Query         gi|254780206|ref|YP_003064619.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 424
No_of_seqs    238 out of 3227
Neff          6.7 
Searched_HMMs 39220
Date          Mon May 23 14:36:27 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780206.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00877 purD phosphoribosyla 100.0       0       0 1120.7  27.0  415    1-415     1-459 (459)
  2 PRK00885 phosphoribosylamine-- 100.0       0       0 1070.8  33.0  417    1-417     1-422 (424)
  3 PRK13789 phosphoribosylamine-- 100.0       0       0 1059.1  30.8  414    1-414     5-426 (426)
  4 PRK13790 phosphoribosylamine-- 100.0       0       0 1041.6  32.4  412    1-417     1-415 (415)
  5 PRK05784 phosphoribosylamine-- 100.0       0       0 1025.8  29.6  420    1-422     1-454 (485)
  6 COG0151 PurD Phosphoribosylami 100.0       0       0 1023.4  28.9  417    1-417     1-426 (428)
  7 PRK06395 phosphoribosylamine-- 100.0       0       0  977.5  31.3  418    1-422     3-431 (435)
  8 KOG0237 consensus              100.0       0       0  964.2  26.2  416    1-416     3-429 (788)
  9 pfam01071 GARS_A Phosphoribosy 100.0       0       0  372.0   8.5  188  101-288     1-193 (193)
 10 PRK09288 purT phosphoribosylgl 100.0 5.5E-36 1.4E-40  280.0  23.3  367    2-403    14-395 (395)
 11 TIGR01369 CPSaseII_lrg carbamo 100.0 1.7E-37 4.4E-42  291.0  11.4  288    2-311   575-889 (1089)
 12 PRK12767 carbamoyl phosphate s 100.0 5.6E-35 1.4E-39  272.8  20.6  297    1-325     2-310 (325)
 13 PRK02186 argininosuccinate lya 100.0 1.5E-33 3.8E-38  262.5  19.0  372   15-414    18-402 (892)
 14 PRK12815 carB carbamoyl phosph 100.0 2.9E-32 7.4E-37  253.2  19.0  284    2-310   556-864 (1068)
 15 PRK05294 carB carbamoyl phosph 100.0 1.4E-31 3.5E-36  248.2  21.8  286    2-310   555-866 (1063)
 16 PRK05294 carB carbamoyl phosph 100.0 3.4E-29 8.6E-34  231.0  21.7  381    2-415     9-420 (1063)
 17 PRK07206 hypothetical protein; 100.0 8.9E-30 2.3E-34  235.2  17.4  373   10-404    14-412 (415)
 18 pfam02844 GARS_N Phosphoribosy 100.0 1.9E-30 4.8E-35  240.1  11.6   99    2-100     1-99  (99)
 19 COG0027 PurT Formate-dependent 100.0 5.7E-28 1.5E-32  222.1  22.1  360    2-401    14-393 (394)
 20 COG0439 AccC Biotin carboxylas 100.0 3.1E-27 7.8E-32  216.8  25.2  388    1-412     3-422 (449)
 21 PRK08462 biotin carboxylase; V 100.0 1.8E-27 4.6E-32  218.5  23.3  379    2-412     6-423 (446)
 22 TIGR01369 CPSaseII_lrg carbamo 100.0 3.7E-29 9.5E-34  230.7  13.0  360    2-397     8-402 (1089)
 23 PRK12815 carB carbamoyl phosph 100.0 6.7E-28 1.7E-32  221.6  18.6  363    2-397     9-402 (1068)
 24 PRK08654 pyruvate carboxylase  100.0 1.1E-26 2.8E-31  212.8  24.4  371    2-411     4-420 (497)
 25 PRK05586 biotin carboxylase; V 100.0 2.9E-26 7.3E-31  209.9  22.9  379    2-411     4-421 (447)
 26 PRK01372 ddl D-alanine--D-alan 100.0 9.6E-28 2.5E-32  220.5  15.0  275    1-310     5-300 (304)
 27 PRK06111 acetyl-CoA carboxylas 100.0 2.1E-25 5.4E-30  203.5  23.4  380    2-411     4-420 (449)
 28 PRK06019 phosphoribosylaminoim  99.9   1E-25 2.6E-30  205.9  20.9  359    1-401     8-374 (377)
 29 PRK12833 acetyl-CoA carboxylas  99.9 1.8E-25 4.7E-30  204.0  21.4  378    2-412     7-425 (458)
 30 PRK08591 acetyl-CoA carboxylas  99.9   2E-25 5.1E-30  203.7  21.6  378    2-411     4-419 (449)
 31 PRK07178 acetyl-CoA carboxylas  99.9 2.5E-25 6.4E-30  203.0  20.3  380    2-411     4-419 (471)
 32 TIGR01205 D_ala_D_alaTIGR D-al  99.9 1.9E-26 4.7E-31  211.2  12.8  232   61-307   105-371 (375)
 33 PRK01966 ddl D-alanyl-alanine   99.9   3E-26 7.6E-31  209.7  13.6  233   59-309    87-341 (344)
 34 PRK08463 acetyl-CoA carboxylas  99.9 2.4E-24   6E-29  196.0  22.6  380    2-411     4-421 (478)
 35 COG0458 CarB Carbamoylphosphat  99.9 1.5E-24 3.7E-29  197.5  20.7  363    1-397     6-389 (400)
 36 PRK12999 pyruvate carboxylase;  99.9 1.5E-23 3.9E-28  190.2  23.0  374    2-411     7-432 (1147)
 37 TIGR00514 accC acetyl-CoA carb  99.9 3.3E-24 8.5E-29  194.9  16.1  331   46-414    58-426 (451)
 38 TIGR01235 pyruv_carbox pyruvat  99.9 4.6E-24 1.2E-28  193.9  16.6  333   42-402    57-426 (1169)
 39 pfam02843 GARS_C Phosphoribosy  99.9 4.1E-25   1E-29  201.5   8.6   92  322-414     1-92  (92)
 40 TIGR02712 urea_carbox urea car  99.9 8.3E-22 2.1E-26  177.6  19.4  367    2-403     3-422 (1226)
 41 pfam02786 CPSase_L_D2 Carbamoy  99.9 4.1E-24 1.1E-28  194.2   5.8  195  102-310     1-206 (211)
 42 COG4770 Acetyl/propionyl-CoA c  99.9 6.3E-22 1.6E-26  178.5  13.7  365    2-403     4-415 (645)
 43 KOG0238 consensus               99.9 1.2E-19 3.1E-24  161.9  20.2  327   47-403    55-412 (670)
 44 COG1038 PycA Pyruvate carboxyl  99.9 7.8E-20   2E-24  163.3  18.3  331   45-402    62-427 (1149)
 45 KOG0369 consensus               99.8 5.2E-19 1.3E-23  157.4  19.8  326   47-403    91-451 (1176)
 46 COG0026 PurK Phosphoribosylami  99.8 2.2E-18 5.6E-23  152.9  20.4  360    1-401     2-371 (375)
 47 pfam02655 ATP-grasp_3 ATP-gras  99.8 5.4E-21 1.4E-25  171.7   6.1  157  101-284     2-158 (160)
 48 pfam07478 Dala_Dala_lig_C D-al  99.8 8.8E-21 2.2E-25  170.2   5.3  161  109-284     1-174 (201)
 49 pfam08443 RimK RimK-like ATP-g  99.8 3.6E-20 9.1E-25  165.8   8.1  167  101-286     2-172 (190)
 50 pfam02222 ATP-grasp ATP-grasp   99.8 7.7E-21   2E-25  170.6   4.6  158  110-285     1-162 (171)
 51 TIGR01161 purK phosphoribosyla  99.8 9.8E-19 2.5E-23  155.4  14.7  351    2-389     1-385 (386)
 52 COG1181 DdlA D-alanine-D-alani  99.8 3.1E-18 7.8E-23  151.8  12.2  225   60-295    59-297 (317)
 53 PRK06849 hypothetical protein;  99.8 3.5E-17 8.9E-22  144.2  16.7  258    1-284     5-277 (387)
 54 PRK10446 ribosomal protein S6   99.8   1E-17 2.6E-22  148.1  13.5  274    1-311     1-290 (300)
 55 KOG0370 consensus               99.8 2.8E-17 7.2E-22  144.8  15.0  289    3-310   921-1231(1435)
 56 KOG0368 consensus               99.7 3.8E-14 9.8E-19  122.2  18.4  338   47-411   122-527 (2196)
 57 TIGR02068 cya_phycin_syn cyano  99.6   5E-16 1.3E-20  135.8   4.8  123   68-193   162-312 (876)
 58 TIGR03103 trio_acet_GNAT GNAT-  99.6 6.6E-15 1.7E-19  127.7   7.8  196   73-284   242-523 (547)
 59 COG0189 RimK Glutathione synth  99.6 8.9E-14 2.3E-18  119.6  11.9  229   59-308    75-312 (318)
 60 KOG0370 consensus               99.6   8E-15   2E-19  127.1   6.3  366    2-398   379-771 (1435)
 61 TIGR01142 purT phosphoribosylg  99.5 4.1E-13   1E-17  114.8  14.6  370    2-400     1-406 (407)
 62 COG1821 Predicted ATP-utilizin  99.5 1.1E-12 2.8E-17  111.7  16.4  275    1-323     1-294 (307)
 63 TIGR00768 rimK_fam alpha-L-glu  99.5 1.4E-13 3.6E-18  118.1  10.9  268   12-305    20-319 (321)
 64 TIGR02144 LysX_arch Lysine bio  99.5 9.6E-14 2.5E-18  119.3   9.2  201   61-282    47-261 (289)
