (9%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  ++  
Sbjct: 258 YHFGPDLPCLLQDKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYL 315

Query: 181 VTVVEANK-DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS 239
           +T  +       Q  L +  +    V+  K R     L   +  +   Y Y+  +   + 
Sbjct: 316 LTTNQPEVLKQLQTALGHLGNKVQLVLSQKSRAWLAMLE--QKEILQDYAYIGHLSTHR- 372

Query: 240 QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK 299
              G   +     R  L   ++   D A   I   EQ   +G++     R  +      +
Sbjct: 373 -LVGNQAVFDQAMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVR--DGLFE 426

Query: 300 RSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFE-EE 353
                  +  + + A        +   +     G   W K   L  L  +  +      E
Sbjct: 427 SEPPLPSLTAVWQEAVLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFRMKSLESLPSSE 486

Query: 354 RNLKDGALEHAVERFFACSVRYTEFSIE 381
           + L D      +E      V  + +  +
Sbjct: 487 QELSD-----VLEHLLVYIVWDSHYDFK 509


>gi|327463172|gb|EGF09493.1| rhamnosyltransferase [Streptococcus sanguinis SK1]
 gi|327474781|gb|EGF20186.1| rhamnosyltransferase [Streptococcus sanguinis SK408]
          Length = 556

 Score = 59.5 bits (143), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 37/268 (13%), Positives = 79/268 (29%), Gaps = 25/268 (9%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  ++  
Sbjct: 258 YHFGPDLPCLLQDKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYL 315

Query: 181 VTVVEANK-DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS 239
           +T  +       Q  L +  +    V+  K R     L   +  +   Y Y+  +   + 
Sbjct: 316 LTTNQPEVLKQLQTALGHLGNKVQLVLSQKSRAWLAMLE--QKEILQDYAYIGHLSTHR- 372

Query: 240 QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK 299
              G   +     R  L   ++   D A   I   EQ   +G++     R  +      +
Sbjct: 373 -LVGNQAVFDQAMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVR--DGLFE 426

Query: 300 RSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFE-EE 353
                  +  + + A        +   +     G   W K   L  L  +  +      E
Sbjct: 427 SEPPLPSLTAVWQEAVLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFRMKSLESLPSSE 486

Query: 354 RNLKDGALEHAVERFFACSVRYTEFSIE 381
           + L D      +E         + +  +
Sbjct: 487 QELSD-----VLEHLLVYIAWDSHYDFK 509


>gi|327489888|gb|EGF21677.1| rhamnosyltransferase [Streptococcus sanguinis SK1058]
          Length = 556

 Score = 59.2 bits (142), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 37/268 (13%), Positives = 79/268 (29%), Gaps = 25/268 (9%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  ++  
Sbjct: 258 YHFGPDLPCLLEDKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYL 315

Query: 181 VTVVEANK-DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS 239
           +T  +       Q  L +  +    V+  K R     L   +  +   Y Y+  +   + 
Sbjct: 316 LTTNQPEVLKQLQTALGHLGNKVQLVLSQKSRAWLAMLE--QKEILQDYAYIGHLSTHR- 372

Query: 240 QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK 299
              G   +     R  L   ++   D A   I   EQ   +G++     R  +      +
Sbjct: 373 -LVGNQAVFDQAMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVR--DGLFE 426

Query: 300 RSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFE-EE 353
                  +  + + A        +   +     G   W K   L  L  +  +      E
Sbjct: 427 SEPPLPSLTAVWQEAVLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFRMKSLESLPSSE 486

Query: 354 RNLKDGALEHAVERFFACSVRYTEFSIE 381
           + L D      +E         + +  +
Sbjct: 487 QELSD-----VLEHLLVYIAWDSHYDFK 509


>gi|325690859|gb|EGD32860.1| rhamnosyltransferase [Streptococcus sanguinis SK115]
          Length = 556

 Score = 58.4 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 40/271 (14%), Positives = 82/271 (30%), Gaps = 31/271 (11%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDT--WIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +  + L  L+  +   
Sbjct: 258 YHFGPDLPCLLQDKYLSQATSNYRTNQPVLLHIHV--TDLPIFQQYQNKLFSLSSQYQYL 315

Query: 181 VTVVEAN--KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK 238
           VTV +    K  +  +       QL + + K       L   +  +   Y Y+  +    
Sbjct: 316 VTVTQPEMLKQLQTTLAHLGDKVQLVLSQ-KSHAWLAMLE--QKEILQDYAYIGHL---- 368

Query: 239 SQRE--GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF 296
           S         +     R  L   ++   D A   I   EQ   +G++     R  +    
Sbjct: 369 STHRIMENQAVFDQAMRSDLINLMV---DYADASIEALEQESAVGLVIPDLPRLVR--DG 423

Query: 297 FAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFE 351
             +   +  R+  + + AG       +   +     G   W K   L  L  +  +    
Sbjct: 424 LFESEPLRPRLAAIWQEAGLHKSFDFMTPPSLTRVYGGFVWFKYSALASLFQMKSLESLP 483

Query: 352 -EERNLKDGALEHAVERFFACSVRYTEFSIE 381
             E+ L D      +E         + +  +
Sbjct: 484 SSEQELSD-----VLEHLLVYLAWDSHYDFK 509


>gi|327470704|gb|EGF16160.1| rhamnosyltransferase [Streptococcus sanguinis SK330]
          Length = 556

 Score = 58.0 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 39/271 (14%), Positives = 82/271 (30%), Gaps = 31/271 (11%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  +   
Sbjct: 258 YHFGPDLPCLLQDKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYQYL 315

Query: 181 VTVVEAN--KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK 238
           VTV +    K  +  +       QL + + K       L   +  +   Y Y+  +    
Sbjct: 316 VTVTQPEMLKQLQTTLAHLGDKVQLVLSQ-KSHAWLAMLE--QKEILQDYAYIGHL---- 368

Query: 239 SQRE--GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF 296
           S         +     R  L   ++ ++D +   I   EQ   +G++     R  +    
Sbjct: 369 STHRIMENQAVFDQAMRSDLINMMVYYADTS---IEALEQESAVGLVIPDLPRLVR--DG 423

Query: 297 FAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFE 351
             +      R+  + + AG       +   +     G   W K   L  L  +  +    
Sbjct: 424 LFESEPPRPRLAAIWQEAGLHKSFDFMTPPSLTRVYGGFVWFKYSALASLFQMKSLESLP 483

Query: 352 -EERNLKDGALEHAVERFFACSVRYTEFSIE 381
             E+ L D      +E         + +  +
Sbjct: 484 SSEQELSD-----VLEHLLVYLAWDSHYDFK 509


>gi|328946538|gb|EGG40677.1| rhamnosyltransferase [Streptococcus sanguinis SK1087]
          Length = 556

 Score = 57.6 bits (138), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 36/269 (13%), Positives = 78/269 (28%), Gaps = 27/269 (10%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHI---LLRLNFDFDL 179
           + +  +L     D+  S   S    +  + + +H    D +         L  L+  +  
Sbjct: 258 YHFGPDLPCLLEDKYLSQSTSNYCTEQPVLLHIHV--TD-FPIFQQYQDNLFSLSSQYQY 314

Query: 180 FVTV--VEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGK 237
            VT    E  K  +  +       Q+ + + K       L   +  +   Y Y+  +   
Sbjct: 315 LVTTGQPEVLKQLQTSLAHLGNKVQIVLSQ-KSHAWLAMLE--QKEILQNYAYIGHLSTH 371

Query: 238 KSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFF 297
           +        +     R  L   ++  +D +   I   E+N  LG++     R  +     
Sbjct: 372 R--LVENQAVFDQAMRSDLINMMVDSADAS---IEALEKNSDLGLVIPDLPRLVR--DGL 424

Query: 298 AKRSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFEE 352
            +      R+  + + AG       +   +     G   W K   L     +  +     
Sbjct: 425 FESEPPRPRLTSVWQDAGLHKSFNFMSTPSLTRVYGGFLWFKYSALASWFQMKSLESLPS 484

Query: 353 ERNLKDGALEHAVERFFACSVRYTEFSIE 381
                D  L   +E         + +  +
Sbjct: 485 ----SDQELSDVLEHLLVYLAWDSHYDFK 509


>gi|325694904|gb|EGD36809.1| rhamnosyltransferase [Streptococcus sanguinis SK150]
          Length = 556

 Score = 57.2 bits (137), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 37/268 (13%), Positives = 74/268 (27%), Gaps = 25/268 (9%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVT 182
           + +  +L     D+  S   S       + + +H      + +    L  L   +   VT
Sbjct: 258 YHFGPDLPCLLQDKYLSQSTSSYRTNQSVLLHIHVTNFPIFQQYQEKLFSLASQYQYLVT 317

Query: 183 VVEAN-KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQR 241
                     Q  L +       V+  K   +   L   +  +   Y Y+  +    S  
Sbjct: 318 TNLPEMLKQLQTALAHLDDKVQIVLSQKSHALLAMLE--QKEILQNYVYIGHL----STH 371

Query: 242 E--GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK 299
                  +     R  L   ++   D A   I   EQ   +G++     R  +      +
Sbjct: 372 RIMENQAVFDQAMRSDLINMMV---DYADASIEALEQESAVGLVIPDLPRLVR--DGLFE 426

Query: 300 RSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFE-EE 353
                  +  + + AG       +   +     G   W K   L  L  +  +      E
Sbjct: 427 SEPPLPSLTAVWQEAGLHKSFDFMTAPSLTRVYGGFLWFKYSALTSLFQMKSLESLPSSE 486

Query: 354 RNLKDGALEHAVERFFACSVRYTEFSIE 381
           + L D      +E         + +  +
Sbjct: 487 QELSD-----VLEHLLVYIAWDSHYDFK 509


>gi|326772087|ref|ZP_08231372.1| hypothetical protein HMPREF0059_00469 [Actinomyces viscosus C505]
 gi|326638220|gb|EGE39121.1| hypothetical protein HMPREF0059_00469 [Actinomyces viscosus C505]
          Length = 681

 Score = 57.2 bits (137), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/90 (20%), Positives = 30/90 (33%), Gaps = 3/90 (3%)

Query: 254 RWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKR 313
           R     LL        +I+ F ++P LG+          +         +      L++R
Sbjct: 439 RQALDCLLDSPGYTAGLIDLFARHPGLGVAMPAA-GHIGQAHGGPTWDGLAGAAKALSRR 497

