HHsearch alignment for GI: 254780206 and conserved domain: PRK13278

>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional.
Probab=98.95  E-value=4e-08  Score=78.69  Aligned_cols=263  Identities=19%  Similarity=0.254  Sum_probs=154.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCC-CEEEECCCHHHH
Q ss_conf             95899886588999999998589967899954983575----1170551287898999999987189-799997955787
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHI-DLVVVGPELPLV   75 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~i-DlvivgpE~pL~   75 (424)
T Consensus        19 i~I~tl~SHSALq-Il~GAK~EGF~T~~vc~~gr~~~Y~~f~~~De~iv~--d~f~di~~~q~~L~~~NaI~I-PhgSfv   94 (356)
T PRK13278         19 ITIATIGSHSSLQ-ILKGAKKEGFRTIAICEKKREKFYKRFPFADEFIIV--DSFSDILEIQEELREMNAIVI-PHGSFV   94 (356)
T ss_pred             CEEEEEECHHHHH-HHCCHHHCCCCEEEEECCCCCCHHHHCCCCCEEEEE--CCHHHHHHHHHHHHHCCEEEE-CCCCEE
T ss_conf             3899984425988-853287739957999669974534547764279994--768999999999987896996-488858


Q ss_pred             HHH-HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCC
Q ss_conf             489-9898605880670106665552010235788876531011112234401111121012420256304653430002
Q gi|254780206|r   76 NGI-SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVV  154 (424)
Q Consensus        76 ~gi-~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~  154 (424)
T Consensus        95 ~Y~G~~~iE~~~VP~FG-NR~lLrwEs~r~~~~~lLe~Agi~~Pk--~~~~Pee-------IDr~VIVK~~gAkggrGyF  164 (356)
T PRK13278         95 AYLGLENVEEFKVPMFG-NREILRWESDRDKERKLLEGAGIRIPR--KYEDPED-------IDGPVIVKLPGAKGGRGYF  164 (356)
T ss_pred             EEECHHHHHHCCCCCCC-CHHHHHHHHCHHHHHHHHHHCCCCCCE--ECCCHHH-------CCCCEEEEECCCCCCCEEE
T ss_conf             98368888508888205-877866510307899999867999871--1589555-------7852699746777774589


Q ss_pred             CHHHHHHHHHHHHHHHCC----CCHHHHHHHHHHCCCCCEEEECC--CCCCCCCCCCCCCCCCCCC------------CC
Q ss_conf             323567788878875144----53177788775205752344215--7763103520001113566------------54
Q gi|254780206|r  155 VAATVDEATSAIDRCFQQ----INSTVIIEEYLEGFEVSFFALCD--GKTAIPFTTARDHKRIHDG------------DI  216 (424)
Q Consensus       155 i~~~~~e~~~~~~~~~~~----~~~~VliEefl~G~E~Sv~~i~d--G~~~~~l~~~~dyKr~~~~------------d~  216 (424)
T Consensus       165 ~a~s~~ef~~k~~~l~~~g~i~d~~~~~IeEyv~G~~~~~~yFySpl~~~lEllg~D~R~esniDg~~rlPa~~qle~~~  244 (356)
T PRK13278        165 IASSPEEFWEKIDRLKEKGLIEDVEKYIIQEYVVGVPYYIHYFYSPIKNRLELLGIDRRYESNIDGLVRIPAKDQLEAGI  244 (356)
T ss_pred             EECCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCEEEHHHCCCCCCCCEEEEECCEEEEECCHHHCCCCHHHHHHCCC
T ss_conf             95798999999999886275455544279998347412312203520066136631003440522320488788853689


Q ss_pred             CCC---CCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECCE-EEEEEEEEEE
Q ss_conf             444---434430000123443222010000089999986204-623566445448985570-4899988651
Q gi|254780206|r  217 GPN---TGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQG-PYLIEYNVRF  283 (424)
Q Consensus       217 Gpn---TGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~g-p~viE~N~R~  283 (424)
T Consensus       245 ~p~~vvvGn----~p~-vlRESLL~~vf~-~ge~fV~a~k~l~~PG~iGPFcLq~vvt~~le~vvFevS~RI  310 (356)
T PRK13278        245 DPTYVVTGN----IPL-VLRESLLPQVFE-YGERFVEASKELVGPGMIGPFCLESVITDDLEIVVFEISARI  310 (356)
T ss_pred             CCCEEEECC----CCC-EEEHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEEEEEEEECCC
T ss_conf             984699888----532-441765799999-999999999974699863454366898698609999985431