RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] (82 letters) >gnl|CDD|114849 pfam06154, YagB_YeeU_YfjZ, YagB/YeeU/YfjZ family. This family of proteins includes three proteins from E. coli YagB, YeeU and YfjZ. The function of these proteins is unknown. They are about 120 amino acids in length. Length = 104 Score = 27.7 bits (62), Expect = 0.70 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 15 DAFPELIKALEKGLSTFDVEP 35 +AFP IK LE L + ++ P Sbjct: 49 EAFPHFIKQLELMLLSGELNP 69 >gnl|CDD|182323 PRK10236, PRK10236, hypothetical protein; Provisional. Length = 237 Score = 26.8 bits (59), Expect = 1.2 Identities = 13/47 (27%), Positives = 26/47 (55%) Query: 28 LSTFDVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERK 74 L F + + N ++ HGK Y + + V + ++L +K+ EIE++ Sbjct: 70 LQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKADKEMSTFEIEQQ 116 >gnl|CDD|180340 PRK05989, cobN, cobaltochelatase subunit CobN; Reviewed. Length = 1244 Score = 26.0 bits (58), Expect = 2.3 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 5/34 (14%) Query: 14 RDAFPELIKALEKG---LSTFDVEPLK-NPVKSH 43 RDAFP +I + ++ D EP + NPV++H Sbjct: 954 RDAFPNVIALFDDAVRAVAALD-EPDEDNPVRAH 986 >gnl|CDD|167230 PRK01433, hscA, chaperone protein HscA; Provisional. Length = 595 Score = 25.2 bits (55), Expect = 3.6 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Query: 47 YESYISHVCELIELLKNKDFDGVEIERKSYNLRKN 81 YE IS+ IE+ N D EI+ N KN Sbjct: 464 YEK-ISNTSHAIEVKPNHGIDKTEIDIMLENAYKN 497 >gnl|CDD|179692 PRK03979, PRK03979, ADP-specific phosphofructokinase; Provisional. Length = 463 Score = 25.3 bits (56), Expect = 3.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Query: 42 SHGKGYESYISHVCELIELLKNKDFD 67 S GK E Y+ E I+LLK K+ D Sbjct: 239 SDGKTAEYYLKRAKEDIKLLKKKNKD 264 >gnl|CDD|162406 TIGR01536, asn_synth_AEB, asparagine synthase (glutamine-hydrolyzing). This model describes the glutamine-hydrolysing asparagine synthase. A poorly conserved C-terminal extension was removed from the model. Bacterial members of the family tend to have a long, poorly conserved insert lacking from archaeal and eukaryotic sequences. Multiple isozymes have been demonstrated, such as in Bacillus subtilis. Long-branch members of the phylogenetic tree (which typically were also second or third candidate members from their genomes) were removed from the seed alignment and score below trusted cutoff. Length = 467 Score = 25.4 bits (56), Expect = 3.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Query: 9 SKEEVRDAFPELIKALEKGLSTFDVEPL 36 S EE DA PE+I LE + PL Sbjct: 318 SVEEGLDALPEVIYHLEDPTTIRASIPL 345 >gnl|CDD|147852 pfam05925, IpgD, Enterobacterial virulence protein IpgD. This family consists of several enterobacterial IpgD like virulence factor proteins. In the Gram-negative pathogen Shigella flexneri, the virulence factor IpgD is translocated directly into eukaryotic cells and acts as a potent inositol 4-phosphatase that specifically dephosphorylates phosphatidylinositol 4,5-bisphosphate [PtdIns(4,5)P(2)] into phosphatidylinositol 5-monophosphate [PtdIns(5)P] that then accumulates. Transformation of PtdIns(4,5)P(2) into PtdIns(5)P by IpgD is responsible for dramatic morphological changes of the host cell, leading to a decrease in membrane tether force associated with membrane blebbing and actin filament remodelling. Length = 569 Score = 25.0 bits (54), Expect = 4.