Query: 314 AGFPTKRLHLDF--FNGTMFWVKPKCLEPL 341
            G   +   L      G MF  +P+ L  L
Sbjct: 498 LGLSAELDPLAPVAPPGAMFMARPEALRTL 527


>gi|325696073|gb|EGD37964.1| rhamnosyltransferase [Streptococcus sanguinis SK160]
          Length = 556

 Score = 55.3 bits (132), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 39/275 (14%), Positives = 84/275 (30%), Gaps = 39/275 (14%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHC-------YYQDTWIEISHILLRLNF 175
           + +  +L     D+  S   S       + + +H        +YQD        L  L+ 
Sbjct: 258 YHFGPDLPCLLQDKYLSQATSNYRAAQPVLLHIHVTDFPIFQHYQD-------KLFSLSS 310

Query: 176 DFDLFVTVVEAN--KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLE-LGVFDRYDYLC 232
            +   VTV +    K  +  +       QL + +        +L +L+   +   Y Y+ 
Sbjct: 311 QYQYLVTVAQPEMLKQLQTALAHLGDKVQLVLSQAS----HAWLAMLDQKEILQDYAYIG 366

Query: 233 KIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYK 292
            +   +        +     R  L   ++ ++D +   I   EQ   +G++     R  +
Sbjct: 367 HLSTHR--LVENQAVFDQAMRSDLINMMVYYADTS---IEALEQESAVGLVIPDLPRLVR 421

Query: 293 RWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLI 347
                 +      R+  + + A        +   +     G   W K   L  L  +  +
Sbjct: 422 --DGLFESEPPRPRLAAIWQEADLHKSFDCMTPPSLTRVYGGFVWFKYSALASLFQMKSL 479

Query: 348 GEFE-EERNLKDGALEHAVERFFACSVRYTEFSIE 381
                 E+ L D      +E         + +  +
Sbjct: 480 ESLPSSEQELSD-----VLEHLLVYLAWDSHYDFK 509


>gi|327461067|gb|EGF07400.1| rhamnosyltransferase [Streptococcus sanguinis SK1057]
          Length = 556

 Score = 54.2 bits (129), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 38/271 (14%), Positives = 80/271 (29%), Gaps = 31/271 (11%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDT--WIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +  + L  L+  +   
Sbjct: 258 YHFGPDLPCLLQDKYLSQATSNYRTNQPVLLHIHV--TDLPIFQQYQNKLFSLSSQYQYL 315

Query: 181 VTVVEAN--KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK 238
           VTV +    K  +  +       QL + + K       L   +  +   Y Y+  +    
Sbjct: 316 VTVTQPEMLKQLQTTLAHLGDKVQLVLSQ-KSHAWLAMLE--QKEILQDYAYIGHL---- 368

Query: 239 SQRE--GYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSF 296
           S         +     R  L   ++   D A   I   EQ   +G++     R  +    
Sbjct: 369 STHRIMENQAVFDQAMRSDLINLMV---DYADASIEALEQESAVGLVIPDLPRLVR--DG 423

Query: 297 FAKRSEVYRRVIDLAKRAGFPTKRLHLDFFN-----GTMFWVKPKCLEPLRNLHLIGEFE 351
             +   +  R+  + + AG       +   +     G   W K   L  +  +  +    
Sbjct: 424 LFESEPLRPRLAAIWQEAGLHKSFDFMTPPSLTRVYGGFVWFKYSALASVFRMKSLESLP 483

Query: 352 -EERNLKDGALEHAVERFFACSVRYTEFSIE 381
             E+   D      +E           +  +
Sbjct: 484 SSEQEFSD-----VLEHLLVYLAWDNHYDFK 509


>gi|323351266|ref|ZP_08086922.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           sanguinis VMC66]
 gi|322122490|gb|EFX94201.1| alpha-L-Rha alpha-1,2-L-rhamnosyltransferase/alpha-L-Rha
           alpha-1,3-L-rhamnosyltransferase [Streptococcus
           sanguinis VMC66]
          Length = 556

 Score = 52.6 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 38/270 (14%), Positives = 78/270 (28%), Gaps = 29/270 (10%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  ++  
Sbjct: 258 YHFGPDLPCLLQDKYLSQATSNYRTDQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYEYL 315

Query: 181 VTVVEANK-DFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKS 239
           +T  +       Q  L +  +    V+  K R     L   +  +   Y Y+  +   + 
Sbjct: 316 LTTNQPEVLKQLQTALGHLGNKVQIVLSQKSRAWLAMLE--QKEILQDYAYIGHLSTHR- 372

Query: 240 QREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAK 299
                  +     R  L   ++   D A   I   EQ   +G++     R  +      +
Sbjct: 373 -LVENQAVFDQAMRSDLINLMV---DYADASIEALEQESAVGLVIPDLPRLVR--DGLFE 426

Query: 300 RSEVYRRVIDLAKRAGFPTKRLHLDF--------FNGTMFWVKPKCLEPLRNLHLIGEFE 351
              +   +  + + AG        DF          G   W K   L  L  +  +    
Sbjct: 427 TEPLRPSLSAVWQEAGLHKS---FDFMTASSLTRVYGGFLWFKNSALASLFQMKSLESLP 483

Query: 352 EERNLKDGALEHAVERFFACSVRYTEFSIE 381
                 D  L   +E         + +  +
Sbjct: 484 S----SDQELSDVLEHLLVYLAWDSHYDFK 509


>gi|315221431|ref|ZP_07863352.1| rhamnan synthesis protein F [Streptococcus anginosus F0211]
 gi|315189550|gb|EFU23244.1| rhamnan synthesis protein F [Streptococcus anginosus F0211]
          Length = 555

 Score = 52.2 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/186 (16%), Positives = 55/186 (29%), Gaps = 19/186 (10%)

Query: 215 PFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEG-IIW-RRWLFFDLLGFSDIAIRII 271
           P L +  +      Y Y+  +    S       + G   W R  LF  ++   + +   I
Sbjct: 348 PLLAMFAQAERLKTYKYIGHL----STHTLIPEVAGLDQWMRDDLFNMMIENMNYS---I 400

Query: 272 NTFEQNPCLGMIGSRRYRRYKRWSFF----AKRSEVYRRVIDLAKRAGFPTKRLHLDFFN 327
           N  E    LG+I        +   F+     +  E   +++   K   F         + 
Sbjct: 401 NALEHCSNLGLIIPDLPSVVRNGLFYQKPLKEEMEKLWKLLSCRKSFKFTDAVTLTRVYG 460

Query: 328 GTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIESVDCVA 387
           G M W K + +E L        F      +   +    E           +  + +    
Sbjct: 461 GWM-WFKYEAVESLFKASFKT-FSSYSLQEQSTIL---ENLLVYVAWDKNYDFQIILLSQ 515

Query: 388 EYERLL 393
            +  LL
Sbjct: 516 SFPSLL 521


>gi|302186464|ref|ZP_07263137.1| glycosyl transferase family 2 [Pseudomonas syringae pv. syringae 642]
          Length = 1318

 Score = 51.8 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 33/85 (38%), Gaps = 11/85 (12%)

Query: 36   AHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFY 95
              + G    W  + ++  TS          F++   WL   +A +K    +F   R+ F 
Sbjct: 1229 GVMPG----WDNTARRPHTSFCFENATPGAFQA---WLEESIADTKEQ--NFGDERLVFV 1279

Query: 96   GSRKE--QKAFLRLNRFMSNSRMPF 118
             +  E  + A+L  +R   ++ +  
Sbjct: 1280 NAWNEWAEGAYLEPDRRFGHTYLEA 1304


>gi|257481987|ref|ZP_05636028.1| glycosyl transferase family 2 [Pseudomonas syringae pv. tabaci ATCC
            11528]
          Length = 1360

 Score = 51.8 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 33/85 (38%), Gaps = 11/85 (12%)

Query: 36   AHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFY 95
              + G    W  + ++  TS          F++   WL   +A +K    +F   R+ F 
Sbjct: 1271 GVMPG----WDNTARRPHTSFCFENATPGAFQA---WLEESIADTKEQ--NFGDERLVFV 1321

Query: 96   GSRKE--QKAFLRLNRFMSNSRMPF 118
             +  E  + A+L  +R   ++ +  
Sbjct: 1322 NAWNEWAEGAYLEPDRRFGHTYLEA 1346


>gi|330989699|gb|EGH87802.1| glycosyl transferase family 2 [Pseudomonas syringae pv. lachrymans
            str. M301315]
          Length = 1301

 Score = 51.8 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 33/85 (38%), Gaps = 11/85 (12%)

Query: 36   AHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFY 95
              + G    W  + ++  TS          F++   WL   +A +K    +F   R+ F 
Sbjct: 1212 GVMPG----WDNTARRPHTSFCFENATPGAFQA---WLEESIADTKEQ--NFGDERLVFV 1262

Query: 96   GSRKE--QKAFLRLNRFMSNSRMPF 118
             +  E  + A+L  +R   ++ +  
Sbjct: 1263 NAWNEWAEGAYLEPDRRFGHTYLEA 1287


>gi|331008848|gb|EGH88904.1| glycosyl transferase family 2 [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 846

 Score = 51.5 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 33/85 (38%), Gaps = 11/85 (12%)

Query: 36  AHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFY 95
             + G    W  + ++  TS          F++   WL   +A +K    +F   R+ F 
Sbjct: 757 GVMPG----WDNTARRPHTSFCFENATPGAFQA---WLEESIADTKEQ--NFGDERLVFV 807

Query: 96  GSRKE--QKAFLRLNRFMSNSRMPF 118
            +  E  + A+L  +R   ++ +  
Sbjct: 808 NAWNEWAEGAYLEPDRRFGHTYLEA 832


>gi|325067617|ref|ZP_08126290.1| hypothetical protein AoriK_07344 [Actinomyces oris K20]
          Length = 233

 Score = 51.1 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 27/80 (33%), Gaps = 3/80 (3%)

Query: 264 SDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHL 323
                 +I+ F ++P LG+          +    A    +      L++R G   +   L
Sbjct: 1   PGYVAGLIDLFARHPGLGVAMPAA-GHIGQAHGGATWDGLAGAATALSRRLGLTVELDPL 59

