HHsearch alignment for GI: 254780206 and conserved domain: KOG0370

>KOG0370 consensus.
Probab=99.55  E-value=8e-15  Score=127.11  Aligned_cols=366  Identities=17%  Similarity=0.198  Sum_probs=217.9

Q ss_pred             EEEEECCCHHH------------HHHHHHHHHCCCCCEEEEECCCHHHHH----CCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865889------------999999985899678999549835751----17055128789899999998718979
Q gi|254780206|r    2 RVLLIGSGGRE------------HALAWKIAQSPLLSELWSIPGNPGIAQ----HAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsGgrE------------hAl~~~l~~s~~~~~v~~~pgN~g~~~----~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
T Consensus       379 kVlvlGSGGLsIGQAGEFDYSGsQA-iKAlkEe-~i~TiLiNP-NIAtvQts~~lAD~vyflpvT~~~vt~vi~~erPd~  455 (1435)
T KOG0370         379 KVLVLGSGGLSIGQAGEFDYSGSQA-IKALKEE-NIFTILINP-NIATVQTSKGLADKVYFLPVTPEYVTKVIKAERPDG  455 (1435)
T ss_pred             EEEEECCCCCCCCCCCEEEEEHHHH-HHHHHHC-CCEEEEECC-CCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHCCCE
T ss_conf             7999815873321240355407889-8765532-617999789-601000255521289995058799999988618773


Q ss_pred             EEECCC--HHHHHHH----HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             999795--5787489----9898605880670106665552010235788876531011112234401111121012420
Q gi|254780206|r   66 VVVGPE--LPLVNGI----SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus        66 vivgpE--~pL~~gi----~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P  139 (424)
T Consensus       456 il~tfggqtaLncgvel~k~gvf~~~~vkvLgt~i~ti~ttedr~lfa~am~ei~e~ia~s~a~~sie~al~aae~l~yp  535 (1435)
T KOG0370         456 ILLTFGGQTALNCGVELDKAGVFAQYGVKVLGTPIQTIITTEDRDLFARALNEINEKIAPSEAVSTIEEALEAAERLGYP  535 (1435)
T ss_pred             EEEECCCCCCCCCCEEEEECCCCCCCCHHHHCCCCCCCEEECCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCH
T ss_conf             78842776544564353002100003415437875521231427889999876315056256676799999888862828


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC-CCCEEEECCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             25630465343000232356778887887514453177788775205-752344215776310352-0001113566544
Q gi|254780206|r  140 IVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGF-EVSFFALCDGKTAIPFTT-ARDHKRIHDGDIG  217 (424)
Q Consensus       140 vVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~-E~Sv~~i~dG~~~~~l~~-~~dyKr~~~~d~G  217 (424)
T Consensus       536 vivRaayalgglgSgfa~n~eeL~~l~~~a~a~-s~QilvekSlkGwkevEyevvrDa~~nciTvcnmen~-----Dplg  609 (1435)
T KOG0370         536 VIVRAAYALGGLGSGFANNEEELQDLAAQALAL-SPQILVEKSLKGWKEVEYEVVRDAYDNCITVCNMENF-----DPLG  609 (1435)
T ss_pred             HHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCC-CCEEEEHHHHCCCCCEEEEEEECCCCCHHHHCCCCCC-----CCCE
T ss_conf             999999985376643344489999997643125-8615422332443434899980200040533577345-----7620


Q ss_pred             CCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE--EEEEEEEEEECCCCCEEEEECC
Q ss_conf             44434430000123443222010000089999986204623566445448985570--4899988651477510443326
Q gi|254780206|r  218 PNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMMMRL  295 (424)
Q Consensus       218 pnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g--p~viE~N~R~GDPE~q~ilp~L  295 (424)
T Consensus       610 ihtGdSiVvapsqtlsd~ey~mlrtta----ikVirhlgv--vGEcniQyaL~p~s~~y~IiEVNarLSrss---aLASk  680 (1435)
T KOG0370         610 IHTGDSIVVAPSQTLSDEEYQMLRTTA----IKVIRHLGV--VGECNIQYALNPYSLEYRIIEVNARLSRSS---ALASK  680 (1435)
T ss_pred             EECCCEEEEEECCCCCHHHHHHHHHCC----HHHEECCCC--CCCCCCEEEECCCCEEEEEEEEEEEEEEHH---HHHCC
T ss_conf             101650799614225768899987502----021102687--665653044166630479999875774013---44326


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEE-ECCEEEECCCCE
Q ss_conf             5441156665420133332123444420675422544668775797624876668986899833587-788799818807
Q gi|254780206|r  296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAI-VNNNLTANGGRV  374 (424)
Q Consensus       296 ~~dl~~il~~~~~g~L~~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~-~~g~l~t~GGRV  374 (424)
T Consensus       681 a-TgypLAy~aAKlalg~~lpe~~n~Vt~~T~AcF-----EpslDY~v~KiprW--Dl~kf~~-vs~~igssmK----Sv  747 (1435)
T KOG0370         681 A-TGYPLAYTAAKLALGIPLPELKNSVTKTTTACF-----EPSLDYCVVKIPRW--DLSKFQR-VSTEIGSSMK----SV  747 (1435)
T ss_pred             C-CCCCHHHHHHHHHCCCCCCCCCCCCCCCEECCC-----CCCHHHEEEECCCC--CHHHHHH-HHHHHCHHHH----HH
T ss_conf             7-667589999987048603467761125200145-----75320134405653--3787878-8876252565----24


Q ss_pred             EEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             999996289899999999998525
Q gi|254780206|r  375 LSATALGKTITESRELAYHMVENI  398 (424)
Q Consensus       375 L~vv~~g~~l~eA~~~ay~~i~~I  398 (424)
T Consensus       748 gEvm~iGR~feea~QKalr~vd~~  771 (1435)
T KOG0370         748 GEVMAIGRTFEEAFQKALRMVDPS  771 (1435)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             666622130799998877514923