HHsearch alignment for GI: 254780206 and conserved domain: PRK00696

>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional.
Probab=98.75  E-value=4.6e-09  Score=85.48  Aligned_cols=99  Identities=26%  Similarity=0.290  Sum_probs=82.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE-EEEEECCCCCCC----CCCCHHHHHHHHHHHHHHHCCC-----
Q ss_conf             235788876531011112234401111121012420-256304653430----0023235677888788751445-----
Q gi|254780206|r  104 SFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP-IVVKADGLCAGK----GVVVAATVDEATSAIDRCFQQI-----  173 (424)
Q Consensus       104 ~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P-vVVKp~~~agGk----GV~i~~~~~e~~~~~~~~~~~~-----  173 (424)
T Consensus         6 yqaKell~~~gIpvp~g~v~~~~~ea~~~~~~l~~~~~VvKAQV~aGGRGKaGGVk~~~s~~ea~~~a~~ilg~~lvT~Q   85 (388)
T PRK00696          6 YQAKELLAEYGVPVPRGYVAFTPEEAVEAAEELGGPVWVVKAQVHAGGRGKAGGVKVAKSKEEVRAAAEEILGKDLVTHQ   85 (388)
T ss_pred             HHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCEEC
T ss_conf             99999999869989997377999999999998299958999805458888686079908999999999998567742101


Q ss_pred             -------CHHHHHHHHHH-CCCCCEEEECCCCCCCCC
Q ss_conf             -------31777887752-057523442157763103
Q gi|254780206|r  174 -------NSTVIIEEYLE-GFEVSFFALCDGKTAIPF  202 (424)
Q Consensus       174 -------~~~VliEefl~-G~E~Sv~~i~dG~~~~~l  202 (424)
T Consensus        86 Tg~~G~~V~~vlvee~~~i~~E~Ylsi~~DR~~~~~~  122 (388)
T PRK00696         86 TGPEGQPVNRLLIEEGADIAKELYLSAVVDRATRRVV  122 (388)
T ss_pred             CCCCCCEEEEEEEEECCCHHHHEEEEEEEECCCCCEE
T ss_conf             5888844479998751661240689999864778579