 65 COG2232 Predicted ATP-dependen  99.5 3.3E-12 8.4E-17  108.2  15.4  336    2-400    13-374 (389)
 66 PRK02471 bifunctional glutamat  99.4 3.9E-13   1E-17  114.9   7.9   98   98-197   485-586 (753)
 67 COG3919 Predicted ATP-grasp en  99.1   3E-09 7.6E-14   86.9  12.1  284    3-310     6-313 (415)
 68 TIGR01016 sucCoAbeta succinyl-  99.0 3.2E-10 8.1E-15   93.9   3.3  101  104-204     6-126 (389)
 69 PRK13278 purP 5-formaminoimida  98.9   4E-08   1E-12   78.7  13.2  263    1-283    19-310 (356)
 70 pfam08442 ATP-grasp_2 ATP-gras  98.9   1E-09 2.6E-14   90.2   3.2   95  105-199     6-118 (202)
 71 COG0045 SucC Succinyl-CoA synt  98.8 1.4E-09 3.6E-14   89.2   1.4  101  104-204     6-124 (387)
 72 PRK05246 glutathione synthetas  98.8 5.2E-08 1.3E-12   77.9   9.4  280    1-311     2-313 (316)
 73 pfam02955 GSH-S_ATP Prokaryoti  98.8 2.6E-08 6.6E-13   80.1   6.8  146  117-283    12-163 (176)
 74 PRK00696 sucC succinyl-CoA syn  98.7 4.6E-09 1.2E-13   85.5   2.8   99  104-202     6-122 (388)
 75 PRK13277 5-formaminoimidazole-  98.6 2.3E-06 5.9E-11   66.0  14.0  263    1-286    15-320 (363)
 76 COG1759 5-formaminoimidazole-4  98.5 5.9E-06 1.5E-10   63.0  12.9  255    1-285    19-318 (361)
 77 TIGR02291 rimK_rel_E_lig alpha  98.5 5.1E-07 1.3E-11   70.7   6.8  180  101-284    36-271 (320)
 78 PRK06524 biotin carboxylase-li  98.4 4.4E-06 1.1E-10   63.9  11.1  220   50-285    78-312 (480)
 79 PRK12458 glutathione synthetas  98.3 4.4E-06 1.1E-10   63.9   7.9  229   62-313    85-333 (349)
 80 pfam05770 Ins134_P3_kin Inosit  97.8  0.0002 5.2E-09   51.9   9.4  231   52-303    25-305 (307)
 81 COG1748 LYS9 Saccharopine dehy  97.8 0.00048 1.2E-08   49.2  10.7  109    1-116     2-118 (389)
 82 pfam00289 CPSase_L_chain Carba  97.4  0.0021 5.3E-08   44.6   9.2   90    2-96      3-108 (109)
 83 pfam02571 CbiJ Precorrin-6x re  97.1   0.012 2.9E-07   39.2  10.3  119    1-138     1-128 (246)
 84 TIGR01380 glut_syn glutathione  97.1 0.00039 9.9E-09   49.9   2.7  227   51-307    71-318 (322)
 85 pfam01408 GFO_IDH_MocA Oxidore  96.9  0.0056 1.4E-07   41.5   7.8  111    1-117     1-116 (120)
 86 COG2099 CobK Precorrin-6x redu  96.8   0.025 6.3E-07   36.9  10.3  120    1-137     3-128 (257)
 87 KOG2799 consensus               96.8 0.00033 8.3E-09   50.4   0.5  102  105-206    29-155 (434)
 88 COG1091 RfbD dTDP-4-dehydrorha  96.4   0.027 6.8E-07   36.6   8.3  135    1-152     1-155 (281)
 89 PRK09987 dTDP-4-dehydrorhamnos  96.3   0.015 3.8E-07   38.4   6.4   59    1-68      1-60  (299)
 90 CHL00194 ycf39 Ycf39; Provisio  96.2    0.13 3.3E-06   31.7  11.9  112    1-116     1-138 (319)
 91 COG0673 MviM Predicted dehydro  96.2   0.063 1.6E-06   33.9   9.0  142    1-146     4-155 (342)
 92 TIGR01214 rmlD dTDP-4-dehydror  96.0   0.015 3.7E-07   38.5   5.1   62    2-67      1-65  (317)
 93 pfam03133 TTL Tubulin-tyrosine  95.9  0.0098 2.5E-07   39.8   3.8   41  138-184    67-107 (291)
 94 PRK11579 putative oxidoreducta  95.7    0.16 4.2E-06   30.9   9.5  137    1-144     5-150 (346)
 95 PRK08057 cobalt-precorrin-6x r  95.7    0.22 5.7E-06   29.9  10.7  120    1-137     2-125 (241)
 96 pfam03435 Saccharop_dh Sacchar  95.5    0.25 6.3E-06   29.6  11.0   88    3-92      1-97  (384)
 97 pfam02629 CoA_binding CoA bind  95.5    0.11 2.7E-06   32.3   7.8   85    2-90      5-90  (96)
 98 KOG1447 consensus               95.4   0.016   4E-07   38.2   3.5  180  105-299    26-244 (412)
 99 TIGR03023 WcaJ_sugtrans Undeca  95.2    0.31   8E-06   28.9   9.8   88    2-90    130-222 (451)
100 TIGR01435 glu_cys_lig_rel puta  95.1   0.037 9.4E-07   35.6   4.4   99   99-198   487-590 (754)
101 TIGR03025 EPS_sugtrans exopoly  94.9    0.37 9.4E-06   28.4   9.9   88    2-91    127-220 (445)
102 KOG3895 consensus               94.7    0.15 3.8E-06   31.2   6.8  221   57-313   150-396 (488)
103 PRK07578 short chain dehydroge  94.4    0.27   7E-06   29.3   7.5   58    1-67      1-60  (199)
104 COG2344 AT-rich DNA-binding pr  94.4    0.41 1.1E-05   28.0   8.4   42   47-88    131-172 (211)
105 COG1181 DdlA D-alanine-D-alani  94.2   0.054 1.4E-06   34.4   3.5   97   99-195    48-150 (317)
106 TIGR02482 PFKA_ATP 6-phosphofr  93.8     0.6 1.5E-05   26.8   8.2  146   52-206    81-253 (302)
107 pfam06849 DUF1246 Protein of u  93.7    0.62 1.6E-05   26.7   8.2  112    3-120     1-122 (124)
108 pfam11379 DUF3182 Protein of u  93.6   0.044 1.1E-06   35.0   2.1   94  101-198   102-201 (355)
109 PRK03369 murD UDP-N-acetylmura  93.5     0.4   1E-05   28.1   6.9   91    2-99     14-107 (487)
110 PRK04663 murD UDP-N-acetylmura  93.5    0.59 1.5E-05   26.9   7.8   94    1-98      8-104 (438)
111 PRK00141 murD UDP-N-acetylmura  93.5     0.4   1E-05   28.1   6.9   91    2-99     19-113 (476)
112 PRK10084 dTDP-glucose 4,6 dehy  93.4    0.72 1.8E-05   26.3   8.4   66    1-67      1-78  (352)
113 PRK01390 murD UDP-N-acetylmura  93.2    0.34 8.6E-06   28.7   6.1   84    2-91     11-98  (457)
114 PRK10675 UDP-galactose-4-epime  93.1    0.74 1.9E-05   26.2   7.7   65    1-67      1-78  (338)
115 PRK00421 murC UDP-N-acetylmura  93.0    0.83 2.1E-05   25.8   8.8  107    2-116    10-136 (459)
116 PRK00683 murD UDP-N-acetylmura  93.0    0.49 1.2E-05   27.5   6.7   86    2-93      5-90  (418)
117 cd03784 GT1_Gtf_like This fami  92.9    0.85 2.2E-05   25.8   8.8   24    1-24      1-29  (401)
118 PRK01641 leuD isopropylmalate   92.8    0.24   6E-06   29.8   4.9   21  124-144    81-101 (201)
119 PRK08300 acetaldehyde dehydrog  92.7    0.91 2.3E-05   25.5   8.6   90    1-90      5-98  (298)
120 PRK09009 C factor cell-cell si  92.6    0.93 2.4E-05   25.5   8.5   67    1-67      1-72  (235)
121 PRK07765 para-aminobenzoate sy  92.6    0.94 2.4E-05   25.4   8.0   76    1-93      1-83  (221)
122 PRK12778 putative bifunctional  92.5    0.97 2.5E-05   25.3   9.5   88    2-90    100-207 (760)
123 TIGR02477 PFKA_PPi diphosphate  92.3    0.67 1.7E-05   26.5   6.7   94    1-94     75-205 (566)
124 PRK04308 murD UDP-N-acetylmura  92.2    0.74 1.9E-05   26.2   6.8   91    2-98      7-103 (445)
125 PRK02472 murD UDP-N-acetylmura  92.1     1.1 2.7E-05   25.0   8.5   89    2-96     11-106 (450)
126 COG0771 MurD UDP-N-acetylmuram  92.0    0.64 1.6E-05   26.6   6.3  115    1-121     8-143 (448)
127 TIGR00715 precor6x_red precorr  91.5     1.2 3.1E-05   24.6   7.6   65    1-67      1-72  (260)
128 COG1087 GalE UDP-glucose 4-epi  91.4     1.3 3.2E-05   24.5   7.4   64    1-67      1-72  (329)
129 PRK05472 redox-sensing transcr  91.1     1.4 3.5E-05   24.3   8.9   44   46-89    130-173 (211)
130 PRK04690 murD UDP-N-acetylmura  91.0     0.5 1.3E-05   27.4   4.9   83    2-93     10-100 (468)
131 PRK03806 murD UDP-N-acetylmura  91.0     1.3 3.4E-05   24.4   7.0   85    2-92      8-95  (438)
132 PRK10206 putative dehydrogenas  91.0     1.4 3.5E-05   24.2   8.2  135    2-142     4-149 (345)