Query: 324 DF--FNGTMFWVKPKCLEPL 341
                 G MF  +P  L  L
Sbjct: 60  APVVPVGAMFLARPAALRTL 79


>gi|217420529|ref|ZP_03452034.1| glycosyltransferase, group 1 [Burkholderia pseudomallei 576]
 gi|217395941|gb|EEC35958.1| glycosyltransferase, group 1 [Burkholderia pseudomallei 576]
          Length = 1736

 Score = 49.5 bits (117), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 28/86 (32%), Gaps = 6/86 (6%)

Query: 40   GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
            G    W    ++             ++E ++F      +     ++  P  R+ F  +  
Sbjct: 992  GVTPSWDNEARKPGRGTVFVGSTPKLYEEWLF----NASVDTVRRIENPDERLVFINAWN 1047

Query: 100  E--QKAFLRLNRFMSNSRMPFDSEKF 123
            E  + A L  +R    + +   S+  
Sbjct: 1048 EWAEGAHLEPDRRYGYAWLQATSDAL 1073


>gi|221201094|ref|ZP_03574134.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2M]
 gi|221206454|ref|ZP_03579467.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2]
 gi|221173763|gb|EEE06197.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2]
 gi|221178944|gb|EEE11351.1| glycosyl transferase, group 1 [Burkholderia multivorans CGD2M]
          Length = 1714

 Score = 49.1 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 28/86 (32%), Gaps = 6/86 (6%)

Query: 40   GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
            G    W    ++             ++E    WL +    +   +++ P  R+ F  +  
Sbjct: 971  GVTPSWDNEARKPGRGTVFVGSTPKLYEE---WLCNAATDTVR-RIANPDERLVFINAWN 1026

Query: 100  E--QKAFLRLNRFMSNSRMPFDSEKF 123
            E  + A L  +R    + +   +   
Sbjct: 1027 EWAEGAHLEPDRRYGYAWLQATNNAL 1052


>gi|312100417|gb|ADQ27813.1| glycosyltransferase [Burkholderia pseudomallei]
 gi|312100462|gb|ADQ27848.1| putative glycosyltransferase [Burkholderia pseudomallei]
          Length = 1738

 Score = 48.8 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 26/86 (30%), Gaps = 6/86 (6%)

Query: 40   GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
            G    W    ++             ++E    WL +    +   ++  P  R+ F  +  
Sbjct: 995  GVTPSWDNEARKPGRGAVFVGSTPKLYEE---WLLNAATDTV-ERIDNPDERLVFINAWN 1050

Query: 100  E--QKAFLRLNRFMSNSRMPFDSEKF 123
            E  + A L  +R    + +       
Sbjct: 1051 EWAEGAHLEPDRRYGYAWLQATRNAL 1076


>gi|312100431|gb|ADQ27825.1| glycosyltransferase [Burkholderia pseudomallei]
          Length = 1706

 Score = 48.8 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 26/86 (30%), Gaps = 6/86 (6%)

Query: 40   GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
            G    W    ++             ++E    WL +    +   ++  P  R+ F  +  
Sbjct: 963  GVTPSWDNEARKPGRGAVFVGSTPKLYEE---WLLNAATDTV-ERIDNPDERLVFINAWN 1018

Query: 100  E--QKAFLRLNRFMSNSRMPFDSEKF 123
            E  + A L  +R    + +       
Sbjct: 1019 EWAEGAHLEPDRRYGYAWLQATRNAL 1044


>gi|94972405|ref|YP_595623.1| hypothetical protein LIC007 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731942|emb|CAJ53959.1| conserved hypothetical protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 789

 Score = 48.8 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/136 (17%), Positives = 46/136 (33%), Gaps = 23/136 (16%)

Query: 23  VEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKY 82
           V++      +Y P    G    W  +P++   S           +++  WL     F+  
Sbjct: 315 VKDYTTKYTLY-PCVFPG----WDNTPRRLYFSSIFACSTP---QAYRQWLTDACTFA-- 364

Query: 83  SKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSP 140
           S       R  F  +  E  + A L  N+    + +   S        + E +   PS+ 
Sbjct: 365 STTHEKDNRFVFINAWNEWAEGAHLEPNKAYGYAYLNATS-------RVVENFAVPPSTA 417

Query: 141 KKSGLTIKSKIAIVVH 156
           + +      K+ +V H
Sbjct: 418 ENNP----HKVLVVGH 429


>gi|167903945|ref|ZP_02491150.1| glycosyl transferase, group 1 [Burkholderia pseudomallei NCTC 13177]
          Length = 1741

 Score = 48.0 bits (113), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/83 (14%), Positives = 27/83 (32%), Gaps = 6/83 (7%)

Query: 40   GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
            G    W    ++             ++E ++F      +     ++  P  R+ F  +  
Sbjct: 997  GVTPSWDNEARKPGRGTVFVGSTPKLYEEWLF----NASVDTVRRIENPDERLVFINAWN 1052

Query: 100  E--QKAFLRLNRFMSNSRMPFDS 120
            E  + A L  +R    + +   S
Sbjct: 1053 EWAEGAHLEPDRRYGYAWLQATS 1075


>gi|293407666|gb|ADE44320.1| putative glycosyl transferase [Burkholderia pseudomallei]
          Length = 740

 Score = 48.0 bits (113), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 26/86 (30%), Gaps = 6/86 (6%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           G    W    ++             ++E    WL +    +   ++  P  R+ F  +  
Sbjct: 381 GVTPSWDNEARKPGRGAVFVGSTPKLYEE---WLLNAATDTV-ERIDNPDERLVFINAWN 436

Query: 100 E--QKAFLRLNRFMSNSRMPFDSEKF 123
           E  + A L  +R    + +       
Sbjct: 437 EWAEGAHLEPDRRYGYAWLQATRNAL 462


>gi|323139972|ref|ZP_08074990.1| glycosyl transferase family 2 [Methylocystis sp. ATCC 49242]
 gi|322394772|gb|EFX97355.1| glycosyl transferase family 2 [Methylocystis sp. ATCC 49242]
          Length = 984

 Score = 47.6 bits (112), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/98 (13%), Positives = 38/98 (38%), Gaps = 7/98 (7%)

Query: 42  YVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE- 100
            V W  +P+    S  +       F++++ W      + +  + ++   RI F  +  E 
Sbjct: 892 LVGWDNTPRHPDNSLILEQSTPGAFQAWLEW-----TYRRTIEQNYGDARIVFINAWNEW 946

Query: 101 -QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRP 137
            + ++L  +R   ++ +         +    + + ++P
Sbjct: 947 CEGSYLEPDRHFGHAYLQALRNAQESIASGSDSFVEKP 984


>gi|92116633|ref|YP_576362.1| lipopolysaccharide biosynthesis protein [Nitrobacter hamburgensis
           X14]
 gi|91799527|gb|ABE61902.1| lipopolysaccharide biosynthesis protein [Nitrobacter hamburgensis
           X14]
          Length = 734

 Score = 47.2 bits (111), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/91 (19%), Positives = 30/91 (32%), Gaps = 12/91 (13%)

Query: 33  YIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRI 92
           Y PA +      W  +P++       +      FE    WLR     ++ S  + P   I
Sbjct: 454 YFPAVMP----RWDNTPRKGSRGHIFNRSSPEAFE---VWLRDAANRARKSAFAEP---I 503

Query: 93  FFYGSRKE--QKAFLRLNRFMSNSRMPFDSE 121
            F  S  E  + A L  +     + +     
Sbjct: 504 VFINSWNEWAEGAHLEPDSRYGRAFLEAVRR 534


>gi|75674736|ref|YP_317157.1| lipopolysaccharide biosynthesis protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74419606|gb|ABA03805.1| lipopolysaccharide biosynthesis protein [Nitrobacter winogradskyi
           Nb-255]
          Length = 734

 Score = 46.8 bits (110), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 29/91 (31%), Gaps = 12/91 (13%)

Query: 33  YIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRI 92
           Y PA +      W  +P++       +      FE    WLR     ++    + P   I
Sbjct: 454 YFPAVMP----RWDNTPRKGSRGHVFNRSSPEAFE---VWLRDATGRARRGPFAEP---I 503

Query: 93  FFYGSRKE--QKAFLRLNRFMSNSRMPFDSE 121
            F  S  E  + A L  +     + +     
Sbjct: 504 VFINSWNEWAEGAHLEPDSRYGRAFLEAVRR 534


>gi|46241633|gb|AAS83018.1| hypothetical protein pRhico010 [Azospirillum brasilense]
          Length = 1380

 Score = 46.8 bits (110), Expect = 0.006,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 36/93 (38%), Gaps = 8/93 (8%)

Query: 42  YVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE- 100
           +  W    +++      H       E++  W+   +A++K +   F + R+ F  +  E 
Sbjct: 652 FPSWDNDARRQGRGAVYHGSTP---ENYRRWMEGVIAYAKAN--PFHNERMMFINAWNEW 706

Query: 101 -QKAFLRLNRFMSNSRMPFDSEKFLYVKELFEG 132
            + A+L  +     + +   +    Y +   EG
Sbjct: 707 AEGAYLEPDLHFGAAYLNATARAI-YGRRQVEG 738


>gi|296445524|ref|ZP_06887480.1| lipopolysaccharide biosynthesis protein-like protein [Methylosinus
           trichosporium OB3b]
 gi|296256929|gb|EFH04000.1| lipopolysaccharide biosynthesis protein-like protein [Methylosinus
           trichosporium OB3b]
          Length = 431

 Score = 45.7 bits (107), Expect = 0.014,   Method: Composition-based stats.
 Identities = 13/90 (14%), Positives = 26/90 (28%), Gaps = 6/90 (6%)

Query: 39  SGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSR 98
            G    W    ++             ++E    WL      +  +       RI F  + 
Sbjct: 296 PGVCPSWDNEARRPGKGSCFAGASPRLYED---WLTGACR-AVLTDAQTRDERIVFINAW 351

Query: 99  KE--QKAFLRLNRFMSNSRMPFDSEKFLYV 126
            E  + A+L  +R    + +   +     V
Sbjct: 352 NEWGEGAYLEPDRHYGYAYLVATANALRRV 381


