RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] (180 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 32.9 bits (75), Expect = 0.023 Identities = 8/32 (25%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 116 DIKYERKQVISRKAK-EKDLEESLYQISEFAA 146 ++KY ++Q+++R+A+ + +E L + A Sbjct: 25 NMKYRKRQLVTREAQIKDWVENELEALKLEAE 56 Score = 28.7 bits (64), Expect = 0.54 Identities = 12/62 (19%), Positives = 21/62 (33%), Gaps = 17/62 (27%) Query: 110 EGMTMNDIK-Y--ERKQVISRKAKEKDLEESLYQISEFAACLEHPNRYWHTDSASIGFRV 166 E + D + ER + I +A+ L + Q N ++ D I Sbjct: 56 EEIPSEDQNEFLLERTREIHNEAE-SQLRAAQQQWG---------NDFYKRDP-RIA--- 101 Query: 167 PI 168 P+ Sbjct: 102 PL 103 >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} (A:) Length = 98 Score = 25.9 bits (56), Expect = 3.0 Identities = 6/30 (20%), Positives = 15/30 (50%) Query: 108 IEEGMTMNDIKYERKQVISRKAKEKDLEES 137 ++ GM ++ +R + +K K + E+ Sbjct: 68 LKVGMLKEGVRLDRVRGGRQKYKRRLDSEN 97 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 25.9 bits (57), Expect = 3.1 Identities = 12/41 (29%), Positives = 16/41 (39%), Gaps = 21/41 (51%) Query: 102 SIA-IPTIEE--------GMTMNDIKYERKQVISRKAKEKD 133 S+A + +IE GMTM QV A +D Sbjct: 1 SLADVMSIESLVEVVFYRGMTM--------QV----AVPRD 29 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.325 0.136 0.410 Gapped Lambda K H 0.267 0.0489 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,327,691 Number of extensions: 53538 Number of successful extensions: 176 Number of sequences better than 10.0: 1 Number of HSP's gapped: 176 Number of HSP's successfully gapped: 11 Length of query: 180 Length of database: 4,956,049 Length adjustment: 83 Effective length of query: 97 Effective length of database: 2,150,234 Effective search space: 208572698 Effective search space used: 208572698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.4 bits)