HHsearch alignment for GI: 254780206 and conserved domain: PRK05294

>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed.
Probab=100.00  E-value=1.4e-31  Score=248.24  Aligned_cols=286  Identities=20%  Similarity=0.351  Sum_probs=219.1

Q ss_pred             EEEEECCC------HHH------HHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865------889------99999998589967899954983575----117055128789899999998718979
Q gi|254780206|r    2 RVLLIGSG------GRE------HALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsG------grE------hAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
T Consensus       555 kvlvlGsGp~rIGqgiEFDY~~v~a-~~alk~~G~--~~imIN~NPETVSTD~d~sDrLYFEplt~E~V~~I~~~E~p~g  631 (1063)
T PRK05294        555 KVMILGGGPNRIGQGIEFDYCCVHA-ALALREAGY--ETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIIEKEKPKG  631 (1063)
T ss_pred             CEEEECCCCCCCCCCCCCHHHHHHH-HHHHHHCCC--EEEEECCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHCCCE
T ss_conf             3799657773204442300679999-999996598--1589537811111565667614543688999999999758987


Q ss_pred             EEE--CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             999--795578748998986058806701066655520102357888765310111122344011111210124202563
Q gi|254780206|r   66 VVV--GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus        66 viv--gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVK  143 (424)
T Consensus       632 vi~qfGGQt~~--nla~~L~~~g~~ilGts~~~Id~aEDR~~F~~~l~~l~i~qp~~~~a~s~~ea~~~a~~iGyPvlvR  709 (1063)
T PRK05294        632 VIVQFGGQTPL--KLAKALEAAGVPILGTSPDAIDLAEDRERFQKLLEKLGIKQPPNGTATSVEEALEIAEEIGYPVLVR  709 (1063)
T ss_pred             EEEECCCCCHH--HHHHHHHHCCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCHHHHHHHHHHCCCCEEEC
T ss_conf             99973883678--9999999879947778878878787588899999865999999707668999999998649866843


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHC-CCCCEEEECCCCCCCCCCCCCCCC--CCCCCCCCCC
Q ss_conf             0465343000232356778887887514-45317778877520-575234421577631035200011--1356654444
Q gi|254780206|r  144 ADGLCAGKGVVVAATVDEATSAIDRCFQ-QINSTVIIEEYLEG-FEVSFFALCDGKTAIPFTTARDHK--RIHDGDIGPN  219 (424)
Q Consensus       144 p~~~agGkGV~i~~~~~e~~~~~~~~~~-~~~~~VliEefl~G-~E~Sv~~i~dG~~~~~l~~~~dyK--r~~~~d~Gpn  219 (424)
T Consensus       710 PSyVLGG~~M~iv~~~~eL~~yl~~a~~vs~~~pvlIdkfl~ga~E~eVDai~Dg~~v~I~gImEHIE~AGVHSGDS---  786 (1063)
T PRK05294        710 PSYVLGGRAMEIVYDEEELERYMREAVKVSPDHPVLIDRFLEDAIEVDVDAICDGEDVLIGGIMEHIEEAGVHSGDS---  786 (1063)
T ss_pred             CCCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEEHHHHHCHHHHHHEEECCCEEEEEEEEEECCCCCCCCCCC---
T ss_conf             43102577147856999999999999863899977863543202454430231488489999872001457566784---


Q ss_pred             CCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECC----
Q ss_conf             4344300001234432220100000899999862046235664454489855704899988651477510443326----
Q gi|254780206|r  220 TGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL----  295 (424)
Q Consensus       220 TGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L----  295 (424)
T Consensus       787 ----~~V~Pp~~Ls~~~~~~i-~~~t~~ia~~l---~--v~G~~NiQf~vk~~~vyVIE~NpRaSR-----tvPfvSKat  851 (1063)
T PRK05294        787 ----ACSLPPYTLSEEIIDEI-REQTKKLALEL---N--VVGLMNVQFAVKDDEVYVIEVNPRASR-----TVPFVSKAT  851 (1063)
T ss_pred             ----EEEECCCCCCHHHHHHH-HHHHHHHHHHC---C--CCCCCEEEEEECCCEEEEEEECCCCCC-----CCHHHHHHC
T ss_conf             ----28816855899999999-99999999855---6--666420335540983899994474445-----304457641


Q ss_pred             CCCCHHHHHHHHHCC
Q ss_conf             544115666542013
Q gi|254780206|r  296 ESDILEILNSCVHGN  310 (424)
Q Consensus       296 ~~dl~~il~~~~~g~  310 (424)
T Consensus       852 g~pl~~iAtk~~lG~  866 (1063)
T PRK05294        852 GVPLAKIAARVMLGK  866 (1063)
T ss_pred             CCCHHHHHHHHHCCC
T ss_conf             997999999998299