>gi|85713620|ref|ZP_01044610.1| lipopolysaccharide biosynthesis protein [Nitrobacter sp. Nb-311A]
 gi|85699524|gb|EAQ37391.1| lipopolysaccharide biosynthesis protein [Nitrobacter sp. Nb-311A]
          Length = 734

 Score = 44.9 bits (105), Expect = 0.022,   Method: Composition-based stats.
 Identities = 16/89 (17%), Positives = 28/89 (31%), Gaps = 12/89 (13%)

Query: 35  PAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFF 94
           PA +      W  +P++       +      FE    WLR     ++    + P   I F
Sbjct: 456 PAVMP----RWDNTPRKGSRGHIFNRSSPEAFE---VWLRDAAGRARREPFAEP---IVF 505

Query: 95  YGSRKE--QKAFLRLNRFMSNSRMPFDSE 121
             S  E  + A L  +     + +     
Sbjct: 506 INSWNEWAEGAHLEPDSRYGRAFLEAVRR 534


>gi|118580521|ref|YP_901771.1| polysaccharide biosynthesis protein [Pelobacter propionicus DSM
           2379]
 gi|118503231|gb|ABK99713.1| polysaccharide biosynthesis protein [Pelobacter propionicus DSM
           2379]
          Length = 363

 Score = 44.5 bits (104), Expect = 0.026,   Method: Composition-based stats.
 Identities = 14/113 (12%), Positives = 36/113 (31%), Gaps = 13/113 (11%)

Query: 19  LRLDVEEKGNMQAIYIPAHVSGYYVL------WSFSPKQRITSKDVHFQELSIFESFIFW 72
           L+  + E  ++    +   +  Y         +  SP+++  S   H     +   +  W
Sbjct: 252 LKHQIYEYSSLVDAMLGKELPTYPFYRCVCPSFDNSPRRKTDSVVFHNSTPEL---YFRW 308

Query: 73  LRSFLAFSKYSKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKF 123
           L   + ++  +    P  R+ F  +  E  +   L  +       +    +  
Sbjct: 309 LNEVVEWTSCNH--SPEERLVFVNAWNEWGEGNHLEPDLRWGKQYLEKTRQAI 359


>gi|125718317|ref|YP_001035450.1| lipopolysaccharide biosynthesis protein, putative [Streptococcus
           sanguinis SK36]
 gi|125498234|gb|ABN44900.1| Lipopolysaccharide biosynthesis protein, putative [Streptococcus
           sanguinis SK36]
          Length = 556

 Score = 44.5 bits (104), Expect = 0.029,   Method: Composition-based stats.
 Identities = 36/271 (13%), Positives = 76/271 (28%), Gaps = 31/271 (11%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  +   
Sbjct: 258 YYFGPDLPCLLQDKYLSQATSNYRTVQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYQYL 315

Query: 181 VTVVEAN--KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK 238
           +T  +    K  +  +       Q+ + + K       L   +  +   Y Y+  +   +
Sbjct: 316 LTTNQPEVLKQLQTALGHLGNKVQIILSQ-KSHAWLAMLE--QKEILQNYAYIGHLSTHR 372

Query: 239 SQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA 298
                   +     R  L   ++   D A   I   EQ+   G++     R  +      
Sbjct: 373 --LVENQAVFDQAMRSDLINMMV---DYADASIEALEQDSAEGLVIPDLPRLVR--DGLF 425

Query: 299 KRSEVYRRVIDLAKRAGFPTKRLHLDF--------FNGTMFWVKPKCLEPLRNLHLIGEF 350
           +       +  + + AG        DF          G   W K   L  L  +  +   
Sbjct: 426 EIEPPRPSLSAVWQEAGLHKS---FDFMTASSLTRVYGGFLWFKNSALASLFQMKSLESL 482

Query: 351 EEERNLKDGALEHAVERFFACSVRYTEFSIE 381
                  D  L   +E         + +  +
Sbjct: 483 PS----SDQELSDVLEHLLVYLAWDSHYDFK 509


>gi|190572675|ref|YP_001970520.1| putative glycosyl transferase [Stenotrophomonas maltophilia K279a]
 gi|190010597|emb|CAQ44206.1| putative glycosyl transferase [Stenotrophomonas maltophilia K279a]
          Length = 436

 Score = 44.5 bits (104), Expect = 0.031,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 34/86 (39%), Gaps = 7/86 (8%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           G    W  + +++ TS  +     SI++   +WLR  + +++ +  + P  +I F  +  
Sbjct: 268 GIVPSWDNTARRQHTSHTLVDASPSIYQ---YWLRRLVEYTRVN--NAPEDQILFINAWN 322

Query: 100 E--QKAFLRLNRFMSNSRMPFDSEKF 123
           E  +   L  +     + +       
Sbjct: 323 EWGEGCHLEPDLKHGLAYLEATHAAL 348


>gi|325687210|gb|EGD29232.1| rhamnosyltransferase [Streptococcus sanguinis SK72]
          Length = 556

 Score = 44.1 bits (103), Expect = 0.042,   Method: Composition-based stats.
 Identities = 36/271 (13%), Positives = 76/271 (28%), Gaps = 31/271 (11%)

Query: 123 FLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQD--TWIEISHILLRLNFDFDLF 180
           + +  +L     D+  S   S       + + +H    D   + +    L  L+  +   
Sbjct: 258 YYFGPDLPCLLQDKYLSQATSNYRTVQPVLLHIHV--TDFPIFQQYQDKLFSLSSQYQYL 315

Query: 181 VTVVEAN--KDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKK 238
           +T  +    K  +  +       Q+ + + K       L   +  +   Y Y+  +   +
Sbjct: 316 LTTNQPEVLKQLQTALGHLGNKVQIILSQ-KSHAWLAMLE--QKEILQNYAYIGHLSTHR 372

Query: 239 SQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA 298
                   +     R  L   ++   D A   I   EQ+   G++     R  +      
Sbjct: 373 --LVENQAVFDQTMRSDLINMMV---DYADASIEALEQDSAEGLVIPDLPRLVR--DGLF 425

Query: 299 KRSEVYRRVIDLAKRAGFPTKRLHLDF--------FNGTMFWVKPKCLEPLRNLHLIGEF 350
           +       +  + + AG        DF          G   W K   L  L  +  +   
Sbjct: 426 EIEPPRPSLSAVWQEAGLHKS---FDFMTASSLTRVYGGFLWFKNSALASLFQMKSLESL 482

Query: 351 EEERNLKDGALEHAVERFFACSVRYTEFSIE 381
                  D  L   +E         + +  +
Sbjct: 483 PS----SDQELSDVLEHLLVYLAWDSHYDFK 509


>gi|294675724|ref|YP_003576339.1| family 2 glycosyl transferase [Rhodobacter capsulatus SB 1003]
 gi|294474544|gb|ADE83932.1| glycosyl transferase, family 2/group 1 [Rhodobacter capsulatus SB
            1003]
          Length = 1993

 Score = 43.0 bits (100), Expect = 0.076,   Method: Composition-based stats.
 Identities = 9/81 (11%), Positives = 24/81 (29%), Gaps = 6/81 (7%)

Query: 45   WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
            W  + +++           +    +  WL + +  +       P  R+ F  +  E  + 
Sbjct: 1261 WDNTARRKNKGAIFANSNPA---EYRVWLENAVTRTLADA-RTPDERVIFVNAWNEWAEG 1316

Query: 103  AFLRLNRFMSNSRMPFDSEKF 123
            A L  +     + +       
Sbjct: 1317 AHLEPDTKYGYAYLEASRAAL 1337


>gi|113476766|ref|YP_722827.1| hypothetical protein Tery_3239 [Trichodesmium erythraeum IMS101]
 gi|110167814|gb|ABG52354.1| Tetratricopeptide TPR_2 [Trichodesmium erythraeum IMS101]
          Length = 955

 Score = 43.0 bits (100), Expect = 0.091,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 29/82 (35%), Gaps = 7/82 (8%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W  + +++  +      E    E + FWLR      K  K    S  I F  +  E  + 
Sbjct: 673 WDNTARRQQNATVWLNSEP---EDYEFWLRG--TTEKALKNYGDSENIVFINAWNEWAEG 727

Query: 103 AFLRLNRFMSNSRMPFDSEKFL 124
           A+L  ++    + +       L
Sbjct: 728 AYLEPDKKYGCAYLEATQRVLL 749


>gi|30248500|ref|NP_840570.1| hypothetical protein NE0485 [Nitrosomonas europaea ATCC 19718]
 gi|30138386|emb|CAD84396.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 445

 Score = 42.6 bits (99), Expect = 0.096,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 30/86 (34%), Gaps = 7/86 (8%)

Query: 44  LWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--Q 101
           +W  S ++             ++E    WL   L  +K ++       I F  +  E  +
Sbjct: 364 MWDNSARRDNKGMIFEGASPDLYER---WLTDILLEAK-NREDLEDHYI-FINAWNEWGE 418

Query: 102 KAFLRLNRFMSNSRMPFDSEKFLYVK 127
            A+L  ++    + +    +    V+
Sbjct: 419 GAYLEPDKKYGYAYLNATRQAIEGVR 444


>gi|254788145|ref|YP_003075574.1| glycosyltransferase family 2 domain-containing protein
           [Teredinibacter turnerae T7901]
 gi|237685039|gb|ACR12303.1| glycosyltransferase family 2 domain protein [Teredinibacter
           turnerae T7901]
          Length = 307

 Score = 42.6 bits (99), Expect = 0.12,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 44/131 (33%), Gaps = 32/131 (24%)

Query: 161 DTWIEISHILLRLNFDFDLFVTV----VEANKDFEQDVLKYFPSAQLYVMENKG-RDVRP 215
           +   +    +       DL+V V     +       D  + +P  Q+   EN+G R V P
Sbjct: 14  EFMRKTLDSVCNQTVPPDLWVVVDDGSTDETPAILADYSERYPFIQVITRENRGHRSVGP 73

Query: 216 -----FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRI 270
                F Y  +     ++DY+CK                      L  DL         +
Sbjct: 74  GVIEAFYYGYDKIDVSQFDYVCKF--------------------DLDLDL--PPRYFEIL 111

Query: 271 INTFEQNPCLG 281
           I+  E+NP LG
Sbjct: 112 IDRMEKNPRLG 122


>gi|330826738|ref|YP_004390041.1| family 2 glycosyl transferase [Alicycliphilus denitrificans K601]
 gi|329312110|gb|AEB86525.1| glycosyl transferase family 2 [Alicycliphilus denitrificans K601]
          Length = 1669