133 PRK12775 putative trifunctiona  90.8     1.4 3.6E-05   24.1  10.1   86    2-90    101-208 (993)
134 pfam08886 GshA Glutamate-cyste  90.8    0.58 1.5E-05   27.0   5.0  101   62-165   152-288 (404)
135 TIGR01361 DAHP_synth_Bsub phos  90.5    0.74 1.9E-05   26.2   5.4   78  120-207   116-201 (262)
136 cd01492 Aos1_SUMO Ubiquitin ac  90.5     1.5 3.9E-05   23.9   9.5  112    1-118    22-139 (197)
137 cd01065 NAD_bind_Shikimate_DH   89.9    0.67 1.7E-05   26.5   4.7   34    2-36     21-54  (155)
138 pfam01902 ATP_bind_4 ATP-bindi  89.7     1.8 4.5E-05   23.5  11.6  134    1-145     1-142 (219)
139 pfam00899 ThiF ThiF family. Th  89.7     1.8 4.5E-05   23.5   8.1  109    2-116     3-118 (134)
140 PRK10124 putative UDP-glucose   89.6     1.8 4.6E-05   23.4   9.8   84    2-90    146-235 (464)
141 PRK05562 precorrin-2 dehydroge  89.6     1.3 3.3E-05   24.5   6.0   48    1-65     25-72  (222)
142 TIGR03013 EpsB_2 sugar transfe  89.5     1.8 4.6E-05   23.4   8.1   64    2-69    126-193 (442)
143 PRK02006 murD UDP-N-acetylmura  89.3    0.79   2E-05   26.0   4.8   83    2-92      9-103 (501)
144 pfam01118 Semialdhyde_dh Semia  89.3     1.2   3E-05   24.7   5.6   82    2-91      1-95  (121)
145 PRK08507 prephenate dehydrogen  89.3     1.9 4.8E-05   23.3   7.7   64    1-70      1-66  (275)
146 PRK01710 murD UDP-N-acetylmura  88.8       2 5.1E-05   23.0   8.3   91    2-98     16-113 (458)
147 PRK00025 lpxB lipid-A-disaccha  88.7     2.1 5.2E-05   23.0  13.4  113    1-117     2-158 (382)
148 cd01483 E1_enzyme_family Super  88.6     2.1 5.3E-05   23.0   8.3  113    2-120     1-120 (143)
149 TIGR00417 speE spermidine synt  88.4    0.47 1.2E-05   27.6   3.1   65    2-73     78-165 (284)
150 cd07894 Adenylation_RNA_ligase  88.0    0.29 7.4E-06   29.1   1.8  114   56-171    94-221 (340)
151 PRK10217 dTDP-glucose 4,6-dehy  88.0     2.3 5.7E-05   22.7   7.6   66    1-67      2-79  (355)
152 PRK07417 arogenate dehydrogena  88.0     2.3 5.7E-05   22.7   8.4   62    1-70      2-66  (280)
153 PRK00005 fmt methionyl-tRNA fo  87.7     2.4   6E-05   22.6   6.8   59    1-66      1-60  (309)
154 PRK08340 glucose-1-dehydrogena  87.5     2.4 6.1E-05   22.5   9.0   65    1-67      1-81  (259)
155 pfam05368 NmrA NmrA-like famil  87.4     2.4 6.2E-05   22.5   9.8   86    3-92      1-100 (232)
156 PRK01438 murD UDP-N-acetylmura  87.4     2.4 6.2E-05   22.4   9.4   89    1-96     15-111 (481)
157 PRK05752 uroporphyrinogen-III   87.1     2.5 6.4E-05   22.3   9.4   30    1-32      4-33  (255)
158 pfam02750 Synapsin_C Synapsin,  87.1     1.8 4.6E-05   23.4   5.4  145  112-282    28-177 (203)
159 COG2102 Predicted ATPases of P  87.0     2.6 6.5E-05   22.3  11.6  135    1-145     1-144 (223)
160 TIGR00289 TIGR00289 conserved   86.5     2.2 5.6E-05   22.8   5.6  134    1-145     1-146 (227)
161 pfam00551 Formyl_trans_N Formy  86.4     2.7   7E-05   22.1   9.2   68    1-68      1-85  (181)
162 PRK05693 short chain dehydroge  86.3     2.8 7.1E-05   22.0   9.7   65    1-67      1-77  (274)
163 PRK00994 F420-dependent methyl  86.3     1.7 4.5E-05   23.5   5.0   80   47-154    44-126 (276)
164 TIGR02194 GlrX_NrdH Glutaredox  85.9    0.48 1.2E-05   27.5   1.9   37  105-144    14-55  (72)
165 PRK07502 cyclohexadienyl dehyd  85.8     2.9 7.5E-05   21.9   8.0   66    2-70      8-74  (307)
166 PRK00258 aroE shikimate 5-dehy  85.2     1.8 4.7E-05   23.3   4.7   21   46-66     42-62  (275)
167 PRK00094 gpsA NAD(P)H-dependen  84.9     3.2 8.2E-05   21.6  10.5   31    1-31      2-32  (325)
168 TIGR03215 ac_ald_DH_ac acetald  84.9     3.2 8.2E-05   21.6   9.3   88    1-91      2-93  (285)
169 PRK06732 phosphopantothenate--  84.9       2 5.2E-05   23.0   4.8   73    1-81      1-94  (228)
170 cd01423 MGS_CPS_I_III Methylgl  84.7     1.9 4.9E-05   23.2   4.6   62    2-68      2-77  (116)
171 KOG1209 consensus               84.7     3.3 8.4E-05   21.5   6.7   58    2-61      9-74  (289)
172 TIGR02151 IPP_isom_2 isopenten  84.6     2.3 5.8E-05   22.7   4.9  139   42-207    95-265 (349)
173 PRK00758 GMP synthase subunit   84.2     3.4 8.8E-05   21.4   8.3   71    2-93      1-74  (184)
174 COG0169 AroE Shikimate 5-dehyd  83.9     3.2 8.2E-05   21.6   5.4   13   86-98     62-74  (283)
175 COG2403 Predicted GTPase [Gene  83.8     3.5   9E-05   21.3   7.3   94    1-96      7-121 (449)
176 KOG2158 consensus               83.8       1 2.6E-05   25.1   2.9   53  110-162   199-251 (565)
177 pfam03652 UPF0081 Uncharacteri  83.8     1.6 4.1E-05   23.7   3.9   72   49-137    38-109 (134)
178 PRK05690 molybdopterin biosynt  83.8     3.6 9.1E-05   21.2   7.5   65    2-67     34-104 (245)
179 COG0066 LeuD 3-isopropylmalate  83.7     1.6   4E-05   23.8   3.8   26  120-145    72-97  (191)
180 pfam02593 DUF166 Uncharacteriz  83.3     3.7 9.5E-05   21.1   5.8   35  107-141    93-132 (215)
181 TIGR01087 murD UDP-N-acetylmur  83.2     3.7 9.5E-05   21.1   7.1  119    2-125     1-147 (476)
182 PRK01368 murD UDP-N-acetylmura  83.2     3.8 9.6E-05   21.1   6.8   82    2-93      8-94  (450)
183 TIGR03466 HpnA hopanoid-associ  83.2     3.8 9.6E-05   21.1   7.9   63    1-67      1-69  (328)
184 cd01545 PBP1_SalR Ligand-bindi  83.1     2.5 6.3E-05   22.4   4.6   14   54-67     48-61  (270)
185 pfam01993 MTD methylene-5,6,7,  82.9     3.8 9.7E-05   21.0   5.5   79   49-154    45-126 (276)
186 TIGR02483 PFK_mixed phosphofru  82.8     3.8 9.8E-05   21.0   5.5  127   33-171    75-224 (339)
187 COG1086 Predicted nucleoside-d  82.8     3.9 9.9E-05   21.0  10.4   87    2-90    118-208 (588)
188 pfam01210 NAD_Gly3P_dh_N NAD-d  82.4       4  0.0001   20.9  10.7   30    1-30      1-30  (159)
189 TIGR01092 P5CS delta l-pyrroli  82.3    0.94 2.4E-05   25.4   2.2   11  261-271   636-646 (738)
190 PRK03803 murD UDP-N-acetylmura  82.3     1.8 4.6E-05   23.3   3.7   89    2-96      9-103 (448)
191 pfam03054 tRNA_Me_trans tRNA m  82.2     4.1  0.0001   20.8   7.2  130    1-146     1-142 (354)
192 COG1648 CysG Siroheme synthase  82.1     4.1  0.0001   20.8   6.4   24    1-24     13-36  (210)
193 PRK00109 Holliday junction res  81.9     2.1 5.4E-05   22.9   3.9   71   50-137    42-112 (141)
194 PRK06522 2-dehydropantoate 2-r  81.7     2.9 7.5E-05   21.8   4.5   32    1-33      1-32  (307)
195 PRK08811 uroporphyrinogen-III   81.6     4.3 0.00011   20.7   8.6   93    2-117    18-114 (264)
196 PRK08309 short chain dehydroge  81.5     4.3 0.00011   20.7   8.6   81    1-85      1-101 (182)
197 TIGR00018 panC pantoate--beta-  81.5     3.6 9.2E-05   21.2   4.9  137   15-162    43-210 (310)
198 PRK09275 aspartate aminotransf  81.2     1.9 4.9E-05   23.2   3.4   21  378-398   498-518 (531)
199 COG3494 Uncharacterized protei  81.2     4.4 0.00011   20.6   7.6   63    4-69      9-76  (279)
