HHsearch alignment for GI: 254780206 and conserved domain: PRK00141

>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional.
Probab=93.50  E-value=0.4  Score=28.14  Aligned_cols=91  Identities=20%  Similarity=0.207  Sum_probs=51.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH-CCEE---EECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHH
Q ss_conf             58998865889999999985899678999549835751-1705---5128789899999998718979999795578748
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ-HAQC---VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNG   77 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~-~~~~---~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~g   77 (424)
T Consensus        19 kvlV~GlG~SG~s~a~~L~~~G~--~v~~~D~~~~~~~~~~~~~~~~~~~~~~~~~---~--~~~~d~vV~SPGI~~~~p   91 (476)
T PRK00141         19 RVLVAGAGVSGLGIAKMLSELGC--DVVVADDNETQRHMLIEVVDVADISTAQASD---A--LDSYSIVVTSPGWRPDSP   91 (476)
T ss_pred             CEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCCHHHHHHHHCCCCEECCCCHHH---H--HCCCCEEEECCCCCCCCH
T ss_conf             88999227889999999997899--7999989987035788747985651553065---6--468999998997899799


Q ss_pred             HHHHHHHCCCCEEECCHHHHHH
Q ss_conf             9989860588067010666555
Q gi|254780206|r   78 ISDALNAAGFKVFGPSQRAAKL   99 (424)
Q Consensus        78 i~d~l~~~gi~v~Gp~~~aa~l   99 (424)
T Consensus        92 ~l~~a~~~gi~viseiel~~~~  113 (476)
T PRK00141         92 LLVDAQSAGLEVIGDVELAWRL  113 (476)
T ss_pred             HHHHHHHCCCCEEEHHHHHHHH
T ss_conf             9999998799577199999986