HHsearch alignment for GI: 254780206 and conserved domain: TIGR01214

>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen. dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=96.02  E-value=0.015  Score=38.52  Aligned_cols=62  Identities=21%  Similarity=0.370  Sum_probs=44.6

Q ss_pred             EEEEECCCH---HHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             589988658---899999999858996789995498357511705512878989999999871897999
Q gi|254780206|r    2 RVLLIGSGG---REHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         2 kILviGsGg---rEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
T Consensus         1 rilitGa~GQlG~~--L~~~l~~~g--~~~~~~~~~~~~~~~~~~~~~Dl~dP~~l~~~~r~~~Pd~vv   65 (317)
T TIGR01214         1 RILITGANGQLGRE--LVQQLSKPG--RVVVALTRSTRLKLAARWSQLDLTDPEALEELLRAIRPDAVV   65 (317)
T ss_pred             CEEEECCCCHHHHH--HHHHCCCCC--CEEEEECCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCEEE
T ss_conf             97887387567999--999707888--278643687776113365440622468899999852875376