HHsearch alignment for GI: 254780206 and conserved domain: PRK13789

>PRK13789 phosphoribosylamine--glycine ligase; Provisional.
Probab=100.00  E-value=0  Score=1059.12  Aligned_cols=414  Identities=40%  Similarity=0.696  Sum_probs=402.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH--CCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             958998865889999999985899678999549835751--170551287898999999987189799997955787489
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~--~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
T Consensus         5 MkVLviGsGGREHAia~kl~~S~~v~~v~~aPGN~G~~~~~~~~~~~i~~~d~~~i~~fa~~~~idLvvvGPE~PL~~Gi   84 (426)
T PRK13789          5 LKVLLIGSGGRESAIAFALRKSNLLSELKVFPGNGGFPDDELLPADSFSILDKSSVQSFLKSNPFDLIVVGPEDPLVAGF   84 (426)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCHHHHHHH
T ss_conf             88999898889999999996198988799988976112345454443386699999999998499999989668886317


Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHH
Q ss_conf             98986058806701066655520102357888765310111122344011111210124202563046534300023235
Q gi|254780206|r   79 SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAAT  158 (424)
Q Consensus        79 ~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~  158 (424)
T Consensus        85 ~D~l~~~gi~vfGP~k~aA~LE~SK~faK~fm~~~~IPTa~~~~f~~~~~A~~~l~~~~~P~VIKaDGLAaGKGV~V~~~  164 (426)
T PRK13789         85 ADWAAELGIPCFGPDSYCAQVEGSKHFAKSLMKEAKIPTASYKTFTEYSSSLSYLESEMLPIVIKADGLAAGKGVTVATE  164 (426)
T ss_pred             HHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEECC
T ss_conf             99984169916895989950512698999999972999760157368999999998579988996787689996695399


Q ss_pred             HHHHHHHHHHHH-----CCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCC
Q ss_conf             677888788751-----445317778877520575234421577631035200011135665444443443000012344
Q gi|254780206|r  159 VDEATSAIDRCF-----QQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS  233 (424)
Q Consensus       159 ~~e~~~~~~~~~-----~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~  233 (424)
T Consensus       165 ~~eA~~al~~i~~~~~fg~ag~~VvIEE~L~G~E~S~~a~~dG~~~~~lp~aQDhKR~~dgD~GPNTGGMGaysP~p~~~  244 (426)
T PRK13789        165 KKMAKRALKEIFKDKKFGQSGNQVVIEEFMEGQEASIFAISDGDSYFLLPAAQDHKRAFDGDQGPNTGGMGAYCPAPVIT  244 (426)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCEEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999999997544233035875999974589844799997299778688644442133799999999876777786689


Q ss_pred             CCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             3222010000089999986204623566445448985570-489998865147751044332654411566654201333
Q gi|254780206|r  234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLH  312 (424)
Q Consensus       234 ~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~  312 (424)
T Consensus       245 ~~~~~~i~~~ii~pt~~~l~~~g~~y~GvLy~GlMlt~~G~pkVlEfN~RfGDPE~q~iLp~L~~dl~~~~~a~~~g~L~  324 (426)
T PRK13789        245 EAILQKVKERIFDPMFDDFRKKGHPYRGLLYAGLMISPEGEPKVVEFNCRFGDPETQCVLAMLDGDLLELLYAASTGKIK  324 (426)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             99999999860489999998589998867653289926997699998853189168889887415499999999708866


Q ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHH
Q ss_conf             32123444420675422544668775797624876668986899833587788799818807999996289899999999
Q gi|254780206|r  313 NTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAY  392 (424)
Q Consensus       313 ~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~ay  392 (424)
T Consensus       325 ~~~~~~~~~~~v~vvlas~GYP~~~~kg~~I~~~~~~~~~~~vfhagt~~~~g~l~t~GGRVL~v~a~g~tl~eA~~~aY  404 (426)
T PRK13789        325 VVNLKLKQGAAAVVVLAAQGYPDSYEKNIPLNLPETSGQNVVLFHAGTKKKDGKVFSSGGRILGIVAQGKDLKDSVDQAY  404 (426)
T ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCEECCCCCCCCCEEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHH
T ss_conf             45443026740699974688999777998851866677986999703441799899735938999997699999999999


Q ss_pred             HHHHCCCCCCCEECCHHHHHHH
Q ss_conf             9985258999575351789887
Q gi|254780206|r  393 HMVENIDWKHGYWREDIGLQKK  414 (424)
Q Consensus       393 ~~i~~I~~~g~~yR~DIG~~~~  414 (424)
T Consensus       405 ~~i~~I~~~g~~yR~DIG~ral  426 (426)
T PRK13789        405 SFLEKIQAPKTFYRKDIGRRAL  426 (426)
T ss_pred             HHHHHCCCCCCEECCCCCHHHC
T ss_conf             9996068999880583202019