200 pfam00056 Ldh_1_N lactate/mala  81.0     3.4 8.7E-05   21.4   4.7   35    1-35      1-36  (142)
201 cd00757 ThiF_MoeB_HesA_family   80.9     4.5 0.00012   20.5   8.3   66    1-67     22-93  (228)
202 TIGR01815 TrpE-clade3 anthrani  80.6     1.8 4.5E-05   23.4   3.1   31  300-330   606-636 (726)
203 PRK13303 L-aspartate dehydroge  80.3     4.7 0.00012   20.4  10.2   83    1-90      2-89  (265)
204 PRK03815 murD UDP-N-acetylmura  80.2     3.4 8.7E-05   21.4   4.4   23    1-23      1-23  (401)
205 PRK12550 shikimate 5-dehydroge  79.8     4.8 0.00012   20.3   5.1   20   45-64     42-61  (272)
206 pfam04127 DFP DNA / pantothena  79.6     4.9 0.00012   20.2   5.1   74    2-81      4-97  (197)
207 cd01674 Homoaconitase_Swivel H  79.3     2.7 6.9E-05   22.1   3.7   21  124-144    59-79  (129)
208 pfam04694 Corona_3 Coronavirus  78.7     3.6 9.1E-05   21.2   4.1   28  369-396    31-58  (60)
209 COG2308 Uncharacterized conser  78.6     3.7 9.4E-05   21.1   4.2   14  157-170   178-191 (488)
210 PRK13477 bifunctional pantoate  78.6     5.3 0.00014   20.0   5.7  149   47-203    69-255 (512)
211 TIGR01819 F420_cofD LPPG:Fo 2-  78.5     3.6 9.1E-05   21.2   4.1  240  101-395    81-358 (359)
212 TIGR00232 tktlase_bact transke  78.4     5.4 0.00014   20.0   6.2   23  374-396   560-582 (675)
213 cd01577 IPMI_Swivel Aconatase-  78.3     3.3 8.4E-05   21.5   3.9   28    2-32     19-51  (91)
214 PRK09496 trkA potassium transp  78.3     5.4 0.00014   19.9   7.5   65    1-68      1-71  (455)
215 COG1692 Calcineurin-like phosp  78.1     5.5 0.00014   19.9   5.0   21   52-72     20-40  (266)
216 TIGR03590 PseG pseudaminic aci  78.1     5.5 0.00014   19.9   8.1   68    1-69      1-88  (280)
217 PRK05579 bifunctional phosphop  78.0       5 0.00013   20.2   4.7  169    2-206     6-204 (392)
218 pfam01488 Shikimate_DH Shikima  77.9     5.5 0.00014   19.9   6.3   66    1-69     13-82  (134)
219 PRK08655 prephenate dehydrogen  77.6     5.6 0.00014   19.8   7.2   33    1-35      1-34  (441)
220 COG4569 MhpF Acetaldehyde dehy  77.3     5.7 0.00015   19.8   5.5   90    1-90      5-99  (310)
221 cd00755 YgdL_like Family of ac  77.2     5.8 0.00015   19.7   9.0   66    2-68     13-84  (231)
222 PRK07688 thiamine/molybdopteri  77.1     5.8 0.00015   19.7   9.0   66    1-67     25-98  (339)
223 cd05292 LDH_2 A subgroup of L-  77.1     5.8 0.00015   19.7   5.0   35    1-35      1-35  (308)
224 pfam00208 ELFV_dehydrog Glutam  76.8     5.9 0.00015   19.7   6.5  128    2-156    34-173 (237)
225 PRK05301 pyrroloquinoline quin  76.8     5.9 0.00015   19.7   6.4   91   49-139    78-185 (375)
226 cd00764 Eukaryotic_PFK Phospho  76.7     5.9 0.00015   19.6   8.7   36   56-91     91-148 (762)
227 PRK06476 pyrroline-5-carboxyla  76.2     6.1 0.00016   19.5   6.5   64    1-69      1-68  (255)
228 PRK12921 2-dehydropantoate 2-r  76.0     5.6 0.00014   19.8   4.5   32    1-33      1-32  (306)
229 COG0421 SpeE Spermidine syntha  75.6     6.3 0.00016   19.4   7.3   65    2-69     79-156 (282)
230 TIGR00250 TIGR00250 conserved   75.0     3.3 8.4E-05   21.5   3.1   63   48-127    35-100 (133)
231 COG1810 Uncharacterized protei  74.9     6.6 0.00017   19.3   8.5   15  127-141   124-138 (224)
232 PRK06545 prephenate dehydrogen  74.8     6.6 0.00017   19.3   7.3   65    1-70      1-68  (357)
233 PRK07588 hypothetical protein;  74.7     5.8 0.00015   19.7   4.3   29    1-29      1-29  (391)
234 PRK05599 hypothetical protein;  74.5     6.7 0.00017   19.3   8.6   65    1-68      1-83  (246)
235 PRK12555 chemotaxis-specific m  74.5     6.7 0.00017   19.2  10.8  103    1-146     2-108 (340)
236 cd05565 PTS_IIB_lactose PTS_II  74.2     6.8 0.00017   19.2   7.4   86    1-102     1-89  (99)
237 pfam01820 Dala_Dala_lig_N D-al  74.0       5 0.00013   20.2   3.9   89    1-92      1-110 (110)
238 PRK07680 late competence prote  73.9     6.9 0.00018   19.2   7.2   64    1-69      1-69  (273)
239 COG1088 RfbB dTDP-D-glucose 4,  73.8       7 0.00018   19.1   7.8   66    1-67      1-79  (340)
240 TIGR02049 gshA_ferroox glutama  73.8     1.7 4.3E-05   23.6   1.4  181   74-259   165-400 (436)
241 cd06218 DHOD_e_trans FAD/NAD b  73.7       7 0.00018   19.1  10.0   10  148-157   105-114 (246)
242 cd06325 PBP1_ABC_uncharacteriz  73.5     7.1 0.00018   19.1   5.7   96   62-169    81-181 (281)
243 PRK08229 2-dehydropantoate 2-r  73.1     6.9 0.00018   19.2   4.4   29    1-31      3-31  (341)
244 PRK06223 malate dehydrogenase;  72.7     7.4 0.00019   19.0   5.3  111    1-133     1-127 (312)
245 COG0816 Predicted endonuclease  72.7     6.4 0.00016   19.4   4.2   70   49-135    40-109 (141)
246 COG1168 MalY Bifunctional PLP-  72.6     4.1  0.0001   20.8   3.1  109   51-170    66-188 (388)
247 PRK13978 ribose-5-phosphate is  71.7     6.2 0.00016   19.5   3.9   88   48-144     1-99  (228)
248 PRK08762 molybdopterin biosynt  71.4     7.9  0.0002   18.8   8.9   18  110-127    96-113 (379)
249 PRK12475 thiamine/molybdopteri  71.2     7.9  0.0002   18.7   8.5   30    2-32     26-55  (337)
250 PRK13435 response regulator; P  71.2       8  0.0002   18.7   8.2  114    1-172     2-117 (141)
251 cd01968 Nitrogenase_NifE_I Nit  71.2       8  0.0002   18.7   9.5   92   51-143    75-190 (410)
252 PRK05993 short chain dehydroge  71.1       8  0.0002   18.7   9.3   63    3-67      7-81  (277)
253 PRK00711 D-amino acid dehydrog  71.1     7.7  0.0002   18.8   4.3   30    1-32      1-30  (416)
254 PRK07261 topology modulation p  70.8     4.3 0.00011   20.7   2.9   27    1-27      1-28  (171)
255 TIGR03022 WbaP_sugtrans Undeca  70.8     8.1 0.00021   18.7   8.2   23    2-24    127-149 (456)
256 PRK10329 glutaredoxin-like pro  70.7     7.5 0.00019   18.9   4.2   41  104-145    15-58  (81)
257 PRK10669 putative cation:proto  70.5     8.2 0.00021   18.6   6.2   23  378-401   486-508 (558)
258 PRK09423 gldA glycerol dehydro  70.3     8.3 0.00021   18.6   9.0   42   49-93     71-116 (366)
259 PRK07102 short chain dehydroge  70.1     8.4 0.00021   18.6   8.5   66    1-68      1-82  (243)
260 COG0450 AhpC Peroxiredoxin [Po  69.9     3.8 9.7E-05   21.0   2.5   90   61-157    41-131 (194)
261 TIGR02632 RhaD_aldol-ADH rhamn  69.8     8.5 0.00022   18.5   4.7   23  191-213   261-283 (709)
262 TIGR00507 aroE shikimate 5-deh  69.5     8.6 0.00022   18.5   4.3   18   47-64     38-57  (286)
263 PRK12549 shikimate 5-dehydroge  69.4     8.7 0.00022   18.5   4.7   18   47-64     48-65  (284)
264 COG3967 DltE Short-chain dehyd  68.9     8.9 0.00023   18.4   6.1   61    3-67      8-81  (245)
265 cd01485 E1-1_like Ubiquitin ac  68.8     8.9 0.00023   18.4  10.0  111    2-118    21-142 (198)
266 PRK13606 LPPG:FO 2-phospho-L-l  68.4     9.1 0.00023   18.3   8.1   21    1-21      1-21  (309)
267 KOG0256 consensus               68.2     8.6 0.00022   18.5   4.0   14  383-396   447-460 (471)