 Score = 41.4 bits (96), Expect = 0.25,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 30/94 (31%), Gaps = 8/94 (8%)

Query: 40  GYYVLWSFSPKQRITSKDV-HFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSR 98
           G    W  + ++R     V H     ++E    WLR     ++  +      RI F  + 
Sbjct: 702 GIVPAWDNAARRRKGGATVIHGSTPQLYEK---WLRG--TVARTLEEREGDERIVFINAW 756

Query: 99  KE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELF 130
            E  +  +L  +    ++ +           +  
Sbjct: 757 NEWGEGCYLEPDEKFGHAYLEATQRVLRDPPQAL 790


>gi|319764522|ref|YP_004128459.1| glycosyl transferase family 2 [Alicycliphilus denitrificans BC]
 gi|317119083|gb|ADV01572.1| glycosyl transferase family 2 [Alicycliphilus denitrificans BC]
          Length = 1669

 Score = 41.4 bits (96), Expect = 0.25,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 30/94 (31%), Gaps = 8/94 (8%)

Query: 40  GYYVLWSFSPKQRITSKDV-HFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSR 98
           G    W  + ++R     V H     ++E    WLR     ++  +      RI F  + 
Sbjct: 702 GIVPAWDNAARRRKGGATVIHGSTPQLYEK---WLRG--TVARTLEEREGDERIVFINAW 756

Query: 99  KE--QKAFLRLNRFMSNSRMPFDSEKFLYVKELF 130
            E  +  +L  +    ++ +           +  
Sbjct: 757 NEWGEGCYLEPDEKFGHAYLEATQRVLRDPPQAL 790


>gi|55846838|gb|AAV67424.1| glycosyltransferase [Xanthomonas oryzae pv. oryzicola]
          Length = 464

 Score = 41.1 bits (95), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 33/86 (38%), Gaps = 7/86 (8%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           G    W  + +++ TS  +     SI++   +WL   + +++ +  + P  ++ F  +  
Sbjct: 268 GIVPSWDNTARRQHTSHILLNSSPSIYQ---YWLGRLVDYTRVN--NAPEDQLIFINAWN 322

Query: 100 E--QKAFLRLNRFMSNSRMPFDSEKF 123
           E  +   L  +     + +       
Sbjct: 323 EWGEGCHLEPDLKHGLAYLEATHAAV 348


>gi|229112680|ref|ZP_04242216.1| Glycosytransferase [Bacillus cereus Rock1-15]
 gi|228670812|gb|EEL26120.1| Glycosytransferase [Bacillus cereus Rock1-15]
          Length = 355

 Score = 41.1 bits (95), Expect = 0.30,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 39/92 (42%), Gaps = 8/92 (8%)

Query: 122 KFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVH-----CYYQDTWIEISHILLRLNFD 176
           K +++     G   R     K G   K K+ + +H      +YQ++  +I + +  +   
Sbjct: 73  KIMHIHTASRGSFFRKRIFVKLGKLFKKKVVLHIHGAEFMVFYQESSEDIRNQIREILNQ 132

Query: 177 FDLFVTVVEANKDFEQDVLKYFPSAQLYVMEN 208
            D+ +T+ +  K+  + +     +  + V+ N
Sbjct: 133 VDVIITLSQKWKEDIESIT---NNRNVKVIYN 161


>gi|166713475|ref|ZP_02244682.1| Tetratricopeptide TPR_2 [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 374

 Score = 41.1 bits (95), Expect = 0.31,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 33/86 (38%), Gaps = 7/86 (8%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           G    W  + +++ TS  +     SI++   +WL   + +++ +  + P  ++ F  +  
Sbjct: 205 GIVPSWDNTARRQHTSHILLNSSPSIYQ---YWLGRLVDYTRVN--NAPEDQLIFINAWN 259

Query: 100 E--QKAFLRLNRFMSNSRMPFDSEKF 123
           E  +   L  +     + +       
Sbjct: 260 EWGEGCHLEPDLKHGLAYLEATHAAV 285


>gi|87201246|ref|YP_498503.1| polysaccharide biosynthesis protein [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136927|gb|ABD27669.1| polysaccharide biosynthesis protein [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 377

 Score = 40.3 bits (93), Expect = 0.56,   Method: Composition-based stats.
 Identities = 11/81 (13%), Positives = 29/81 (35%), Gaps = 7/81 (8%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W  S +++             +     WLR  +A+++ +  + P  R  F  +  E  + 
Sbjct: 292 WDNSARKKNRPLIFVGSTPERYGR---WLREMVAWTRRN--APPERRFIFINAWNEWAEG 346

Query: 103 AFLRLNRFMSNSRMPFDSEKF 123
             L  ++   ++ +   +   
Sbjct: 347 NHLEPDQRNGHANLEATARAL 367


>gi|264678899|ref|YP_003278806.1| hyaluronan synthase [Comamonas testosteroni CNB-2]
 gi|262209412|gb|ACY33510.1| hyaluronan synthase [Comamonas testosteroni CNB-2]
          Length = 795

 Score = 39.9 bits (92), Expect = 0.76,   Method: Composition-based stats.
 Identities = 11/87 (12%), Positives = 22/87 (25%), Gaps = 6/87 (6%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W    ++              +E    WL+S LA     +         F  +  E  + 
Sbjct: 67  WDNEARKPGRGMGFVGATPEKYER---WLKS-LARRAVERPLLGKQPYVFVNAWNEWAEG 122

Query: 103 AFLRLNRFMSNSRMPFDSEKFLYVKEL 129
           A L  +     + +            +
Sbjct: 123 ALLEPDLHYGYAYLNATFRALTNTPRV 149


>gi|313199878|ref|YP_004038536.1| polysaccharide biosynthesis protein [Methylovorus sp. MP688]
 gi|312439194|gb|ADQ83300.1| polysaccharide biosynthesis protein [Methylovorus sp. MP688]
          Length = 379

 Score = 39.5 bits (91), Expect = 0.93,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 32/87 (36%), Gaps = 10/87 (11%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLA-FSKYSKLSFPSCRIFFYGSRKE--Q 101
           W  S ++R  +  +   +  +FE    WLR+  +  SKY K      RI F  +  E  +
Sbjct: 300 WDKSARRRAGATVIQNHDPKLFE---LWLRNASSRVSKYPK----DERIIFINAWNEWAE 352

Query: 102 KAFLRLNRFMSNSRMPFDSEKFLYVKE 128
              L  +    +  +      F   K 
Sbjct: 353 GCHLEPDLRHGHQFLEAVRNVFGSKKH 379


>gi|331211817|ref|XP_003307178.1| hypothetical protein PGTG_00128 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309297581|gb|EFP74172.1| hypothetical protein PGTG_00128 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 311

 Score = 39.1 bits (90), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 38/96 (39%), Gaps = 8/96 (8%)

Query: 295 SFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEER 354
           S  A  + + R   D+         +  + +FNG+M W+K K L       L  EFE + 
Sbjct: 10  SSNAHNAFMGRNRRDIDSHHFLGPIKSRVTYFNGSMTWMKGKALVKNGEEDLFCEFEGDP 69

Query: 355 NLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYE 390
           N         +ER F  +V+         D V+E E
Sbjct: 70  N--------FIERRFGGNVKRPREKTMDEDHVSEEE 97


>gi|160894490|ref|ZP_02075266.1| hypothetical protein CLOL250_02042 [Clostridium sp. L2-50]
 gi|156863801|gb|EDO57232.1| hypothetical protein CLOL250_02042 [Clostridium sp. L2-50]
          Length = 783

 Score = 38.7 bits (89), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 43/122 (35%), Gaps = 7/122 (5%)

Query: 227 RYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFD-LLGFSDIAIRIINTFEQNPCLGMIGS 285
            Y+Y+C +  +       +   G     W+  + +LG       I++    N  +G++  
Sbjct: 369 EYEYICFLVNEDRSYIAENLDNGHT--GWIIENSILGKGVSLGNIVSCLNDNSGIGLVYP 426

Query: 286 RRYRRYKRWS-FFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNG---TMFWVKPKCLEPL 341
               +   +S  + +R  +   +  + + +        +    G     FW + + L+ L
Sbjct: 427 PNSSQSLYYSRQYKERELISCEIQQILEDSDIHLNIAKVRGSIGQYTGCFWCRSQVLQNL 486

Query: 342 RN 343
             
Sbjct: 487 TE 488


>gi|254431846|ref|ZP_05045549.1| hypothetical protein CPCC7001_1737 [Cyanobium sp. PCC 7001]
 gi|197626299|gb|EDY38858.1| hypothetical protein CPCC7001_1737 [Cyanobium sp. PCC 7001]
          Length = 205

 Score = 38.7 bits (89), Expect = 1.7,   Method: Composition-based stats.
 Identities = 33/179 (18%), Positives = 52/179 (29%), Gaps = 33/179 (18%)

Query: 205 VMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFS 264
            + N G D   F +L   G F       K+  KKS         G+ W       +    
Sbjct: 29  RVTNYGEDWSSFHHLFYSGAFSSRGATFKLQTKKS--SNLGADGGMAWVDEALQPIASSY 86

Query: 265 DIAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLH-L 323
                +I   +    + +  S    +  + + F    ++    I    R G   +     
Sbjct: 87  RATATVIKNLKAG-TIKLAAS----KLCKRTGFGANPQLVAEYIH---RLGLNEQSAKRQ 138

Query: 324 DFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKD-------GA------LEHAVERFF 369
            F  G+MF           +  LI  F       D       G+        HA+ER F
Sbjct: 139 SFCMGSMFAA---------DNDLIQLFYSSLGDVDYRITSDGGSQFCGRYPGHAIERAF 188


>gi|253755287|ref|YP_003028427.1| rhamnan synthesis protein F family protein [Streptococcus suis
           BM407]
 gi|251817751|emb|CAZ55503.1| rhamnan synthesis protein F family protein [Streptococcus suis
           BM407]
          Length = 574

