HHsearch alignment for GI: 254780206 and conserved domain: PRK07765

>PRK07765 para-aminobenzoate synthase component II; Provisional.
Probab=92.60  E-value=0.94  Score=25.44  Aligned_cols=76  Identities=24%  Similarity=0.217  Sum_probs=44.5

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHH
Q ss_conf             958998865-88999999998589967899954983575117055128789899999998718979999--795578748
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNG   77 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~g   77 (424)
T Consensus         1 MrILiIDn~DSFT~ni~~~lr~lg~--~v~V~~-------------~d~~~~~~~~~~--~~~~dgIILSpGPg~P~~~~   63 (221)
T PRK07765          1 MRILVVDNYDSFVFNLVQYLGQLGV--EAEVWR-------------NDDVRLADEAAV--AAGFDGVLLSPGPGTPERAG   63 (221)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCC--EEEEEE-------------CCCCCHHHHHHH--HCCCCEEEECCCCCCHHHCC
T ss_conf             9799993889339999999987799--189998-------------998998899876--34899899969999801167


Q ss_pred             ----HHHHHHHCCCCEEECC
Q ss_conf             ----9989860588067010
Q gi|254780206|r   78 ----ISDALNAAGFKVFGPS   93 (424)
Q Consensus        78 ----i~d~l~~~gi~v~Gp~   93 (424)
T Consensus        64 ~~~~~i~~~~~~~iPILGIC   83 (221)
T PRK07765         64 ASIDMVRACAAAGTPLLGVC   83 (221)
T ss_pred             CCHHHHHHHHCCCCCEEEEE
T ss_conf             24889987532599889870