268 PRK05884 short chain dehydroge  68.0     9.2 0.00024   18.3   7.8   57    1-59      1-64  (223)
269 PRK02705 murD UDP-N-acetylmura  67.7     9.3 0.00024   18.2   6.5   90    4-97      4-103 (459)
270 PRK00536 speE spermidine synth  67.7     9.4 0.00024   18.2   7.0   30   61-90    138-169 (262)
271 cd01966 Nitrogenase_NifN_1 Nit  67.6     9.4 0.00024   18.2   6.7   96   51-146    70-193 (417)
272 TIGR00137 gid gid protein; Int  67.4     7.5 0.00019   18.9   3.6   27    2-30      2-30  (444)
273 PHA02117 glutathionylspermidin  67.3     4.2 0.00011   20.7   2.3   15  107-121    79-93  (395)
274 cd01421 IMPCH Inosine monophos  67.0     9.6 0.00025   18.1   4.2  113   46-169     5-154 (187)
275 COG2910 Putative NADH-flavin r  66.9     9.7 0.00025   18.1   5.1   63    1-67      1-67  (211)
276 cd01424 MGS_CPS_II Methylglyox  66.9     9.7 0.00025   18.1   6.0   54   15-70     18-75  (110)
277 PRK06182 short chain dehydroge  66.8     9.7 0.00025   18.1   9.9   78    3-97      6-94  (273)
278 TIGR02518 EutH_ACDH acetaldehy  65.7      10 0.00026   18.0   4.2   35   52-86    230-271 (528)
279 TIGR01284 alt_nitrog_alph nitr  65.7     9.8 0.00025   18.1   3.9  125   78-217   228-360 (468)
280 PRK09552 mtnX 2-hydroxy-3-keto  65.4      10 0.00026   17.9   6.5   16  128-143    80-95  (219)
281 cd05297 GH4_alpha_glucosidase_  65.2      10 0.00026   17.9   8.0  137    1-150     1-169 (423)
282 COG1519 KdtA 3-deoxy-D-manno-o  65.2      10 0.00026   17.9  10.4  120   15-140    68-199 (419)
283 COG0289 DapB Dihydrodipicolina  64.8      11 0.00027   17.8   9.7   26    1-26      3-29  (266)
284 PRK09564 coenzyme A disulfide   64.6      11 0.00027   17.8   4.6   30    1-31      1-31  (443)
285 TIGR01469 cobA_cysG_Cterm urop  64.6      11 0.00027   17.8   6.3   42  108-156   100-141 (242)
286 PRK13111 trpA tryptophan synth  64.5      11 0.00027   17.8   4.3   47  102-149   127-175 (256)
287 COG1042 Acyl-CoA synthetase (N  64.5     9.7 0.00025   18.1   3.7   26    3-29     13-42  (598)
288 KOG0243 consensus               64.4      11 0.00027   17.8   4.7   81  135-221    66-162 (1041)
289 cd01076 NAD_bind_1_Glu_DH NAD(  63.6      11 0.00028   17.7   6.6  133    2-156    33-169 (227)
290 cd01337 MDH_glyoxysomal_mitoch  63.3      11 0.00029   17.6   5.1   34    1-34      1-35  (310)
291 cd05294 LDH-like_MDH_nadp A la  63.2      11 0.00029   17.6   5.1  117    1-139     1-138 (309)
292 TIGR00284 TIGR00284 dihydropte  63.1      11 0.00029   17.6   4.3   94    1-99      1-98  (529)
293 PRK06753 hypothetical protein;  62.9      11 0.00029   17.6   4.3   25    1-25      1-25  (373)
294 PRK02842 light-independent pro  62.8     7.1 0.00018   19.1   2.7   81    3-90     40-133 (425)
295 cd03012 TlpA_like_DipZ_like Tl  62.7      12 0.00029   17.6   3.8   73   71-146    41-116 (126)
296 PRK08328 hypothetical protein;  62.6      12 0.00029   17.6   8.0   30    2-32     29-58  (230)
297 cd03823 GT1_ExpE7_like This fa  62.5      12 0.00029   17.6   9.1   89    2-90      1-124 (359)
298 KOG3198 consensus               62.5       3 7.7E-05   21.8   0.8   33   71-111    42-74  (152)
299 TIGR01179 galE UDP-glucose 4-e  62.3      12  0.0003   17.5   5.5   63    2-67      1-81  (341)
300 PRK06217 hypothetical protein;  62.2      12  0.0003   17.5   7.3   37    1-37      2-44  (185)
301 PRK13123 consensus              62.2      12  0.0003   17.5   3.9   15  107-121   135-149 (256)
302 PTZ00287 6-phosphofructokinase  62.1      12  0.0003   17.5   7.4   93    1-93    180-309 (1439)
303 PRK13609 diacylglycerol glucos  62.0      12  0.0003   17.5   8.8   35   52-90     94-131 (388)
304 PRK05849 hypothetical protein;  61.7      12  0.0003   17.5   5.9  167  107-281    19-215 (782)
305 cd01489 Uba2_SUMO Ubiquitin ac  61.4      12 0.00031   17.4   8.0  112    2-119     1-120 (312)
306 pfam04174 DUF407 Domain of unk  61.3       7 0.00018   19.1   2.5   62  107-169     3-67  (145)
307 COG2894 MinD Septum formation   61.2      12 0.00031   17.4   5.3   28    2-31      3-37  (272)
308 cd05213 NAD_bind_Glutamyl_tRNA  60.7      12 0.00032   17.3   7.4   12   17-28     31-42  (311)
309 KOG2741 consensus               60.6      12 0.00032   17.3   7.1   88    2-91      8-101 (351)
310 cd03466 Nitrogenase_NifN_2 Nit  60.4      13 0.00032   17.3   9.6   96   51-146    73-190 (429)
311 TIGR01968 minD_bact septum sit  60.3     8.1 0.00021   18.7   2.7   30  256-285   203-237 (272)
312 PRK06101 short chain dehydroge  60.2      13 0.00032   17.3   8.4   65    1-67      1-76  (241)
313 PRK05708 2-dehydropantoate 2-r  59.7      13 0.00033   17.2   4.6   24    1-24      3-26  (305)
314 PRK13190 putative peroxiredoxi  59.6     9.1 0.00023   18.3   2.8   61   64-127    38-99  (202)
315 PRK13131 consensus              59.6      12 0.00031   17.4   3.5   13  108-120   134-146 (257)
316 cd02969 PRX_like1 Peroxiredoxi  59.3      13 0.00032   17.3   3.5   78   73-152    45-126 (171)
317 PRK10116 universal stress prot  58.9     9.4 0.00024   18.2   2.8   85   52-144    21-109 (142)
318 PRK07878 molybdopterin biosynt  58.7      13 0.00034   17.1   8.6  112    2-119    44-162 (392)
319 COG0420 SbcD DNA repair exonuc  58.6      13 0.00034   17.1   4.8   43   49-91     27-80  (390)
320 PRK10816 DNA-binding transcrip  58.6      13 0.00034   17.1  10.3  116    1-172     1-118 (223)
321 PRK06988 putative formyltransf  58.5      13 0.00034   17.1   5.6   35    2-36      4-39  (313)
322 PRK10717 cysteine synthase A;   58.1      14 0.00035   17.0   7.3   18  320-339   296-313 (334)
323 PRK07832 short chain dehydroge  58.0      14 0.00035   17.0   9.0   78    2-96      2-97  (272)
324 PRK05600 thiamine biosynthesis  57.6      14 0.00035   17.0   8.5   22    2-23     43-64  (370)
325 COG0205 PfkA 6-phosphofructoki  57.3      14 0.00036   16.9   9.0   90    1-94      3-126 (347)
326 cd06289 PBP1_MalI_like Ligand-  57.3      14 0.00036   16.9   4.7   39   52-90     45-83  (268)
327 TIGR02311 HpaI 2,4-dihydroxyhe  57.2     6.1 0.00016   19.6   1.6  147   55-227    26-182 (249)
328 PRK07411 hypothetical protein;  56.5      14 0.00037   16.8   8.7   66    2-68     40-111 (390)
329 TIGR00504 pyro_pdase pyrrolido  56.5      14 0.00036   17.0   3.3   88   49-140    47-163 (220)
330 cd06277 PBP1_LacI_like_1 Ligan  56.1      15 0.00037   16.8   3.8   15   54-68     50-64  (268)
331 PRK09982 universal stress prot  56.0      11 0.00029   17.6   2.8   44  100-143    64-109 (142)
332 PRK06953 short chain dehydroge  55.9      15 0.00038   16.8   8.6   65    1-67      1-75  (222)
333 COG2740 Predicted nucleic-acid  55.5      12 0.00031   17.4   2.9   44  123-166    17-60  (95)
334 pfam01113 DapB_N Dihydrodipico  55.1      15 0.00039   16.7   9.1   28    1-28      1-29  (122)
335 TIGR01809 Shik-DH-AROM shikima  55.0      15 0.00039   16.7   3.9   41   34-74     25-68  (291)
