HHsearch alignment for GI: 254780206 and conserved domain: COG2232

>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only].
Probab=99.49  E-value=3.3e-12  Score=108.22  Aligned_cols=336  Identities=20%  Similarity=0.256  Sum_probs=189.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEE----EC-CCHHHHH-CCEEE------ECCCCCHHHHHHHHHHHC--CCE-E
Q ss_conf             58998865889999999985899678999----54-9835751-17055------128789899999998718--979-9
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWS----IP-GNPGIAQ-HAQCV------AIDIQNHSAIIHFCQEKH--IDL-V   66 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~----~p-gN~g~~~-~~~~~------~i~~~d~~~i~~~a~~~~--iDl-v   66 (424)
T Consensus        13 kiLviGvntR~vv--eSA~k--lGf~V~sv~~y~~~Dl~~~a~~~l~~r~~~~~~rfe~~de~~li~~~~~~~~dvD~~i   88 (389)
T COG2232          13 KILVIGVNTRPVV--ESASK--LGFEVYSVQYYDPADLPGDAISYLRERPGELLGRFENLDEQKLIEAAEDLAEDVDAPI   88 (389)
T ss_pred             EEEEEEECCHHHH--HHHHH--CCEEEEEEEEECCCCCCCCCCEEEEECCHHHCCCCCCCCHHHHHHHHHHHHHHCCEEE
T ss_conf             3899962341767--78774--4718998675343236642102788448545276558898999999986445324125


Q ss_pred             EECCCHHHHHHHHHHHH---HCCCCEEECCHHHHHHH-HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             99795578748998986---05880670106665552-010235788876531011112234401111121012420256
Q gi|254780206|r   67 VVGPELPLVNGISDALN---AAGFKVFGPSQRAAKLE-SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVV  142 (424)
Q Consensus        67 ivgpE~pL~~gi~d~l~---~~gi~v~Gp~~~aa~le-~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVV  142 (424)
T Consensus        89 i~~s-------g~e~l~~~g~~~~~v~~n~P~~~v~~~snk~~~~r~l~~lgmp~p~~~~~-------e~~~~gekt~Il  154 (389)
T COG2232          89 IPFS-------GFEALRTSGELGCEVAGNEPEVKVVEASNKLKFYRKLEVLGMPEPSEKKI-------EPLEEGEKTLIL  154 (389)
T ss_pred             EECC-------CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHH-------HHHHHCCEEEEE
T ss_conf             4035-------53212456754564456782788999888886520101028999704321-------144402101477


Q ss_pred             EECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             30465343000232356778887887514453177788775205752344215776310352000111356654444434
Q gi|254780206|r  143 KADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGG  222 (424)
Q Consensus       143 Kp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGG  222 (424)
T Consensus       155 KPv~GaGG~-~el~~~~Ee----------~~~~~~i~Qefi~G~p~Svs~is~g~~a~~la~N~---QiI~~~~~~~-~~  219 (389)
T COG2232         155 KPVSGAGGL-VELVKFDEE----------DPPPGFIFQEFIEGRPVSVSFISNGSDALTLAVND---QIIDGLRGEY-SQ  219 (389)
T ss_pred             EECCCCCCE-EEECCCCCC----------CCCCCEEHHHHCCCCEEEEEEEECCCCEEEEEEEE---EEECCCCCCC-CC
T ss_conf             302378860-131004334----------58766003343178413799973586238999700---2214532334-44


Q ss_pred             ---CCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEE-CCCCCEEEEECCCCC
Q ss_conf             ---4300001234432220100000899999862046235664454489855704899988651-477510443326544
Q gi|254780206|r  223 ---MGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRF-GDPECQAMMMRLESD  298 (424)
Q Consensus       223 ---MGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~-GDPE~q~ilp~L~~d  298 (424)
T Consensus       220 f~Y~GNlTP~~~~~~----ee~e~la~elV~~lgL~G-----snGVDfvl~d~gpyViEVNPR~qGt~e~i--E~s~giN  288 (389)
T COG2232         220 FVYKGNLTPFPYEEV----EEAERLAEELVEELGLVG-----SNGVDFVLNDKGPYVIEVNPRIQGTLECI--ERSSGIN  288 (389)
T ss_pred             CEECCCCCCCCCHHH----HHHHHHHHHHHHHHCCCC-----CCCCCEEEECCCCEEEEECCCCCCHHHHH--HHHCCCC
T ss_conf             101267677765026----899999999999842356-----66610686068857999568545237888--9861777


Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCC-CEE-EEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEE-ECCEEEECCCCEE
Q ss_conf             11566654201333321234444-206-75422544668775797624876668986899833587-7887998188079
Q gi|254780206|r  299 ILEILNSCVHGNLHNTHINWKAE-YAL-TVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAI-VNNNLTANGGRVL  375 (424)
Q Consensus       299 l~~il~~~~~g~L~~~~~~~~~~-~~v-~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~-~~g~l~t~GGRVL  375 (424)
T Consensus       289 l~~lHi~af~G~LpE---r~kpr~~a~krILyap~---------~v~v~--~-l~~-~~~~---DiP~~GtviekgePl~  349 (389)
T COG2232         289 LFRLHIQAFDGELPE---RPKPRGYACKRILYAPR---------TVRVP--I-LKL-SWTH---DIPRPGTVIEKGEPLC  349 (389)
T ss_pred             HHHHHHHHHCCCCCC---CCCCCEEEEEEEEECCC---------EEECC--C-CCC-CCCC---CCCCCCCCCCCCCCEE
T ss_conf             899999984575767---77765347767886452---------36613--1-025-5211---3798982257998304


Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCC
Q ss_conf             9999628989999999999852589
Q gi|254780206|r  376 SATALGKTITESRELAYHMVENIDW  400 (424)
Q Consensus       376 ~vv~~g~~l~eA~~~ay~~i~~I~~  400 (424)
T Consensus       350 sviA~~nt~~~a~~~~er~~ervk~  374 (389)
T COG2232         350 SVIASSNTRSGAESMAERLAERVKN  374 (389)
T ss_pred             EEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             6552268778999999999999988