HHsearch alignment for GI: 254780206 and conserved domain: PRK05784

>PRK05784 phosphoribosylamine--glycine ligase; Provisional.
Probab=100.00  E-value=0  Score=1025.85  Aligned_cols=420  Identities=30%  Similarity=0.507  Sum_probs=385.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECC--CHHHHHCCE-----EEECCCCCHHHHHHHHHHHCCCEEEECCCHH
Q ss_conf             958998865889999999985899678999549--835751170-----5512878989999999871897999979557
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPG--NPGIAQHAQ-----CVAIDIQNHSAIIHFCQEKHIDLVVVGPELP   73 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pg--N~g~~~~~~-----~~~i~~~d~~~i~~~a~~~~iDlvivgpE~p   73 (424)
T Consensus         1 MkVLVIGsGGREHAla~kl~~Sp~v~~l~~aPGn~NpG~~~~a~~~~~~~~~~~~~d~~~i~~fa~~~~IDLvvVGPE~P   80 (485)
T PRK05784          1 MKVLLVGDGAREHAIAEALAKSPKGYRIYALSSHLNPGIEEIVKKTGGEYFIGNPTSPGEVVKAAEEVSPDLVVIGPEEP   80 (485)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHCCCCEECCCCCCHHHHHHHHHHCCCCEEEECCHHH
T ss_conf             98999898889999999996098989899973898752567764258721204877999999999981999999897388


Q ss_pred             HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             8748998986058806701066655520102357888765310-111122344011111210124202563046534300
Q gi|254780206|r   74 LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP-TATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKG  152 (424)
Q Consensus        74 L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP-t~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkG  152 (424)
T Consensus        81 L~~Gi~D~l~~~gi~vFGP~k~aA~LE~SK~FaK~fm~~~~IPtta~~~~f~~~~~A~~~l~~~~-piVIKaDGLAaGKG  159 (485)
T PRK05784         81 LFAGVADALREEGFPVFGASSKCAEIEKSKVFARSLMWKYGIPGRLRYGVFKDVEEAYSFAEYGG-SVAIKPARQAGGKG  159 (485)
T ss_pred             HHHHHHHHHHHCCCCEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCC-CEEEECCHHCCCCC
T ss_conf             76125899973799078968899414127889999999728996640121389999999986489-84992113306785


Q ss_pred             CCCHHHHH--------HHH-HHHH------HHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             02323567--------788-8788------75144531777887752057523442157763103520001113566544
Q gi|254780206|r  153 VVVAATVD--------EAT-SAID------RCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIG  217 (424)
Q Consensus       153 V~i~~~~~--------e~~-~~~~------~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~G  217 (424)
T Consensus       160 V~V~~~~~~~~~~~~~e~~~~~~~~~~~~~~~fg~ag~~VvIEEfL~G~E~S~~a~~DG~~~~~lp~aQDhKR~~dgD~G  239 (485)
T PRK05784        160 VKVIYDLQAYLSNEKDEVLTKGAEEIKEQLASYRDVEEKILVEEKVDGVEYTVQVLTDGESVFPLPPVQDNPHAYEYGIG  239 (485)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEEECCEEEECCCCCCCCCCCCCCCC
T ss_conf             18822727777778999999999999987654324687099996446817999999829969989222057655689999


Q ss_pred             CCCCCCCEEECC----CCCCCCCCEEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEE
Q ss_conf             444344300001----23443222010000089999986204-6235664454489855704899988651477510443
Q gi|254780206|r  218 PNTGGMGACSPA----LGMSQELYSTVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMM  292 (424)
Q Consensus       218 pnTGGMGa~~p~----~~~~~~~~~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~il  292 (424)
T Consensus       240 PNTGGMGAysP~~~~~P~l~~~~~~~~-~~Ii~pti~~l~~e~g~~y~GvLY~GlMit~~GPkVlEfN~RfGDPEtQ~iL  318 (485)
T PRK05784        240 PETGGMGSVSGPGELLPFIEEEEYEEA-VEIVKATVEAIRKETGERYVGVLSGQMMLTALGPTVIEYYSRLGDPEALNAL  318 (485)
T ss_pred             CCCCCCEECCCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCEEEEEECCCCCCHHHHHH
T ss_conf             899987006787667754479999999-8748999999986169972788876788618984899996887883388899


Q ss_pred             ECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCCCCC--CCCCCCCCCC--CCCCCEEEEEEEEEECCEEE
Q ss_conf             3265441156665420133332123444420675422544668775--7976248766--68986899833587788799
Q gi|254780206|r  293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYP--HGTIISKIPQ--NTGTTQLFHAGTAIVNNNLT  368 (424)
Q Consensus       293 p~L~~dl~~il~~~~~g~L~~~~~~~~~~~~v~Vvlas~GYP~~~~--kg~~I~~l~~--~~~~~~ifhagt~~~~g~l~  368 (424)
T Consensus       319 p~L~sDl~~l~~a~~~g~L~~~~~~~~~~~av~VVlAs~GYP~~~~~~~g~~i~~~~~~~~~~~~~vfhagt~~~~g~l~  398 (485)
T PRK05784        319 YLYEGDFYELFELAATGKLHKAERRFKEEPTVVKAIAPLGYPLRRDLATGRRIWVDWDSIRREGCLVYFGSVEVEGGKLV  398 (485)
T ss_pred             HHHHCCHHHHHHHHHCCCCCCCCEEECCCCEEEEEEECCCCCCCCCCCCCCEEECCCCCCCCCCCEEEEEEEEEECCEEE
T ss_conf             87426399999999819988787047689569999946999997567899565268422235697899704387799899


Q ss_pred             ECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCC-CEECCHHHHHHH-HHHHHHHC
Q ss_conf             8188079999962898999999999985258999-575351789887-51644430
Q gi|254780206|r  369 ANGGRVLSATALGKTITESRELAYHMVENIDWKH-GYWREDIGLQKK-ERNVKYRN  422 (424)
Q Consensus       369 t~GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g-~~yR~DIG~~~~-~~~~~~~~  422 (424)
T Consensus       399 t~GGRVL~v~a~g~tl~eAr~~aY~~i~~I~f~g~~~yR~DIGt~~~~~~~i~~m~  454 (485)
T PRK05784        399 TLGSRALEILAPGDTYEEAYEKAERCASAVKGDGKLIYRHDIGSPEYMSEMAEKAE  454 (485)
T ss_pred             ECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             83692899999869899999999999850659998877288898799999999999