 Score = 38.7 bits (89), Expect = 1.7,   Method: Composition-based stats.
 Identities = 36/222 (16%), Positives = 76/222 (34%), Gaps = 27/222 (12%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEA----NKDFEQDVLKYFP-SA 201
             + + + +H      + E    L +++    L +T+ E     N    +  L  +   A
Sbjct: 281 SSTSVLLHIHIESVSIFEEYIEELCKISDRCQLLITLPETDFSNNFSIVERYLSTYKLRA 340

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKI---HGKKSQREGYHPIEGIIWRRWLFF 258
           Q+  +     D   F  ++   + D   YL  I      K++      I+    R+  F 
Sbjct: 341 QIVKLT----DELHFFEIVNNYMGDA-KYLAHITVKQTNKTKYSVEDIIDRYQLRKMFFT 395

Query: 259 DLLGFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA-- 314
                      +I+ FE    L ++       +RY R S      E+ R++  L +    
Sbjct: 396 S-------FDAVISNFESQSNLAVVIPDLTTNQRYDRKSLREGNPELIRQLNILYESLVR 448

Query: 315 GFPTKRLHLDFFNG---TMFWVKPKCLEPLRNLHLIGEFEEE 353
                   + +  G   + +W+K +  + +       +F +E
Sbjct: 449 TKKVDFYKVPYIIGEEVSWYWIKTEHYKKIEEKFRNIDFSKE 490


>gi|319784640|ref|YP_004144116.1| hypothetical protein Mesci_4961 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170528|gb|ADV14066.1| hypothetical protein Mesci_4961 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 936

 Score = 38.7 bits (89), Expect = 1.8,   Method: Composition-based stats.
 Identities = 24/170 (14%), Positives = 62/170 (36%), Gaps = 20/170 (11%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W  + + +  S  V    ++ +E    WLR   + ++ ++      ++ F  +  E  + 
Sbjct: 270 WDNTARVKNRSLIVLGSTVANYER---WLRGSSSLTRANR--AEGDQLVFINAWNEWAEG 324

Query: 103 AFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYYQDT 162
            +L  +R      +     +      + +   D   +P++    ++ ++A +      + 
Sbjct: 325 CYLEPDRRHGRGFLEAT-LRVKNGMSMVDDIYD--VAPERVRFELRQQLAAI-----PEE 376

Query: 163 W--IEISH-ILLRLNFDFDLF--VTVVEANKDFEQDVLKYFPSAQLYVME 207
               EI+     ++    DL   VT+++      Q   +  P  Q  + E
Sbjct: 377 ARDAEIAKLRAAKIREVADLDGKVTLLKQEASRLQSGNETAPEPQREITE 426


>gi|253682781|ref|ZP_04863576.1| putative formyl-CoA transferase [Clostridium botulinum D str. 1873]
 gi|253560980|gb|EES90434.1| putative formyl-CoA transferase [Clostridium botulinum D str. 1873]
          Length = 391

 Score = 38.4 bits (88), Expect = 1.8,   Method: Composition-based stats.
 Identities = 22/108 (20%), Positives = 34/108 (31%), Gaps = 21/108 (19%)

Query: 236 GKKSQREGYHPIEGIIWRRWLFFDLLGFSDIA-----IRIINTF--------EQNPCL-- 280
            KKS    YH  EG      +   L+  +D+         + +F        E NP L  
Sbjct: 63  SKKSITINYHKSEGA----EIIKRLVKNTDMIIFNEPEEKLKSFGLGFPELKEVNPKLVY 118

Query: 281 GMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNG 328
           G++    +     W        +      L ++ G P K     F  G
Sbjct: 119 GILTP--FGEEGPWKDMPDYDLIIMARTGLLEKTGMPEKPTKFGFPLG 164


>gi|312278781|gb|ADQ63438.1| Rhamnosyltransferase [Streptococcus thermophilus ND03]
          Length = 547

 Score = 38.4 bits (88), Expect = 2.0,   Method: Composition-based stats.
 Identities = 31/198 (15%), Positives = 61/198 (30%), Gaps = 29/198 (14%)

Query: 152 AIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVE--ANKDFEQDVLKYFPSAQLYVM--- 206
           AI VH    D   E   +          + T+         E  +L  F   +  ++   
Sbjct: 287 AIHVHI--SDL--ERLKVFSDKKLSAFYYFTLSSHLDKNIVENTLLNSFDKDRFQLVSQK 342

Query: 207 -ENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
            +N        + L     F  YD++   H    +  G          R    ++L   +
Sbjct: 343 FDNH---YYALVSLASQ--FSEYDFVGHFHT---EDFGNEGKFVDEATRLALVNMLLDEE 394

Query: 266 IAIRIINTFEQNPCLGMIGSRRYRRYKRWSFFA--KRSEVYRRVIDLAKRAGFPTKRLHL 323
               I + F   P +G++ +   +            +++  +   +  K       +  L
Sbjct: 395 RVASIFDHF---PEVGLVFADLSKELYWTDAIGTLNQNQAAKLDNECQKTI-----KNSL 446

Query: 324 DFFNGTMFWVKPKCLEPL 341
             F G+M W+    LE +
Sbjct: 447 HVFQGSM-WLSKDFLEKI 463


>gi|302024024|ref|ZP_07249235.1| polysaccharide biosynthesis protein [Streptococcus suis 05HAS68]
          Length = 587

 Score = 38.0 bits (87), Expect = 2.6,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 78/215 (36%), Gaps = 13/215 (6%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN-KDFEQDVLKYFPSAQLYV 205
             + + + VH      + E    L +++    L +T+ E +  +    V +Y  + +L  
Sbjct: 294 SSTSVLLHVHIESVSIFEEYIEELCKISDRCQLLITLPETDFSNKCSIVERYLSTYKLRA 353

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
              K  D   F  ++   + D   YL  +  K+++   Y   + I  R  L        D
Sbjct: 354 QIAKLTDELHFFEIVNNYMGDA-KYLAHVTVKQTKEIKYSVEDIID-RHQLRKMFFTSFD 411

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA--GFPTKRL 321
                I+ FE    L ++       +RY R S      E+ R++  L +           
Sbjct: 412 AV---ISNFESQSNLAVVIPDLTTNQRYDRQSLREGNPELIRQLNILYESLVRTKKVDFY 468

Query: 322 HLDFFNG---TMFWVKPKCLEPLRNLHLIGEFEEE 353
            + +  G   + +W+K +  + +       +F +E
Sbjct: 469 KVPYIIGEEVSWYWIKTEDYKKIEEKFRNIDFSKE 503


>gi|302388250|ref|YP_003824072.1| L-carnitine dehydratase/bile acid-inducible protein F [Clostridium
           saccharolyticum WM1]
 gi|302198878|gb|ADL06449.1| L-carnitine dehydratase/bile acid-inducible protein F [Clostridium
           saccharolyticum WM1]
          Length = 394

 Score = 38.0 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 34/104 (32%), Gaps = 13/104 (12%)

Query: 236 GKKSQREGYHPIEGIIWRRWL---FFDLLGFS--DIAIRIINTFE----QNPCL--GMIG 284
           GKKS     +   G    R L   F  L+     +    +   FE    +NP L  G++ 
Sbjct: 62  GKKSMTLDINKEAGQEIIRRLIPQFDMLIVNKKEEDMKALGLGFESLKEKNPKLIYGVLT 121

Query: 285 SRRYRRYKRWSFFAKRSEVYRRVIDLAKRAGFPTKRLHLDFFNG 328
              Y     W        +      L ++ GFP K     F  G
Sbjct: 122 P--YGENGPWKDMPDYDLLINSRSGLQEKTGFPEKPTKFGFPLG 163


>gi|223933250|ref|ZP_03625240.1| Rhamnan synthesis F [Streptococcus suis 89/1591]
 gi|330832517|ref|YP_004401342.1| Rhamnan synthesis F [Streptococcus suis ST3]
 gi|223898064|gb|EEF64435.1| Rhamnan synthesis F [Streptococcus suis 89/1591]
 gi|329306740|gb|AEB81156.1| Rhamnan synthesis F [Streptococcus suis ST3]
          Length = 574

 Score = 38.0 bits (87), Expect = 2.8,   Method: Composition-based stats.
 Identities = 38/215 (17%), Positives = 78/215 (36%), Gaps = 13/215 (6%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN-KDFEQDVLKYFPSAQLYV 205
             + + + VH      + E    L +++    L +T+ E +  +    V +Y  + +L  
Sbjct: 281 SSTSVLLHVHIESVSIFEEYIEELCKISDRCQLLITLPETDFSNKCSIVERYLSTYKLRA 340

Query: 206 MENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSD 265
              K  D   F  ++   + D   YL  +  K+++   Y   + I  R  L        D
Sbjct: 341 QIAKLTDELHFFEIVNNYMGDA-KYLAHVTVKQTKEIKYSVEDIID-RHQLRKMFFTSFD 398

Query: 266 IAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA--GFPTKRL 321
                I+ FE    L ++       +RY R S      E+ R++  L +           
Sbjct: 399 AV---ISNFESQSNLAVVIPDLTTNQRYDRQSLREGNPELIRQLNILYESLVRTKKVDFY 455

Query: 322 HLDFFNG---TMFWVKPKCLEPLRNLHLIGEFEEE 353
            + +  G   + +W+K +  + +       +F +E
Sbjct: 456 KVPYIIGEEVSWYWIKTEDYKKIEEKFRNIDFSKE 490


>gi|114328198|ref|YP_745355.1| glycosyltransferase [Granulibacter bethesdensis CGDNIH1]
 gi|114316372|gb|ABI62432.1| glycosyltransferase [Granulibacter bethesdensis CGDNIH1]
          Length = 946

 Score = 38.0 bits (87), Expect = 3.0,   Method: Composition-based stats.
 Identities = 11/91 (12%), Positives = 28/91 (30%), Gaps = 7/91 (7%)

Query: 42  YVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE- 100
            + W  +P+             +   ++  WL   +  +    +  P  RI F  S  E 
Sbjct: 722 MLPWDNTPR---YGSRAMVHVNTSNNAYRTWLTQAMLDTHRRHV--PEERIVFLHSWNEW 776

Query: 101 -QKAFLRLNRFMSNSRMPFDSEKFLYVKELF 130
            +  ++  +       +         V+++ 
Sbjct: 777 CEGTYVEPDGRYGRHYLNETRAAVQDVRDIL 807


>gi|312863645|ref|ZP_07723883.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
 gi|311101181|gb|EFQ59386.1| conserved hypothetical protein [Streptococcus vestibularis F0396]
          Length = 262