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Query: 8 PSKEEVRDAFPELIKALEKGLSTFDVEPLKNPVKSHGKGY 47 +KE R A A +K L+ + EP+K + +G Y Sbjct: 154 KAKEAHRFAASAFKDAFDKQLNNKNWEPIKKNINHNGHHY 193 >gnl|CDD|181851 PRK09431, asnB, asparagine synthetase B; Provisional. Length = 554 Score = 25.3 bits (56), Expect = 4.1 Identities = 9/24 (37%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Query: 10 KEEVRDAFPELIKALEKGLSTFDV 33 +E DA ++I LE T+DV Sbjct: 302 VQEGLDALRDVIYHLE----TYDV 321 >gnl|CDD|183436 PRK12321, cobN, cobaltochelatase subunit CobN; Reviewed. Length = 1100 Score = 25.0 bits (55), Expect = 4.9 Identities = 8/29 (27%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Query: 14 RDAFPELIKALEKG---LSTFDVEPLKNP 39 RD FP LI ++ ++ + NP Sbjct: 834 RDVFPALIALFDQAARAVAAREEADEDNP 862 >gnl|CDD|148092 pfam06277, EutA, Ethanolamine utilisation protein EutA. This family consists of several bacterial EutA ethanolamine utilisation proteins. The EutA protein is thought to protect the lyase (EutBC) from inhibition by CNB12. Length = 473 Score = 24.5 bits (54), Expect = 5.8 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 7 RPSKEEVRDAFPELIKALEKGLSTFDVEPLKNPV--KSHGKGYESY--ISHVCELI 58 +PS ++ L +A+ + L+ FD+E PV G S+ + + E I Sbjct: 342 KPSLDDEEQGNEPLAEAIRQALAWFDLEGEVQPVALAFPGLKNPSFQAVQALAEAI 397 >gnl|CDD|180495 PRK06263, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed. Length = 543 Score = 24.6 bits (54), Expect = 5.8 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 32 DVEPLKNPVKSHGKGYESYISHVCELIELLKNKDFDGVEIERKSYNLRK 80 VE +KS K I+ +LI+ LK +D V I R L+K Sbjct: 414 SVEEDIARIKSEIKFLNGSIN-PYDLIDELKKTMWDYVSIVRNEKGLKK 461 >gnl|CDD|183330 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional. Length = 272 Score = 24.8 bits (55), Expect = 6.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 10 KEEVRDAFPELIKALEKG 27 EVR+A E+I L+ G Sbjct: 24 DTEVREAVEEVIDLLDSG 41 >gnl|CDD|128884 smart00636, Glyco_18, Glycosyl hydrolase family 18. Length = 334 Score = 24.6 bits (54), Expect = 6.4 Identities = 6/14 (42%), Positives = 9/14 (64%) Query: 58 IELLKNKDFDGVEI 71 + LK FDG++I Sbjct: 100 VSFLKKYGFDGIDI 113 >gnl|CDD|177379 PHA02544, 44, clamp loader, small subunit; Provisional. Length = 316 Score = 24.6 bits (54), Expect = 6.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 52 SHVCELIELLKNKDFDGV 69 S + +++E LK KDF V Sbjct: 230 SDIDDVVEALKAKDFKAV 247 >gnl|CDD|131310 TIGR02257, cobalto_cobN, cobaltochelatase, CobN subunit. Length = 1122 Score = 23.9 bits (52), Expect = 9.4 Identities = 11/44 (25%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Query: 14 RDAFPELIKALEKGL---STFDVEPLKNPVKSHGKGYESYISHV 54 RDAFP LI ++K + + D NP+ + + + Sbjct: 848 RDAFPNLIALVDKAVQAVAQLDEPDELNPLAARTRAEGRASPRI 891 >gnl|CDD|132040 TIGR02995, ectoine_ehuB, ectoine/hydroxyectoine ABC transporter solute-binding protein. Members of this family are the extracellular solute-binding proteins of ABC transporters that closely resemble amino acid transporters. The member from Sinorhizobium meliloti is involved in ectoine uptake, both for osmoprotection and for catabolism. All other members of the seed alignment are found associated with ectoine catabolic genes. Length = 275 Score = 23.7 bits (51), Expect = 9.8 Identities = 12/23 (52%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Query: 6 YRPSKEEVRDAF-PELIKALEKG 27 +RP +E+RDAF EL K E G Sbjct: 228 FRPEDKELRDAFNVELAKLKESG 250 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.313 0.135 0.381 Gapped Lambda K H 0.267 0.0600 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,372,353 Number of extensions: 72881 Number of successful extensions: 192 Number of sequences better than 10.0: 1 Number of HSP's gapped: 192 Number of HSP's successfully gapped: 37 Length of query: 82 Length of database: 5,994,473 Length adjustment: 51 Effective length of query: 31 Effective length of database: 4,892,465 Effective search space: 151666415 Effective search space used: 151666415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 50 (23.3 bits)