336 PRK12749 quinate/shikimate deh  54.8      15 0.00039   16.7   4.7   15   50-64     48-62  (288)
337 PTZ00137 2-Cys peroxiredoxin;   54.8      10 0.00027   17.9   2.5   61   64-126    44-105 (194)
338 PRK10643 DNA-binding transcrip  54.7      15 0.00039   16.6   8.7   51    1-70      1-52  (222)
339 TIGR03333 salvage_mtnX 2-hydro  54.5      13 0.00034   17.1   3.0   17   51-67     75-91  (214)
340 COG0240 GpsA Glycerol-3-phosph  54.3      16  0.0004   16.6  10.0   31    1-31      2-32  (329)
341 PRK05805 phosphate butyryltran  54.2      16  0.0004   16.6   6.0   74   48-128     2-76  (301)
342 pfam00148 Oxidored_nitro Nitro  54.2      16  0.0004   16.6   8.6   91   52-142    64-177 (398)
343 PRK07085 diphosphate--fructose  54.0      16  0.0004   16.6   8.2   94    1-94     73-203 (557)
344 COG0287 TyrA Prephenate dehydr  54.0      16  0.0004   16.6   7.0   80    1-83      4-85  (279)
345 cd00763 Bacterial_PFK Phosphof  53.7      16 0.00041   16.5   4.9   37   53-91     83-120 (317)
346 cd01980 Chlide_reductase_Y Chl  53.5      16 0.00041   16.5   5.7   39   52-90     81-123 (416)
347 PRK07577 short chain dehydroge  53.5      16 0.00041   16.5   9.4   64    2-67      5-73  (234)
348 KOG0822 consensus               53.5      14 0.00035   17.0   2.9   10   60-69    259-268 (649)
349 TIGR00853 pts-lac PTS system,   53.5      16 0.00041   16.5   4.3   56   52-116    64-120 (142)
350 pfam06973 DUF1297 Domain of un  53.4      16 0.00041   16.5   3.3  106  175-286    21-146 (188)
351 PRK07649 para-aminobenzoate/an  53.4      16 0.00041   16.5   6.5   71    3-93      2-79  (195)
352 PRK10586 hypothetical protein;  53.4      16 0.00041   16.5   3.9   39   51-93     76-118 (362)
353 PRK06398 aldose dehydrogenase;  53.3      16 0.00041   16.5   9.0   63    3-67      9-78  (256)
354 PRK00048 dihydrodipicolinate r  53.2      16 0.00041   16.5   8.8   29    1-29      3-32  (265)
355 TIGR02622 CDP_4_6_dhtase CDP-g  53.0     7.7  0.0002   18.8   1.5   32   44-75     63-94  (361)
356 PRK05637 anthranilate synthase  52.8      17 0.00042   16.4   7.1   72    1-92      2-79  (208)
357 TIGR02717 AcCoA-syn-alpha acet  52.5      17 0.00043   16.4   5.0  104    2-116     9-126 (457)
358 TIGR02539 SepCysS Sep-tRNA:Cys  52.4      17 0.00043   16.4   4.5   82    6-94     72-186 (381)
359 cd03110 Fer4_NifH_child This p  52.3      17 0.00043   16.4   5.6   18    2-19      1-24  (179)
360 cd01979 Pchlide_reductase_N Pc  51.8      17 0.00043   16.3   4.7  105    3-116    29-146 (396)
361 TIGR03239 GarL 2-dehydro-3-deo  51.8      17 0.00044   16.3   5.3   87   52-154    23-117 (249)
362 TIGR00097 HMP-P_kinase phospho  51.6     8.2 0.00021   18.6   1.5  145   52-225    57-214 (264)
363 COG1378 Predicted transcriptio  51.6      13 0.00034   17.1   2.6   70   77-147     4-75  (247)
364 PRK10507 bifunctional glutathi  51.5      11 0.00028   17.7   2.2   25  286-310   482-511 (619)
365 PRK08099 nicotinamide-nucleoti  51.5      12  0.0003   17.5   2.3   10  107-116   162-171 (411)
366 PRK11517 transcriptional regul  51.4      17 0.00044   16.3  10.9   50    1-69      1-51  (223)
367 pfam06134 RhaA L-rhamnose isom  51.3      17 0.00044   16.3   3.2   88  102-203   149-245 (416)
368 PRK00436 argC N-acetyl-gamma-g  51.1      17 0.00045   16.3   8.8   85    1-92      2-98  (345)
369 pfam01370 Epimerase NAD depend  51.0      18 0.00045   16.2   7.9   63    3-67      1-70  (235)
370 cd00765 Pyrophosphate_PFK Phos  50.8      18 0.00045   16.2   7.7   94    1-94     73-203 (550)
371 TIGR02352 thiamin_ThiO glycine  50.8      17 0.00043   16.3   3.0   52    3-60      1-64  (357)
372 PRK08267 short chain dehydroge  50.7      18 0.00045   16.2   9.0   65    1-67      1-82  (258)
373 KOG3851 consensus               50.6      18 0.00045   16.2   4.7   63    2-64     41-120 (446)
374 PRK08857 para-aminobenzoate sy  50.6      18 0.00045   16.2   7.1   71    3-93      2-79  (192)
375 PRK07310 consensus              50.5      13 0.00033   17.2   2.4   24  375-398   370-393 (395)
376 PRK01322 6-carboxyhexanoate--C  50.4      18 0.00046   16.2   3.2   62  314-400   176-240 (243)
377 PRK11880 pyrroline-5-carboxyla  50.2      18 0.00046   16.2   6.8   64    1-69      3-69  (267)
378 KOG1201 consensus               50.2      18 0.00046   16.2   6.2   59    2-62     40-109 (300)
379 pfam04321 RmlD_sub_bind RmlD s  50.1      18 0.00046   16.1   7.3   54    3-68      1-55  (284)
380 PRK10786 ribD bifunctional dia  50.1      18 0.00046   16.1   6.5   76    5-90     37-123 (367)
381 cd01487 E1_ThiF_like E1_ThiF_l  49.9      18 0.00046   16.1   8.2   30    2-32      1-30  (174)
382 PRK12428 3-alpha-hydroxysteroi  49.8      18 0.00047   16.1   8.4   64    2-67      7-73  (261)
383 PRK08644 thiamine biosynthesis  49.8      18 0.00047   16.1   8.6   30    2-32     29-58  (209)
384 pfam04392 ABC_sub_bind ABC tra  49.8      18 0.00047   16.1   5.5   96   63-170    81-181 (292)
385 PRK10610 chemotaxis regulatory  49.6      18 0.00047   16.1  10.7   88   47-172    35-126 (129)
386 PRK03147 thiol-disulfide oxido  49.6      18 0.00047   16.1   5.6   93   71-171    80-174 (176)
387 KOG3974 consensus               49.5      18 0.00047   16.1   7.5   71   55-147    70-142 (306)
388 cd01484 E1-2_like Ubiquitin ac  49.4      19 0.00047   16.1   6.4   30    2-32      1-30  (234)
389 PRK09444 pntB pyridine nucleot  49.3     6.9 0.00017   19.2   0.8   14  245-258   323-336 (459)
390 pfam07991 IlvN Acetohydroxy ac  49.1      19 0.00048   16.0   4.3   60    2-68      6-66  (165)
391 TIGR01127 ilvA_1Cterm threonin  49.0      19 0.00048   16.0   7.4  155   13-184    59-271 (381)
392 PRK13289 nitric oxide dioxygen  49.0      19 0.00048   16.0   3.2   14   47-60     67-80  (399)
393 PRK05670 anthranilate synthase  48.9      19 0.00048   16.0   7.6   72    2-93      1-79  (192)
394 PRK05597 molybdopterin biosynt  48.8      19 0.00048   16.0   8.7   66    2-68     30-101 (355)
395 COG0796 MurI Glutamate racemas  48.8      19 0.00048   16.0   9.3  124    1-145     6-143 (269)
396 COG0075 Serine-pyruvate aminot  48.7      19 0.00048   16.0   6.1   30  107-136    96-129 (383)
397 cd03802 GT1_AviGT4_like This f  48.6      19 0.00048   16.0   8.9   85    1-90      1-111 (335)
398 CHL00073 chlN photochlorophyll  48.6      15 0.00039   16.7   2.5   90    3-101    40-142 (457)
399 PRK10046 dpiA two-component re  48.6      19 0.00049   16.0  10.5  114    1-169     5-121 (225)
400 KOG2156 consensus               48.5      18 0.00045   16.2   2.8   59  119-186   286-345 (662)
401 PTZ00253 tryparedoxin peroxida  48.3      15 0.00037   16.8   2.4   16  266-281   130-146 (199)
402 TIGR01828 pyru_phos_dikin pyru  48.2       9 0.00023   18.3   1.3  170  152-336   199-422 (920)
