HHsearch alignment for GI: 254780206 and conserved domain: TIGR01380

>TIGR01380 glut_syn glutathione synthase; InterPro: IPR006284 These are the glutathione synthetases found in Gram-negative bacteria. This gene does not appear to be present in genomes of Gram-positive bacteria. Glutathione synthetase has an ATP-binding domain in the COOH terminus and catalyzes the second step in the glutathione biosynthesis pathway: ATP + gamma-L-glutamyl-L-cysteine + glycine = ADP + phosphate + glutathione. Glutathione is a tripeptide that functions as a reductant in many cellular reactions. ; GO: 0004363 glutathione synthase activity, 0006750 glutathione biosynthetic process.
Probab=97.06  E-value=0.00039  Score=49.89  Aligned_cols=227  Identities=23%  Similarity=0.346  Sum_probs=126.8

Q ss_pred             HHHHHHHHHH-----H-CCCEEEECCCHH-----H-HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             8999999987-----1-897999979557-----8-74899898605880670106665552010235788876531011
Q gi|254780206|r   51 HSAIIHFCQE-----K-HIDLVVVGPELP-----L-VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA  118 (424)
Q Consensus        51 ~~~i~~~a~~-----~-~iDlvivgpE~p-----L-~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~  118 (424)
T Consensus        71 ~~~w~~~~~~~~~~L~d~~d~vlMRkDPPf~~~Y~yaT~lLe~~~~~g~~vi-N~P~~lRd~NEKl~~~~F-p~~---~p  145 (322)
T TIGR01380        71 KQDWYTLGEKVRLALKDELDVVLMRKDPPFDMEYIYATYLLELAEPTGTLVI-NSPQGLRDANEKLFALQF-PKV---IP  145 (322)
T ss_pred             CHHHHHHHHHHHHCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEE-ECCCHHHCCCHHHHHHCC-CCC---CC
T ss_conf             1278887665420113574299984750986315446778877842796798-488232246603454334-123---58


Q ss_pred             CCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHH-HHHHHHHHHHCCCCHHHHHHHHHHCCCCCE----EEE
Q ss_conf             112234401111121012420256304653430002323567-788878875144531777887752057523----442
Q gi|254780206|r  119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVD-EATSAIDRCFQQINSTVIIEEYLEGFEVSF----FAL  193 (424)
Q Consensus       119 ~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~-e~~~~~~~~~~~~~~~VliEefl~G~E~Sv----~~i  193 (424)
T Consensus       146 pTLvt~~~~~ir~F~~e~~-divLKPL~g~GG~gi~Rl~~~DpN~~~i~E~~~~~g~~~~~aQ~ylp--ei~~GDKRilL  222 (322)
T TIGR01380       146 PTLVTRDKAEIRAFLAEHG-DIVLKPLDGMGGEGIFRLDPGDPNLNSILETLTQLGREPVMAQRYLP--EIKEGDKRILL  222 (322)
T ss_pred             CCCEECCHHHHHHHHHHHH-CEEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCEEEEEECHH--HHHHCCCEEEE
T ss_conf             8501067799999998751-25872666777843676178998556898887652671687650205--76617965999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEE
Q ss_conf             1577631035200011135665---4444434430000123443222010000089999986204623566445448985
Q gi|254780206|r  194 CDGKTAIPFTTARDHKRIHDGD---IGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT  270 (424)
Q Consensus       194 ~dG~~~~~l~~~~dyKr~~~~d---~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t  270 (424)
T Consensus       223 ~~G~---Pig~a~--~Rip~~gE~RgNlavGG~~~a~~---L~~rD-~eI-c~~~~P~---L~~r-----Gl~fvGi--D  282 (322)
T TIGR01380       223 IDGE---PIGYAV--ARIPAGGEFRGNLAVGGRGEAQE---LSERD-REI-CATVAPE---LKRR-----GLLFVGI--D  282 (322)
T ss_pred             ECCE---ECCCCE--EECCCCCCCCHHHCCCCEEEECC---CCHHH-HHH-HHHHCCC---CCCC-----CEEEEEE--E
T ss_conf             7883---500101--40278875000200288622002---66789-999-9871610---0207-----7479754--6


Q ss_pred             CCEEEEEEEEEEECCCCCEEEEECCCC-CCHHHHHHHH
Q ss_conf             570489998865147751044332654-4115666542
Q gi|254780206|r  271 EQGPYLIEYNVRFGDPECQAMMMRLES-DILEILNSCV  307 (424)
Q Consensus       271 ~~gp~viE~N~R~GDPE~q~ilp~L~~-dl~~il~~~~  307 (424)
T Consensus       283 VIG~~LTEvNVTS--PTGi~Ei~~~~G~~~~~~~~d~~  318 (322)
T TIGR01380       283 VIGGYLTEVNVTS--PTGIREIDRQKGVNIAEQLIDAI  318 (322)
T ss_pred             EECCCCEEEECCC--CHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             7778007983146--45689887635855899999998