RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780203|ref|YP_003064616.1| hypothetical protein CLIBASIA_00440 [Candidatus Liberibacter asiaticus str. psy62] (82 letters) >d2ea9a1 d.110.8.1 (A:8-110) Hypothetical protein YfjZ {Escherichia coli [TaxId: 562]} Length = 103 Score = 28.5 bits (64), Expect = 0.16 Identities = 9/30 (30%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Query: 9 SKEEVRD---AFPELIKALEKGLSTFDVEP 35 S E FP I +E L+T ++ P Sbjct: 41 SDAECPKLDVVFPHFISQIESMLTTGELNP 70 >d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 320 Score = 27.5 bits (60), Expect = 0.29 Identities = 8/37 (21%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Query: 9 SKEEVRDA--FPELIKALEKGLSTFDVEPLKNPVKSH 43 ++EEV E + A+E+ + + + P K + Sbjct: 7 TQEEVESLISMDEAMNAVEEAFRLYALGKAQMPPKVY 43 >d2inwa1 d.110.8.1 (A:4-120) Hypothetical protein YeeU {Shigella flexneri [TaxId: 623]} Length = 117 Score = 27.4 bits (61), Expect = 0.30 Identities = 10/30 (33%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Query: 9 SKEEVRD---AFPELIKALEKGLSTFDVEP 35 S + AFP L+K LE L+ ++ P Sbjct: 52 SDVDAYHLDQAFPLLMKQLELMLTGGELNP 81 >d1vj7a1 a.211.1.1 (A:5-196) Stringent response-like protein RelA N-terminal domain {Streptococcus equisimilis [TaxId: 119602]} Length = 192 Score = 24.4 bits (52), Expect = 3.1 Identities = 12/57 (21%), Positives = 22/57 (38%), Gaps = 8/57 (14%) Query: 19 ELIKALEKGLSTFDVEPLKNP----VKSHG----KGYESYISHVCELIELLKNKDFD 67 E++ K ++ D +K +H K E YI H ++ +L + D Sbjct: 7 EVVALAAKYMNETDAAFVKKALDYATAAHFYQVRKSGEPYIVHPIQVAGILADLHLD 63 >d1vpra1 b.60.1.7 (A:868-1218) Dinoflagellate luciferase {Lingulodinium polyedrum [TaxId: 160621]} Length = 351 Score = 23.7 bits (51), Expect = 3.9 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Query: 30 TFDVEPLKNPVKSHGKGYESYISHVCELIEL-LKNKD 65 F + L P++ GK +ES ++ E EL KN Sbjct: 35 EFHEDGLHKPMEVGGKKFESGFHYLLECHELGGKNAS 71 >d1gr0a1 c.2.1.3 (A:14-200,A:312-367) Myo-inositol 1-phosphate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Score = 23.5 bits (51), Expect = 4.6 Identities = 13/81 (16%), Positives = 24/81 (29%), Gaps = 11/81 (13%) Query: 6 YRPSKEEVRDAF-----------PELIKALEKGLSTFDVEPLKNPVKSHGKGYESYISHV 54 Y + AF + I A E N + G + + Sbjct: 44 YHVRDVKFVAAFDVDAKKVGFDLSDAIFASENNTIKIADVAPTNVIVQRGPTLDGIGKYY 103 Query: 55 CELIELLKNKDFDGVEIERKS 75 + IEL + D V+ +++ Sbjct: 104 ADTIELSDAEPVDVVQALKEA 124 >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 Score = 23.3 bits (50), Expect = 5.9 Identities = 5/19 (26%), Positives = 9/19 (47%) Query: 9 SKEEVRDAFPELIKALEKG 27 R+A ++I L+ G Sbjct: 23 VDTVTREAVNQVIGLLDSG 41 >d1cfza_ c.56.1.1 (A:) Hydrogenase maturating endopeptidase HybD {Escherichia coli [TaxId: 562]} Length = 162 Score = 22.9 bits (49), Expect = 6.8 Identities = 4/25 (16%), Positives = 7/25 (28%) Query: 11 EEVRDAFPELIKALEKGLSTFDVEP 35 V ++ + L VE Sbjct: 132 PTVEAMIEPALEQVLAALRESGVEA 156 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.313 0.135 0.381 Gapped Lambda K H 0.267 0.0597 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 320,161 Number of extensions: 13334 Number of successful extensions: 50 Number of sequences better than 10.0: 1 Number of HSP's gapped: 50 Number of HSP's successfully gapped: 13 Length of query: 82 Length of database: 2,407,596 Length adjustment: 48 Effective length of query: 34 Effective length of database: 1,748,556 Effective search space: 59450904 Effective search space used: 59450904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 47 (22.2 bits)