403 PRK00973 glucose-6-phosphate i  48.1      19 0.00049   15.9   7.0   46  105-151   155-203 (454)
404 pfam01135 PCMT Protein-L-isoas  47.9      19  0.0005   15.9   3.3   14  272-285    73-86  (205)
405 TIGR00065 ftsZ cell division p  47.8      20  0.0005   15.9   4.9   96    2-107    19-157 (365)
406 TIGR03219 salicylate_mono sali  47.7      20  0.0005   15.9   4.8   25    1-25      1-25  (414)
407 cd06281 PBP1_LacI_like_5 Ligan  47.6      20  0.0005   15.9   3.0   39   52-90     45-83  (269)
408 COG0774 LpxC UDP-3-O-acyl-N-ac  47.6      12  0.0003   17.5   1.8   42   48-89     74-122 (300)
409 PRK00881 purH bifunctional pho  47.5      20  0.0005   15.9   4.3   33  364-396   415-447 (514)
410 cd05293 LDH_1 A subgroup of L-  47.5      20  0.0005   15.9   5.0  117    1-139     4-137 (312)
411 COG0345 ProC Pyrroline-5-carbo  47.5      20  0.0005   15.9   5.7   64    1-69      2-69  (266)
412 TIGR02782 TrbB_P P-type conjug  47.5      20  0.0005   15.9   7.1  157   13-190     8-184 (315)
413 TIGR01055 parE_Gneg DNA topois  47.4      20  0.0005   15.9   3.5   51   75-125   225-292 (647)
414 cd04950 GT1_like_1 Glycosyltra  47.4      20 0.00051   15.9   6.5   97  129-228   113-216 (373)
415 PRK10637 cysG siroheme synthas  47.0      20 0.00051   15.8   5.7   23    2-24     14-36  (457)
416 cd00279 YlxR Ylxr homologs; gr  47.0      20 0.00051   15.8   3.8   49  124-172    12-65  (79)
417 PRK03317 histidinol-phosphate   47.0      20 0.00051   15.8   5.7   19   50-68    148-166 (369)
418 COG1893 ApbA Ketopantoate redu  46.9      20 0.00051   15.8   4.7   23    1-23      1-23  (307)
419 PRK06179 short chain dehydroge  46.8      20 0.00052   15.8   9.3   63    3-67      7-78  (270)
420 PRK13982 bifunctional SbtC-lik  46.7      20 0.00052   15.8   4.7  170    2-206    73-275 (476)
421 cd06533 Glyco_transf_WecG_TagA  46.7      20 0.00052   15.8   9.9   26   49-74     86-111 (171)
422 PRK10538 3-hydroxy acid dehydr  46.6      20 0.00052   15.8   8.4   65    1-67      1-79  (248)
423 PRK07454 short chain dehydroge  46.4      20 0.00052   15.8   9.4   65    1-67      6-88  (241)
424 COG1819 Glycosyl transferases,  46.4      20 0.00051   15.8   2.8   31    1-32      2-37  (406)
425 TIGR01069 mutS2 MutS2 family p  46.3     6.5 0.00017   19.4   0.3   21  378-398   760-780 (834)
426 PRK13139 consensus              46.3      21 0.00052   15.7   3.6   17   53-69     34-50  (254)
427 cd06220 DHOD_e_trans_like2 FAD  46.2      21 0.00053   15.7   9.2   11  148-158    95-105 (233)
428 pfam00390 malic Malic enzyme,   46.2      18 0.00046   16.1   2.6   26  186-224    65-90  (182)
429 PRK13124 consensus              46.2      21 0.00053   15.7   4.7   99   48-150    67-175 (257)
430 PRK05437 isopentenyl pyrophosp  45.9      21 0.00053   15.7   4.4   21  126-146   175-195 (351)
431 COG2201 CheB Chemotaxis respon  45.9      21 0.00053   15.7   8.3   77    1-94      2-82  (350)
432 pfam03807 F420_oxidored NADP o  45.9      21 0.00053   15.7   7.5   62    2-69      1-65  (93)
433 pfam03808 Glyco_tran_WecB Glyc  45.9      21 0.00053   15.7  10.2   18   52-69     91-108 (172)
434 PRK13129 consensus              45.6      21 0.00054   15.7   3.6   19  107-125   141-159 (267)
435 COG1712 Predicted dinucleotide  45.5      21 0.00054   15.7   8.5   86    1-93      1-91  (255)
436 PRK13114 consensus              45.5      21 0.00054   15.7   4.2   98   50-151    73-182 (266)
437 PRK07024 short chain dehydroge  45.5      21 0.00054   15.7   8.3   64    2-67      4-82  (256)
438 TIGR02030 BchI-ChlI magnesium   45.4     9.8 0.00025   18.1   1.1   50  260-336   135-188 (340)
439 PRK06500 short chain dehydroge  45.3      21 0.00054   15.6   9.4   64    2-67      8-85  (249)
440 PRK00439 leuD 3-isopropylmalat  45.3      21 0.00054   15.6   3.6   32   28-59      4-35  (163)
441 PRK06718 precorrin-2 dehydroge  45.3      21 0.00054   15.6   6.1   24    1-24     11-34  (202)
442 cd01976 Nitrogenase_MoFe_alpha  45.2      21 0.00054   15.6   8.0   95   52-146    88-207 (421)
443 KOG2157 consensus               45.1      13 0.00034   17.1   1.8   32  136-167   198-229 (497)
444 PRK13355 bifunctional HTH-doma  45.0      19 0.00048   16.0   2.5   21  377-397   494-514 (518)
445 PRK08017 short chain dehydroge  45.0      21 0.00055   15.6   8.7   56    3-60      5-66  (256)
446 PRK05650 short chain dehydroge  44.9      22 0.00055   15.6   9.4   64    2-67      2-82  (270)
447 COG0702 Predicted nucleoside-d  44.9      22 0.00055   15.6   9.7  142    1-146     1-169 (275)
448 PRK07538 hypothetical protein;  44.8      22 0.00055   15.6   4.3   29    1-29      1-29  (413)
449 PRK11559 garR tartronate semia  44.8      22 0.00055   15.6   8.6   34    1-36      2-35  (295)
450 COG1393 ArsC Arsenate reductas  44.8      22 0.00055   15.6   5.4  101   47-166    10-115 (117)
451 PRK13302 putative L-aspartate   44.7      22 0.00055   15.6  10.4   83    1-90      7-95  (271)
452 PRK13113 consensus              44.3      22 0.00056   15.5   4.1   99   49-151    76-186 (263)
453 PRK08007 para-aminobenzoate sy  44.1      22 0.00056   15.5   6.8   72    3-93      2-79  (187)
454 PRK13187 UDP-3-O-[3-hydroxymyr  44.0      22 0.00057   15.5   3.2   42   48-89     85-133 (305)
455 TIGR00619 sbcd nuclease SbcCD,  43.9      22 0.00057   15.5   5.6   66   51-120    37-118 (275)
456 PRK01581 speE spermidine synth  43.7      22 0.00057   15.5   3.4   22  283-304   223-244 (363)
457 cd01144 BtuF Cobalamin binding  43.7      22 0.00057   15.5   6.3   81    1-91      1-85  (245)
458 TIGR03190 benz_CoA_bzdN benzoy  43.5      23 0.00057   15.5   4.7   20   11-30     15-34  (377)
459 PRK06249 2-dehydropantoate 2-r  43.3      23 0.00058   15.4   4.6   32    1-34      6-38  (313)
460 COG0059 IlvC Ketol-acid reduct  43.2      23 0.00058   15.4   4.8   65    2-72     20-85  (338)
461 COG2145 ThiM Hydroxyethylthiaz  43.2      22 0.00056   15.6   2.6  135   44-202    39-179 (265)
462 PRK12439 NAD(P)H-dependent gly  42.9      23 0.00059   15.4   8.7   23    2-24      8-30  (340)
463 cd00363 PFK Phosphofructokinas  42.9      23 0.00059   15.4   5.3   90    2-93      2-128 (338)
464 PRK13403 ketol-acid reductoiso  42.7      23 0.00059   15.4   3.6   58    2-68     18-77  (335)
465 cd01985 ETF The electron trans  42.6      23 0.00059   15.4   5.7   20   52-71     81-100 (181)
466 pfam01177 Asp_Glu_race Asp/Glu  42.6      23 0.00059   15.4   7.7   80   52-142    54-136 (212)
467 pfam04007 DUF354 Protein of un  42.5      23  0.0006   15.3   5.0   20   50-69     36-55  (335)
468 COG1598 Predicted nuclease of   42.4      16 0.00041   16.5   1.8   21  376-396    25-45  (73)
469 cd06333 PBP1_ABC-type_HAAT_lik  42.3      24  0.0006   15.3   5.0   45   52-97     56-101 (312)
470 TIGR03569 NeuB_NnaB N-acetylne  42.2      24  0.0006   15.3   3.6   22   46-67     73-94  (329)
