RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780204|ref|YP_003064617.1| hypothetical protein CLIBASIA_00445 [Candidatus Liberibacter asiaticus str. psy62] (180 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 35.7 bits (82), Expect = 0.006 Identities = 37/171 (21%), Positives = 62/171 (36%), Gaps = 60/171 (35%) Query: 4 KGYDILK------AT--VDYGGLILSFLSVIVS-PV--------YSYFRHTVAETPKIMW 46 +G +IL+ T DY LS+ +S P+ Y + TP + Sbjct: 211 QGLNILEWLENPSNTPDKDY------LLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELR 264 Query: 47 KAFKKSSGRWQ-------------WYKKSFQY-------LLFFSGL-SYLLFHSASFVLS 85 K ++G Q W +SF +LFF G+ Y + + S S Sbjct: 265 SYLKGATGHSQGLVTAVAIAETDSW--ESFFVSVRKAITVLFFIGVRCYEAYPNTSLPPS 322 Query: 86 LTSACL-----VVTAILAIL-LSIAIPTIEEGMT-MNDIKY--ERKQV-IS 126 + L V + +L+I L+ +++ + N + KQV IS Sbjct: 323 ILEDSLENNEGVPSPMLSISNLTQE--QVQDYVNKTN--SHLPAGKQVEIS 369 >2hi2_A Fimbrial protein; type IV pilin, fiber-forming protein, membrane protein, DNA binding protein, contractIle protein, cell adhesion; HET: MEA GLA DT6 HTO; 2.30A {Neisseria gonorrhoeae} PDB: 2hil_A* 1ay2_A* 2pil_A* Length = 158 Score = 31.2 bits (69), Expect = 0.13 Identities = 7/16 (43%), Positives = 13/16 (81%) Query: 91 LVVTAILAILLSIAIP 106 ++V AI+ IL ++A+P Sbjct: 7 MIVIAIVGILAAVALP 22 >1oqw_A Fimbrial protein; type IV pilin, fiber-forming protein, adhesion, pseudomonas aerugionosa, PAK pilin, cell adhesion; 2.00A {Pseudomonas aeruginosa} SCOP: d.24.1.1 Length = 144 Score = 30.2 bits (67), Expect = 0.23 Identities = 9/18 (50%), Positives = 13/18 (72%) Query: 91 LVVTAILAILLSIAIPTI 108 ++V AI+ IL +IAIP Sbjct: 7 MIVVAIIGILAAIAIPQY 24 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 29.8 bits (66), Expect = 0.39 Identities = 8/22 (36%), Positives = 18/22 (81%) Query: 116 DIKYERKQVISRKAKEKDLEES 137 ++KY ++Q+++R+A+ KD E+ Sbjct: 1245 NMKYRKRQLVTREAQIKDWVEN 1266 Score = 28.2 bits (62), Expect = 1.1 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 9/71 (12%) Query: 98 AILLSIAIPTIEEGMTMNDIKYERKQVISRKAKEKDLEESLYQIS-EFAACLEHPNRYWH 156 +IL I IE + N E+K++I E+DLE ++ S E A +H H Sbjct: 897 SILEHSGIRLIEPEL-FNGYNPEKKEMIQEVIVEEDLEP--FEASKETAEQFKHQ----H 949 Query: 157 TDSASIGFRVP 167 D I F +P Sbjct: 950 GDKVDI-FEIP 959 >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 Score = 28.1 bits (62), Expect = 1.3 Identities = 6/30 (20%), Positives = 15/30 (50%) Query: 108 IEEGMTMNDIKYERKQVISRKAKEKDLEES 137 ++ GM ++ +R + +K K + E+ Sbjct: 68 LKVGMLKEGVRLDRVRGGRQKYKRRLDSEN 97 >2deb_A CPT II, carnitine O-palmitoyltransferase II, mitochondrial; central six-stranded beta-sheet; HET: BOG COA PLM; 1.60A {Rattus norvegicus} PDB: 2fw3_A* 2fyo_A 2rcu_A* 2h4t_A* Length = 653 Score = 27.3 bits (60), Expect = 2.3 Identities = 9/30 (30%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Query: 53 SGRWQWYKKSFQYLLFFSGLSYLLF-HSAS 81 G +W+ KSF ++ G + + F HS Sbjct: 341 DGTNRWFDKSFNLIVAEDGTAAVHFEHSWG 370 >2qa0_A Capsid protein; beta-barrel, icosahedral virus; 2.60A {Adeno-associated virus - 8} PDB: 1lp3_A Length = 519 Score = 26.0 bits (57), Expect = 4.8 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 6/33 (18%) Query: 24 SVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRW 56 S I YS + +V +I W+ K++S RW Sbjct: 452 SFITQ--YSTGQVSV----EIEWELQKENSKRW 478 >2g8g_A Capsid; adeno-associated virus serotype 4, gene therapy, icosahedral virus; HET: D5M; 3.20A {Adeno-associated virus - 4} Length = 524 Score = 25.6 bits (56), Expect = 6.6 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 6/33 (18%) Query: 24 SVIVSPVYSYFRHTVAETPKIMWKAFKKSSGRW 56 S I YS + +V +I W+ K+ S RW Sbjct: 457 SFITQ--YSTGQVSV----QIDWEIQKERSKRW 483 >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Score = 25.4 bits (56), Expect = 7.7 Identities = 7/31 (22%), Positives = 12/31 (38%) Query: 122 KQVISRKAKEKDLEESLYQISEFAACLEHPN 152 K+ +S KD L ++ +HP Sbjct: 88 KRSMSPFRGPKDRARKLAEVGSHEKVGQHPC 118 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.325 0.136 0.410 Gapped Lambda K H 0.267 0.0686 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,513,707 Number of extensions: 63123 Number of successful extensions: 265 Number of sequences better than 10.0: 1 Number of HSP's gapped: 265 Number of HSP's successfully gapped: 12 Length of query: 180 Length of database: 5,693,230 Length adjustment: 86 Effective length of query: 94 Effective length of database: 3,608,246 Effective search space: 339175124 Effective search space used: 339175124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 53 (24.3 bits)