 Score = 37.6 bits (86), Expect = 3.0,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 37/119 (31%), Gaps = 14/119 (11%)

Query: 225 FDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLGMIG 284
              YD++   H   +       +     R  L   LL        I   F   P +G++ 
Sbjct: 72  LSEYDFIGHFHT--ADFGNEGKLVDEATRLALIDMLL-DEKKVSSIFADF---PEVGLVF 125

Query: 285 SRRYRRYKRWSFFA--KRSEVYRRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLEPL 341
           +   +            +++  +   +  K       +  L  F G+M W+    LE +
Sbjct: 126 ADLSKELYWTDAIGTLNQNQAAKLDNECQKTI-----KNSLHVFQGSM-WLSKDFLEKI 178


>gi|326403402|ref|YP_004283483.1| putative glycosyltransferase [Acidiphilium multivorum AIU301]
 gi|325050263|dbj|BAJ80601.1| putative glycosyltransferase [Acidiphilium multivorum AIU301]
          Length = 1247

 Score = 37.6 bits (86), Expect = 3.4,   Method: Composition-based stats.
 Identities = 7/81 (8%), Positives = 25/81 (30%), Gaps = 7/81 (8%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W   P++      +H    + +++++          +  +       I    +  E  + 
Sbjct: 514 WDNDPRREGAGVVLHEATPAAYQAWL-----AALIERARRAPVHGEPIVCINAWNEWAEG 568

Query: 103 AFLRLNRFMSNSRMPFDSEKF 123
           A+L  +     + +   +   
Sbjct: 569 AYLEPDLHFGAAFLNATARAI 589


>gi|148259629|ref|YP_001233756.1| glycosyl transferase, group 1 [Acidiphilium cryptum JF-5]
 gi|146401310|gb|ABQ29837.1| glycosyl transferase, group 1 [Acidiphilium cryptum JF-5]
          Length = 1247

 Score = 37.6 bits (86), Expect = 3.4,   Method: Composition-based stats.
 Identities = 7/81 (8%), Positives = 25/81 (30%), Gaps = 7/81 (8%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W   P++      +H    + +++++          +  +       I    +  E  + 
Sbjct: 514 WDNDPRREGAGVVLHEATPAAYQAWL-----AALIERARRAPVHGEPIVCINAWNEWAEG 568

Query: 103 AFLRLNRFMSNSRMPFDSEKF 123
           A+L  +     + +   +   
Sbjct: 569 AYLEPDLHFGAAFLNATARAI 589


>gi|237808791|ref|YP_002893231.1| polysaccharide biosynthesis protein [Tolumonas auensis DSM 9187]
 gi|237501052|gb|ACQ93645.1| polysaccharide biosynthesis protein [Tolumonas auensis DSM 9187]
          Length = 370

 Score = 37.6 bits (86), Expect = 3.5,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 41/122 (33%), Gaps = 11/122 (9%)

Query: 7   LKSKLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIF 66
           LK+K+  +  +     V                  +  W  + +++ T   +   + +++
Sbjct: 254 LKTKVSAVNKVNYAALVSNMVKKSWPKTYRKFPCVFPSWDNTARRK-TPTVIQNLDSNVY 312

Query: 67  ESFIFWLRSFLAFSKYSKLSFPSC-RIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKF 123
                    +L ++  S  S+P   +I F  +  E  +   L  +R +  + +    +  
Sbjct: 313 A-------RWLEYAVDSVSSYPENEKIVFINAWNEWAEGCHLEPDRKVGRAFLEATKQVV 365

Query: 124 LY 125
             
Sbjct: 366 ER 367


>gi|256827944|ref|YP_003156672.1| glycosyl transferase family 2 [Desulfomicrobium baculatum DSM 4028]
 gi|256577120|gb|ACU88256.1| glycosyl transferase family 2 [Desulfomicrobium baculatum DSM 4028]
          Length = 1077

 Score = 37.2 bits (85), Expect = 4.4,   Method: Composition-based stats.
 Identities = 11/90 (12%), Positives = 29/90 (32%), Gaps = 10/90 (11%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPS-CRIFFYGSRKE--Q 101
           W  +P++   S  +       +       R +L+ +  S    P+  R+ F  +  E  +
Sbjct: 831 WDNTPRRPKDSVVLLDPSPDRY-------RRWLSHAVESVTKLPADERLVFINAWNEWGE 883

Query: 102 KAFLRLNRFMSNSRMPFDSEKFLYVKELFE 131
              L  +    ++ +   +          +
Sbjct: 884 GCALEPDLLRGDAYLKATAAALDAGVRTLD 913


>gi|237653904|ref|YP_002890218.1| lipopolysaccharide biosynthesis protein-like protein [Thauera sp.
           MZ1T]
 gi|237625151|gb|ACR01841.1| lipopolysaccharide biosynthesis protein-like protein [Thauera sp.
           MZ1T]
          Length = 358

 Score = 37.2 bits (85), Expect = 4.4,   Method: Composition-based stats.
 Identities = 12/85 (14%), Positives = 28/85 (32%), Gaps = 8/85 (9%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W  +P+  +    +H     +F++ +   R       Y        RI F  +  E  + 
Sbjct: 280 WDNTPRSGLNGLVLHGSTPELFKTVLR--RGVDLVQGYPA----EQRIVFIKAWNEWAEG 333

Query: 103 AFLRLNRFMSNSRMPFDSEKFLYVK 127
            +L  ++   +  +    E     +
Sbjct: 334 NYLEPDQRFGHGYLRAVREVLQETR 358


>gi|261364085|ref|ZP_05976968.1| pantetheine-phosphate adenylyltransferase [Neisseria mucosa ATCC
           25996]
 gi|288568133|gb|EFC89693.1| pantetheine-phosphate adenylyltransferase [Neisseria mucosa ATCC
           25996]
          Length = 168

 Score = 37.2 bits (85), Expect = 4.5,   Method: Composition-based stats.
 Identities = 10/74 (13%), Positives = 30/74 (40%), Gaps = 7/74 (9%)

Query: 162 TWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENK-----GRDVRPF 216
            + E+   +       + +   ++  +D  + + + FP+ ++ V EN+      R++   
Sbjct: 32  LFDELVVAIGINPEKHNTY--TIDERRDMLEAITEGFPNVRISVFENRFLVRYAREIGAG 89

Query: 217 LYLLELGVFDRYDY 230
             +  +     Y+Y
Sbjct: 90  FIVRGIRSAADYEY 103


>gi|213962348|ref|ZP_03390611.1| conserved hypothetical protein [Capnocytophaga sputigena Capno]
 gi|213955014|gb|EEB66333.1| conserved hypothetical protein [Capnocytophaga sputigena Capno]
          Length = 368

 Score = 37.2 bits (85), Expect = 4.6,   Method: Composition-based stats.
 Identities = 13/75 (17%), Positives = 23/75 (30%), Gaps = 10/75 (13%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W  +P+ +  SK       + FE F+  L    A               F  +  E  + 
Sbjct: 295 WDNTPRYKNRSKFFVNATPANFEHFLKELSLIEAAK--------GNEFVFINAWNEWSEG 346

Query: 103 AFLRLNRFMSNSRMP 117
           A+L  +       + 
Sbjct: 347 AYLEPDTTYEYQYLD 361


>gi|281424202|ref|ZP_06255115.1| glycosyltransferase [Prevotella oris F0302]
 gi|281401471|gb|EFB32302.1| glycosyltransferase [Prevotella oris F0302]
          Length = 361

 Score = 37.2 bits (85), Expect = 4.7,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 26/89 (29%), Gaps = 8/89 (8%)

Query: 37  HVSGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYG 96
           H    Y  W  S +    +      E  I+  F    R F+  S+          + F  
Sbjct: 271 HFPCIYPNWDHSARSGKIATIFRNVEPEIWGDFCK--RLFVKCSRQPT----EENLIFIK 324

Query: 97  SRKE--QKAFLRLNRFMSNSRMPFDSEKF 123
           S  E  +  +L  +R      +    +  
Sbjct: 325 SWNEWGEGNYLEPDRRYGRGYLEELKKAL 353


>gi|323694861|ref|ZP_08109014.1| hypothetical protein HMPREF9475_03878 [Clostridium symbiosum
           WAL-14673]
 gi|323501087|gb|EGB16996.1| hypothetical protein HMPREF9475_03878 [Clostridium symbiosum
           WAL-14673]
          Length = 374

 Score = 37.2 bits (85), Expect = 4.9,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 29/79 (36%), Gaps = 10/79 (12%)

Query: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99
           G +V W  SP++   +  +       F  ++  L       K  +L  P   +    +  
Sbjct: 286 GAFVAWDNSPRKSYNATVITGATPEKFGEYMCKL-----MKKAQELHSP---VIVINAWN 337

Query: 100 E--QKAFLRLNRFMSNSRM 116
           E  + AFL  ++    + +
Sbjct: 338 EWAEGAFLEPDKEYGTAYL 356


>gi|58038685|ref|YP_190649.1| hypothetical protein GOX0204 [Gluconobacter oxydans 621H]
 gi|58001099|gb|AAW59993.1| Hypothetical protein GOX0204 [Gluconobacter oxydans 621H]
          Length = 1260

 Score = 37.2 bits (85), Expect = 5.2,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 28/80 (35%), Gaps = 7/80 (8%)

Query: 45  WSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QK 102
           W    +++     +H     ++E    WL   +   +    +F    +    +  E  + 
Sbjct: 521 WDNDARRQGKGLVLHGSTPELYER---WLSGLI--EQAQSRTFFGDPVVCINAWNEWAKG 575

Query: 103 AFLRLNRFMSNSRMPFDSEK 122
           A+L  ++   ++ +   +  
Sbjct: 576 AYLEPDQHFGSAYLNATARA 595


>gi|189426434|ref|YP_001953611.1| radical SAM protein [Geobacter lovleyi SZ]
 gi|189422693|gb|ACD97091.1| Radical SAM domain protein [Geobacter lovleyi SZ]
          Length = 843

 Score = 36.8 bits (84), Expect = 5.3,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 41/120 (34%), Gaps = 14/120 (11%)

