HHsearch alignment for GI: 254780206 and conserved domain: KOG0370

>KOG0370 consensus.
Probab=99.77  E-value=2.8e-17  Score=144.82  Aligned_cols=289  Identities=18%  Similarity=0.325  Sum_probs=206.8

Q ss_pred             EEEECCC------HHHH---H--HHHHHHHCCCCCEEEEECCCHHHHH----CCEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             8998865------8899---9--9999985899678999549835751----1705512878989999999871897999
Q gi|254780206|r    3 VLLIGSG------GREH---A--LAWKIAQSPLLSELWSIPGNPGIAQ----HAQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         3 ILviGsG------grEh---A--l~~~l~~s~~~~~v~~~pgN~g~~~----~~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
T Consensus       921 ~mVlGsGvYrIGSSVEFDwcaV~~~rtLr~~g~--kTimvNyNPETVSTDyDecdrLYFeeis~E~vmDiYe~E~~~G~i  998 (1435)
T KOG0370         921 VMVLGSGVYRIGSSVEFDWCAVGCARTLRKLGK--KTIMVNYNPETVSTDYDECDRLYFEEISYERVMDIYELENSEGII  998 (1435)
T ss_pred             EEEECCCCEECCCCEEECHHHHHHHHHHHHCCC--CEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             599724325635620551335547999997098--469995686543575677766767542366534355430677269


Q ss_pred             E--CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             9--79557874899898605880670106665552010235788876531011112234401111121012420256304
Q gi|254780206|r   68 V--GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        68 v--gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
T Consensus       999 is~GGQ~pn--NiA~~L~r~~~kilGTsP~~ID~AEnR~kFS~~Ld~i~v~Qp~Wkelt~~~eA~~F~~~VgYP~lvRPS 1076 (1435)
T KOG0370         999 ISVGGQLPN--NIALKLHRNGVKILGTSPEMIDSAENRFKFSRMLDSIGVDQPAWKELTSLEEAKKFAEKVGYPVLVRPS 1076 (1435)
T ss_pred             EEECCCCCC--HHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCHHHHHHHHHHCCCCEEECCC
T ss_conf             983684862--021375862886754885761114567789998877278861023322688999999865996685110


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHC-CCCCEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             65343000232356778887887514-45317778877520-575234421-5776310352000111356654444434
Q gi|254780206|r  146 GLCAGKGVVVAATVDEATSAIDRCFQ-QINSTVIIEEYLEG-FEVSFFALC-DGKTAIPFTTARDHKRIHDGDIGPNTGG  222 (424)
Q Consensus       146 ~~agGkGV~i~~~~~e~~~~~~~~~~-~~~~~VliEefl~G-~E~Sv~~i~-dG~~~~~l~~~~dyKr~~~~d~GpnTGG  222 (424)
T Consensus      1077 YVLSGaAMnv~~~~~dl~~~L~~A~~vs~dhPVVisKfie~AkEidvDAVa~~G~~~~-haiS-EH--v--EnAGVHSGD 1150 (1435)
T KOG0370        1077 YVLSGAAMNVVYSESDLKSYLEQASAVSPDHPVVISKFIEGAKEIDVDAVASDGKVLV-HAIS-EH--V--ENAGVHSGD 1150 (1435)
T ss_pred             CEECCHHHHHHHCHHHHHHHHHHHHHCCCCCCEEHHHHHCCCCEECHHHHCCCCEEEE-EEHH-HH--H--HCCCCCCCC
T ss_conf             1331015552104788999999776408779777277544450103123104781899-8623-34--1--124655786


Q ss_pred             CCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEEC--CCCCEEEEECCCCCCH
Q ss_conf             43000012344322201000008999998620462356644544898557048999886514--7751044332654411
Q gi|254780206|r  223 MGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFG--DPECQAMMMRLESDIL  300 (424)
Q Consensus       223 MGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~G--DPE~q~ilp~L~~dl~  300 (424)
T Consensus      1151 Atlv~Ppq~l~~~t~~ri-k~i~~ki~~a~~i-----tGPfN~Q~i~k~n~lkVIECN~RaSRSFP---FvSKtlgvdfi 1221 (1435)
T KOG0370        1151 ATLVLPPQDLSADTLERI-KDIAAKVAKALKI-----TGPFNMQIIAKDNELKVIECNVRASRSFP---FVSKTLGVDFI 1221 (1435)
T ss_pred             EEEECCCHHCCHHHHHHH-HHHHHHHHHHHCC-----CCCCEEEEEECCCEEEEEEEEEEEECCCC---CEEHHCCCHHH
T ss_conf             037578112498899999-9999999888616-----68743799954980789996403433666---30010583199


Q ss_pred             HHHHHHHHCC
Q ss_conf             5666542013
Q gi|254780206|r  301 EILNSCVHGN  310 (424)
Q Consensus       301 ~il~~~~~g~  310 (424)
T Consensus      1222 ~~At~~i~g~ 1231 (1435)
T KOG0370        1222 ALATRAIMGV 1231 (1435)
T ss_pred             HHHHHHHHCC
T ss_conf             9988997389