RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter asiaticus str. psy62] (394 letters) >1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA synthetase; 2.75A {Thermus thermophilus} (A:66-188) Length = 123 Score = 28.3 bits (63), Expect = 1.6 Identities = 12/60 (20%), Positives = 17/60 (28%), Gaps = 1/60 (1%) Query: 322 HLDFFNGTMFWVKPKCLEPLRNLHLIGEFEEERNLKDGALEHAVERFFACSVRYTEFSIE 381 H F M + R HL+ E EE + E V+ + E Sbjct: 14 HEATFADPM-VDNRITKKRYRLDHLLKEQPEEVLKRLYRAMEVEEENLHALVQAMMQAPE 72 >1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} (A:114-250) Length = 137 Score = 26.3 bits (57), Expect = 6.0 Identities = 13/121 (10%), Positives = 34/121 (28%), Gaps = 16/121 (13%) Query: 215 PFLYLL-ELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINT 273 P + ++ ++ + + G ++ E ++ E + L Sbjct: 18 PVVSMVRQMQEWTAPNETRIYFGVNTEPELFYIDE--LKSLERSMRNLTVKACVWH---- 71 Query: 274 FEQNPCLGMIGSRRYRRYKRWSFFAKRSEVY--------RRVIDLAKRAGFPTKRLHLDF 325 G GS + ++Y +L + G P +++ + Sbjct: 72 -PSGDWEGEQGSPIDALREDLESSDANPDIYLCGPPGMIDAACELVRSRGIPGEQVFFEK 130 Query: 326 F 326 F Sbjct: 131 F 131 >3gbt_A Gluconate kinase; LBA0354, FGGY kinase family, carbohydrate metabolic process, transferase, structural genomics, PSI-2; 2.40A {Lactobacillus acidophilus ncfm} (A:238-504) Length = 267 Score = 26.5 bits (57), Expect = 6.2 Identities = 5/48 (10%), Positives = 13/48 (27%), Gaps = 2/48 (4%) Query: 267 AIRIINTFEQNPCLGMIGSRRYRRYKRWSFFAKRSEVYRRVIDLAKRA 314 + + NP + + Y S Y + ++ + Sbjct: 217 FAQADKVYFPNPKEAATYQKLFPLYCEIRNALAAS--YGKFSNINEGH 262 >3jrt_A Integron cassette protein VPC_CASS2; mobIle metagenome, structural genomics, PSI-2 protein structure initiative; 2.30A {Vibrio paracholerae} (A:) Length = 192 Score = 26.2 bits (57), Expect = 8.2 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Query: 161 DTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQ 202 D WIEI IL L D + VTV+ KD+E P Q Sbjct: 26 DKWIEIEEILSGLIGDLTIAVTVL---KDYEGKAFLREPQHQ 64 >3l70_H Mitochondrial ubiquinol-cytochrome C reductase 11 kDa protein, complex III subunit...; cytochrome BC1, membrane protein, heme protein, rieske iron sulfur protein; HET: PEE HEM JZV UQ CDL HEC BOG; 2.75A {Gallus gallus} PDB: 3cwb_H* 3h1i_H* 3h1h_H* 3h1k_H* 3h1l_H* 3h1j_H* 3l71_H* 3l72_H* 3l73_H* 3l74_H* 3l75_H* (H:) Length = 77 Score = 25.9 bits (57), Expect = 9.7 Identities = 11/43 (25%), Positives = 13/43 (30%) Query: 352 EERNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLLH 394 E + A ER C R + S C E LH Sbjct: 20 REHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLH 62 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.328 0.143 0.447 Gapped Lambda K H 0.267 0.0657 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 3,265,390 Number of extensions: 157446 Number of successful extensions: 580 Number of sequences better than 10.0: 1 Number of HSP's gapped: 580 Number of HSP's successfully gapped: 16 Length of query: 394 Length of database: 4,956,049 Length adjustment: 90 Effective length of query: 304 Effective length of database: 1,913,599 Effective search space: 581734096 Effective search space used: 581734096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (25.1 bits)