Query: 10  KLGKIENLLLRLDVEEKGNMQAIYIPAHVSGYYVLWSFSPKQRITSKDVHFQELSIFESF 69
           K+ + E+L+L L   +  + +    P  V      W  +P+       +      +F   
Sbjct: 731 KVSRYEDLVLYLKQYQLSDNE---YPLVVPN----WDNTPRSGSNGFVLQGSTPELFGEM 783

Query: 70  IFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYVK 127
           +       A  K  +   P+ RI F  +  E  +   L  +    ++ +    +  L+  
Sbjct: 784 L-----EDALRKVEQRKDPADRIVFIKAWNEWAEGNHLEPDLLHGHAYLQALYKALLHGA 838


>gi|294672884|ref|YP_003573500.1| hypothetical protein PRU_0097 [Prevotella ruminicola 23]
 gi|294473985|gb|ADE83374.1| conserved hypothetical protein [Prevotella ruminicola 23]
          Length = 369

 Score = 36.8 bits (84), Expect = 5.6,   Method: Composition-based stats.
 Identities = 15/92 (16%), Positives = 29/92 (31%), Gaps = 8/92 (8%)

Query: 39  SGYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSR 98
              Y  W  SP+       +      +FE  +  +   +      K   P  +I F  S 
Sbjct: 283 PAIYPNWDHSPRSGRNGFIIVDSTPDLFEKHVAQVLDEV------KSKQPEHQIAFIKSW 336

Query: 99  KE--QKAFLRLNRFMSNSRMPFDSEKFLYVKE 128
            E  +  ++  +    N  +   S +   V+ 
Sbjct: 337 NEWGEGNYIEPDLKFGNGYLEALSRQIEKVRY 368


>gi|146318939|ref|YP_001198651.1| polysaccharide biosynthesis protein [Streptococcus suis 05ZYH33]
 gi|145689745|gb|ABP90251.1| polysaccharide biosynthesis protein [Streptococcus suis 05ZYH33]
 gi|319758378|gb|ADV70320.1| polysaccharide biosynthesis protein [Streptococcus suis JS14]
          Length = 587

 Score = 36.4 bits (83), Expect = 7.0,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 78/219 (35%), Gaps = 21/219 (9%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN-----KDFEQDVLKYFPSA 201
             + + + VH      + E    L ++     L +T+ EA+        E+ +  Y   A
Sbjct: 294 SSTSVLLHVHIESVSIFEEYIEELCKIADRCQLLITLPEADFSNKCSIVERCLFTYQLRA 353

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
           Q+  +     D   F  ++   + D   YL  +  K+++   Y   + I  R  L     
Sbjct: 354 QIAKLT----DELHFFEIVNNYMGDA-KYLAHVTVKQTKEIKYSVEDIID-RHQLRKMFF 407

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA--GFP 317
              D     I+ FE    L ++       +RY R S      E+ R++  L +       
Sbjct: 408 TSFDAV---ISNFESQSNLAVVIPDLTTNQRYDRQSLREGNPELIRQLNILYESLVRTKK 464

Query: 318 TKRLHLDFFNG---TMFWVKPKCLEPLRNLHLIGEFEEE 353
                + +  G   + +W+K +  + +       +F +E
Sbjct: 465 VDFYKVPYIIGEEVSWYWIKTEHYKKIEEKFRNIDFSKE 503


>gi|253752012|ref|YP_003025153.1| rhamnan synthesis protein F family protein [Streptococcus suis
           SC84]
 gi|253753837|ref|YP_003026978.1| rhamnan synthesis protein F family protein [Streptococcus suis
           P1/7]
 gi|251816301|emb|CAZ51929.1| rhamnan synthesis protein F family protein [Streptococcus suis
           SC84]
 gi|251820083|emb|CAR46353.1| rhamnan synthesis protein F family protein [Streptococcus suis
           P1/7]
          Length = 574

 Score = 36.4 bits (83), Expect = 7.2,   Method: Composition-based stats.
 Identities = 39/219 (17%), Positives = 78/219 (35%), Gaps = 21/219 (9%)

Query: 147 IKSKIAIVVHCYYQDTWIEISHILLRLNFDFDLFVTVVEAN-----KDFEQDVLKYFPSA 201
             + + + VH      + E    L ++     L +T+ EA+        E+ +  Y   A
Sbjct: 281 SSTSVLLHVHIESVSIFEEYIEELCKIADRCQLLITLPEADFSNKCSIVERCLFTYQLRA 340

Query: 202 QLYVMENKGRDVRPFLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLL 261
           Q+  +     D   F  ++   + D   YL  +  K+++   Y   + I  R  L     
Sbjct: 341 QIAKLT----DELHFFEIVNNYMGDA-KYLAHVTVKQTKEIKYSVEDIID-RHQLRKMFF 394

Query: 262 GFSDIAIRIINTFEQNPCLGMIGSR--RYRRYKRWSFFAKRSEVYRRVIDLAKRA--GFP 317
              D     I+ FE    L ++       +RY R S      E+ R++  L +       
Sbjct: 395 TSFDAV---ISNFESQSNLAVVIPDLTTNQRYDRQSLREGNPELIRQLNILYESLVRTKK 451

Query: 318 TKRLHLDFFNG---TMFWVKPKCLEPLRNLHLIGEFEEE 353
                + +  G   + +W+K +  + +       +F +E
Sbjct: 452 VDFYKVPYIIGEEVSWYWIKTEHYKKIEEKFRNIDFSKE 490


>gi|94310676|ref|YP_583886.1| glycosyl transferase family protein [Cupriavidus metallidurans
           CH34]
 gi|93354528|gb|ABF08617.1| Cellulose synthase (UDP-forming), putative glycosyl transferase
           [Cupriavidus metallidurans CH34]
          Length = 658

 Score = 36.4 bits (83), Expect = 8.6,   Method: Composition-based stats.
 Identities = 32/182 (17%), Positives = 61/182 (33%), Gaps = 23/182 (12%)

Query: 176 DFDLFVTVVEA-----NKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYLLELGVFDRY-- 228
             D+F+           K     +   +P+ +++V+++  RD   +L      V  RY  
Sbjct: 117 PVDIFIATYNEGLDVLEKTIVAALDIDYPNFRVWVLDDTRRD---WLREFCDQVGARYVT 173

Query: 229 --DYLCKIHGK-----KSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPCLG 281
             D     H K        R       G  +   L  D     +I +RI+  F  +P +G
Sbjct: 174 RPDN---AHAKAGNLNNGLRHSAELDGGAPFIMVLDADFAPNRNILLRIVGLF-DDPQVG 229

Query: 282 MI-GSRRYRRYKRWSFFAKRSEVY-RRVIDLAKRAGFPTKRLHLDFFNGTMFWVKPKCLE 339
           ++   + Y       +  + +E +                     F  GT F V+ + L+
Sbjct: 230 VVQTPQFYYNADPIQYNLRSTECWVDEQRAFFDVMQPSKDAWGTAFCIGTSFVVRREALD 289

Query: 340 PL 341
            +
Sbjct: 290 RI 291


>gi|297569722|ref|YP_003691066.1| glycosyl transferase family 2 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925637|gb|ADH86447.1| glycosyl transferase family 2 [Desulfurivibrio alkaliphilus AHT2]
          Length = 318

 Score = 36.0 bits (82), Expect = 9.2,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 44/143 (30%), Gaps = 32/143 (22%)

Query: 161 DTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPS----AQLYVMENKG-RDVRP 215
           D        ++      DL+V V + + D    +L  + +     ++    N+G R V P
Sbjct: 17  DYMRHTLDSMVAQTVRPDLWVIVDDGSTDQTPQILAEYAAKYDFIKIVPKANRGHRSVGP 76

Query: 216 -----FLYLLELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRI 270
                F         D ++Y+CK                      L  DL         +
Sbjct: 77  GVIEAFYAGYRAVRPDDFEYICK----------------------LDLDLELPPRYFEIL 114

Query: 271 INTFEQNPCLGMIGSRRYRRYKR 293
           +   E+NP +G    + Y     
Sbjct: 115 LKRLEENPRIGTCSGKPYFLDNE 137


>gi|13474019|ref|NP_105587.1| hypothetical protein mll4797 [Mesorhizobium loti MAFF303099]
 gi|14024771|dbj|BAB51373.1| mll4797 [Mesorhizobium loti MAFF303099]
          Length = 467

 Score = 36.0 bits (82), Expect = 10.0,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 29/90 (32%), Gaps = 14/90 (15%)

Query: 69  FIFWLRSFLAFSKYSKLSFPSCRIFFYGSRKE--QKAFLRLNRFMSNSRMPFDSEKFLYV 126
           +  WL + +A +      F S R+ F  +  E  + A+L  +     + +          
Sbjct: 8   YAEWLANAVADTCDRFADFDS-RLIFVNAWNEWAEGAYLEPDARYGYAYLQETRNVLSA- 65

Query: 127 KELFEGWNDRPSSPKKSGLTIKSKIAIVVH 156
                     PS+  K       ++  V H
Sbjct: 66  ----------PSAAGKFPTGASWRVLFVSH 85


  Database: nr
    Posted date:  May 13, 2011  4:10 AM
  Number of letters in database: 999,999,932
  Number of sequences in database:  2,987,209
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 13, 2011  4:17 AM
  Number of letters in database: 999,998,956
  Number of sequences in database:  2,896,973
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 13, 2011  4:23 AM
  Number of letters in database: 999,999,979
  Number of sequences in database:  2,907,862
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 13, 2011  4:29 AM
  Number of letters in database: 999,999,513
  Number of sequences in database:  2,932,190
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 13, 2011  4:33 AM
  Number of letters in database: 792,586,372
  Number of sequences in database:  2,260,650
  
Lambda     K      H
   0.316    0.148    0.461 

Lambda     K      H
   0.267   0.0453    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,549,637,152
Number of Sequences: 13984884
Number of extensions: 325821736
Number of successful extensions: 992874
Number of sequences better than 10.0: 289
Number of HSP's better than 10.0 without gapping: 220
Number of HSP's successfully gapped in prelim test: 251
Number of HSP's that attempted gapping in prelim test: 991084
Number of HSP's gapped (non-prelim): 640
length of query: 394
length of database: 4,792,584,752
effective HSP length: 141
effective length of query: 253
effective length of database: 2,820,716,108
effective search space: 713641175324
effective search space used: 713641175324
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)
S2: 83 (36.4 bits)