HHsearch alignment for GI: 254780206 and conserved domain: COG0771

>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane].
Probab=92.02  E-value=0.64  Score=26.64  Aligned_cols=115  Identities=21%  Similarity=0.292  Sum_probs=65.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH----H--CCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             95899886588999999998589967899954983575----1--17055128789899999998718979999795578
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA----Q--HAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~----~--~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
T Consensus         8 ~kv~V~GLG~sG~a~a~~L~~~G--~~v~v~D~~~~~~~~~~~~~~~~~i~~~~g~~~--~--~~~~~~d~vV~SPGi~~   81 (448)
T COG0771           8 KKVLVLGLGKSGLAAARFLLKLG--AEVTVSDDRPAPEGLAAQPLLLEGIEVELGSHD--D--EDLAEFDLVVKSPGIPP   81 (448)
T ss_pred             CEEEEEECCCCCHHHHHHHHHCC--CEEEEECCCCCCCCHHHHHHHCCCCEEECCCCC--H--HCCCCCCEEEECCCCCC
T ss_conf             97999926651099999999779--869998389876532344442037223137641--1--00134778998999999


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHH---------HC--CH----HHHHHHHHHHHHCCCCC
Q ss_conf             74899898605880670106665552---------01--02----35788876531011112
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAKLE---------SS--KS----FAKKFCTKYGIPTATYQ  121 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~le---------~s--K~----~~K~~l~~~gIPt~~~~  121 (424)
T Consensus        82 ~~p~v~~A~~~gi~i~~dieL~~r~~~~~p~vaITGTNGKTTTTsli~~~l~~~G~~~~lgG  143 (448)
T COG0771          82 THPLVEAAKAAGIEIIGDIELFYRLSGEAPIVAITGTNGKTTTTSLIAHLLKAAGLDALLGG  143 (448)
T ss_pred             CCHHHHHHHHCCCCEEEHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEECC
T ss_conf             88899999986993774888898744899989997999628899999999985599832135