HHsearch alignment for GI: 254780206 and conserved domain: PRK07206

>PRK07206 hypothetical protein; Provisional.
Probab=99.97  E-value=8.9e-30  Score=235.19  Aligned_cols=373  Identities=19%  Similarity=0.226  Sum_probs=231.7

Q ss_pred             HHHHHHHHHHHHCCC-CCEEEEECCCHHHHHC--CEE---EECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHH
Q ss_conf             889999999985899-6789995498357511--705---5128789899999998718979999795578748998986
Q gi|254780206|r   10 GREHALAWKIAQSPL-LSELWSIPGNPGIAQH--AQC---VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALN   83 (424)
Q Consensus        10 grEhAl~~~l~~s~~-~~~v~~~pgN~g~~~~--~~~---~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~   83 (424)
T Consensus        14 G~~--la~a~~~~G~~~v~V~S~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~aVi~g~E~gV--~lAd~La   89 (415)
T PRK07206         14 GKF--LAPAFKKRGIELIAVTSACDLDPLYYAGFDENIYRQQRIIKHIDETIEFLRQLGPDAVIAGAESGV--ELADRLA   89 (415)
T ss_pred             HHH--HHHHHHHCCCEEEEEEECCCCCHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCEEEECCHHHH--HHHHHHH
T ss_conf             879--999999739828999837988435442324343433210578999999998629729997855659--9999999


Q ss_pred             H-CCCCE-EECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHC---CCCEEEEEECCCCCCCCCCCHHH
Q ss_conf             0-58806-7010666555201023578887653101111223440111112101---24202563046534300023235
Q gi|254780206|r   84 A-AGFKV-FGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQN---KSMPIVVKADGLCAGKGVVVAAT  158 (424)
Q Consensus        84 ~-~gi~v-~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~---~g~PvVVKp~~~agGkGV~i~~~  158 (424)
T Consensus        90 ~~LgLp~~N~~~~~~aR--RdK~~m~~~L~~aGl~~~~~~~~~~~~e~~~~~~~~~~~~~PvVvKP~~gagS~gV~~c~~  167 (415)
T PRK07206         90 ERLGLCYANAPALSSAR--RNKYEMINALANAGLPAIRQIDTADWEEASAWIRVNNLWDSPVVIKPLESAGSDGVFFCPD  167 (415)
T ss_pred             HHHCCCCCCCHHHHHHH--CCHHHHHHHHHHCCCCCCCEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCEEEECC
T ss_conf             98689989955688774--5999999999975998553885299999999998605579998995899998799899799


Q ss_pred             HHHHHHHHHHHHCC------CCHHHHHHHHHHCCCCCEEEE-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             67788878875144------531777887752057523442-15776310352000111356654444434430000123
Q gi|254780206|r  159 VDEATSAIDRCFQQ------INSTVIIEEYLEGFEVSFFAL-CDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG  231 (424)
Q Consensus       159 ~~e~~~~~~~~~~~------~~~~VliEefl~G~E~Sv~~i-~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~  231 (424)
T Consensus       168 ~~el~~a~~~i~~~~n~~g~~~~~vLveEyl~G~EysVe~vs~~G~h~v~~-i~~y~k~~~~--~~~~~~~~~~~~p---  241 (415)
T PRK07206        168 KQDAYHAFNAILGKANKLGLVNESVLVQEFLIGTEYVVNTVSINGNHLVTE-IVRYHKTSLN--RGSVVYDYDELLP---  241 (415)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCEEEEEEEEECCCEEEEE-EEEECCCCCC--CCCEEEECCEECC---
T ss_conf             999999999985665435786753887541468578999998789689999-9997255689--9865653203569---


Q ss_pred             CCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEE-CCCCCEEEEECCCCCCHHHHHHHHHCC
Q ss_conf             4432220100000899999862046235664454489855704899988651-477510443326544115666542013
Q gi|254780206|r  232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRF-GDPECQAMMMRLESDILEILNSCVHGN  310 (424)
Q Consensus       232 ~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~-GDPE~q~ilp~L~~dl~~il~~~~~g~  310 (424)
T Consensus       242 --~--~~~~~~~l~~y~~~~l~ALGi~~-G~~H~Ev~lt~~gp~liE~~~R~~G~~~~~~~~~~~g~~~~~~~v~~~l~~  316 (415)
T PRK07206        242 --C--TSPEYQELVDYTKKALDALGIKN-GPAHAEIMLTSDGPVLIETGARLDGGLHPDAARVATGFSQLDLTAQSLADP  316 (415)
T ss_pred             --C--CHHHHHHHHHHHHHHHHHHCCCC-CCCEEEEEECCCCCEEEEECCCCCCCCCHHHHHHCCCCCHHHHHHHHHCCC
T ss_conf             --9--84899999999999999838775-772189998289828999678778986478998705879999999985093


Q ss_pred             --CCCCCCCCC-CCCEEEEEECCC--CCCCCCCCCCCCCCCCCCCCCCEEEE-EEEEEE-CCEEEECCCCEEEEEEECCC
Q ss_conf             --333212344-442067542254--46687757976248766689868998-335877-88799818807999996289
Q gi|254780206|r  311 --LHNTHINWK-AEYALTVVVATK--GYPEEYPHGTIISKIPQNTGTTQLFH-AGTAIV-NNNLTANGGRVLSATALGKT  383 (424)
Q Consensus       311 --L~~~~~~~~-~~~~v~Vvlas~--GYP~~~~kg~~I~~l~~~~~~~~ifh-agt~~~-~g~l~t~GGRVL~vv~~g~~  383 (424)
T Consensus       317 ~~~~~~~~~y~~~~~~~~v~Lis~~~G~l~~~~gl~~i~~Lpsf-~~~~~~~~~G~~v~~T~Dl~s~pG~v---~L~~~d  392 (415)
T PRK07206        317 DRFRETRESYKLQAHSLNVFLISQAAGVISGKHFLRELQKLPSF-KKSVYYVNEGDNVKVTVDLFSQPGIV---YLVHSD  392 (415)
T ss_pred             HHCCCCCCCCCCCCEEEEEEEECCCCCEEECCHHHHHHHHCCCE-EEEEEECCCCCCCCCCCCCCCCCEEE---EEECCC
T ss_conf             11046788766443489999853999358577269999838875-37999669979808876678998799---997699


Q ss_pred             HHHHHHHHHHHHHCCCCCCCE
Q ss_conf             899999999998525899957
Q gi|254780206|r  384 ITESRELAYHMVENIDWKHGY  404 (424)
Q Consensus       384 l~eA~~~ay~~i~~I~~~g~~  404 (424)
T Consensus       393 -~~~l~~D~~~iR~le~~g~~  412 (415)
T PRK07206        393 -KEQLEQDYRKIRKMESDGFF  412 (415)
T ss_pred             -HHHHHHHHHHHHHHHHCCCE
T ss_conf             -99999999999998645865