471 pfam00465 Fe-ADH Iron-containi  42.1      24  0.0006   15.3   8.2   26   49-74     66-92  (312)
472 PRK08219 short chain dehydroge  42.0      24 0.00061   15.3   9.0   64    1-67      3-75  (226)
473 PRK05086 malate dehydrogenase;  41.9      24 0.00061   15.3   4.8   32    1-32      1-34  (312)
474 pfam07355 GRDB Glycine/sarcosi  41.9      24 0.00061   15.3   5.5   75   50-149    68-142 (349)
475 COG4091 Predicted homoserine d  41.8      24 0.00061   15.3   8.0  174    2-185    19-220 (438)
476 PRK08255 salicylyl-CoA 5-hydro  41.7      24 0.00061   15.3   4.2   29    1-29      1-31  (770)
477 PRK13112 consensus              41.7      24 0.00061   15.3   4.0   91   51-142   112-211 (279)
478 pfam03681 UPF0150 Uncharacteri  41.7      15 0.00037   16.8   1.5   21  376-396    23-43  (48)
479 PRK10444 UMP phosphatase; Prov  41.6      24 0.00061   15.3   3.0   72   63-137     8-81  (248)
480 PTZ00286 6-phospho-1-fructokin  41.5      24 0.00062   15.2   5.6   47   48-94    173-224 (486)
481 PRK13189 peroxiredoxin; Provis  41.4      19 0.00049   15.9   2.1   87   64-157    39-126 (215)
482 PRK10558 alpha-dehydro-beta-de  41.1      24 0.00062   15.2   5.3   78   51-142   158-235 (256)
483 cd06343 PBP1_ABC_ligand_bindin  40.8      25 0.00063   15.2   3.7   55   51-105    63-117 (362)
484 PRK13599 putative peroxiredoxi  40.8      20 0.00051   15.8   2.1   87   64-157    39-126 (215)
485 cd06270 PBP1_GalS_like Ligand   40.7      25 0.00063   15.2   3.8   99   36-136    29-171 (268)
486 PRK00742 chemotaxis-specific m  40.6      25 0.00063   15.1  11.1  123    1-169     3-129 (345)
487 PRK08329 threonine synthase; V  40.4      25 0.00064   15.1  10.7  106   11-116    90-205 (348)
488 TIGR02442 Cob-chelat-sub cobal  40.4      18 0.00047   16.1   1.9   32  260-315   132-163 (688)
489 TIGR02661 MauD methylamine deh  40.2      25 0.00064   15.1   3.5  102   65-183    79-189 (189)
490 PRK06895 para-aminobenzoate sy  40.0      25 0.00065   15.1   6.6   70    1-91      3-78  (191)
491 PRK01076 L-rhamnose isomerase;  39.9      26 0.00065   15.1   3.3  159   46-236   110-273 (419)
492 CHL00101 trpG anthranilate syn  39.8      26 0.00065   15.1   6.8   70    3-91      2-77  (190)
493 pfam03352 Adenine_glyco Methyl  39.8      26 0.00065   15.1   3.4   35   70-115   132-166 (179)
494 cd01171 YXKO-related B.subtili  39.8      26 0.00065   15.1   9.4  140    2-143    10-172 (254)
495 PRK11908 NAD-dependent epimera  39.7      26 0.00065   15.1   7.4   66    1-67      1-73  (347)
496 PRK06180 short chain dehydroge  39.6      26 0.00066   15.0   9.1   93    1-110     4-111 (277)
497 KOG1430 consensus               39.6      26 0.00066   15.0   8.4  141    2-169     6-167 (361)
498 PRK05647 purN phosphoribosylgl  39.6      26 0.00066   15.0   7.4   67    1-67      1-85  (200)
499 PTZ00317 malic enzyme; Provisi  39.5      26 0.00066   15.0   2.5   33  179-224   134-169 (570)
500 smart00732 YqgFc Likely ribonu  39.4      26 0.00066   15.0   5.1   41   50-90     39-88  (99)

No 1  
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115   Phosphoribosylglycinamide synthetase (6.3.4.13 from EC) (GARS) (phosphoribosylamine glycine ligase)  catalyzes the second step in the de novo biosynthesis of purine:  ATP + 5-phosphoribosylamine + glycine = ADP + P_i + 5'-phosphoribosylglycinamide  In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5/7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) (IPR000728 from INTERPRO). In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS (IPR000728 from INTERPRO) and with phosphoribosylglycinamide formyltransferase (GART) (), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process.
Probab=100.00  E-value=0  Score=1120.74  Aligned_cols=415  Identities=51%  Similarity=0.875  Sum_probs=400.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEE--EECCCC----CHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             9589988658899999999858996789995498357511705--512878----9899999998718979999795578
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQ----NHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~--~~i~~~----d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      |||||||+|||||||||||+||+.+.++|++||||||+.+.++  +.++.+    |+++|++||++++|||+|||||+||
T Consensus         1 MkVLviG~GGREHAla~~l~qs~~v~~~~~apGN~Gta~~~~~~~~~~~~~~~~~d~~~~~~FA~~~~idL~~iGPE~PL   80 (459)
T TIGR00877         1 MKVLVIGNGGREHALAWKLAQSPLVKYVYVAPGNAGTARLAKNKNVAIEITKDVRDIEALVEFAKKKKIDLAVIGPEAPL   80 (459)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCH
T ss_conf             95899748705899999873271133667826898622012544411457866300899999998469754880874101


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHCCCCE--EEEEECCCCCCC
Q ss_conf             748998986058806701066655520102357888765310-11112234401111121012420--256304653430
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP-TATYQHFSDPMKAKQYVQNKSMP--IVVKADGLCAGK  151 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP-t~~~~~~~~~~ea~~~~~~~g~P--vVVKp~~~agGk  151 (424)
                      ++||+|.|+++||+||||+++|||||+||.|||+||++|||| |+.|+.|++.++|++|+++.+.|  +||||||||+||
T Consensus        81 ~~G~vd~le~~Gi~~FGP~k~AA~LE~SK~FaK~fm~~~gIPGta~Y~~Ft~~eea~~y~~~~g~PA~~VVKadGLAAGK  160 (459)
T TIGR00877        81 VLGLVDALEEAGIPVFGPTKEAAQLEASKAFAKDFMKRYGIPGTAEYEVFTDPEEAKSYIQEKGAPAEIVVKADGLAAGK  160 (459)
T ss_pred             HHHHHHHHHHCCCCEECCCHHHHHHHCCHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHCCCCCCEEEECCCCCCCC
T ss_conf             20147789867951456887886433287899999996489832221000898999999984188974898056665798


Q ss_pred             CCCCH----HHHHHHHHHHHHHH-----CCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCC-CCCCC
Q ss_conf             00232----35677888788751-----4453177788775205752344215776310352000111356654-44443
Q gi|254780206|r  152 GVVVA----ATVDEATSAIDRCF-----QQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDI-GPNTG  221 (424)
Q Consensus       152 GV~i~----~~~~e~~~~~~~~~-----~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~-GpnTG  221 (424)
                      ||.||    .|.+||.++++++|     ++++++|||||||+|+|+|++||+||++++|||++|||||+||+|+ |||||
T Consensus       161 GV~V~Ge~L~~~eEA~~~~~~~~~~~~FG~a~~~VVIEEfL~G~E~S~~~~~DG~~v~Plp~aQDhKR~~egD~~GpNTG  240 (459)
T TIGR00877       161 GVIVAGEQLKTNEEAIKAVEEILEQKAFGEAGERVVIEEFLEGEEVSLLAFVDGKTVIPLPPAQDHKRALEGDKKGPNTG  240 (459)
T ss_pred             CCEEECCCCCCHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCEEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             62684760274789999999998547656668825896424880089999974866770542157650466888788557


Q ss_pred             CCCEEECCC---CCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE----EEEEEEEEEECCCCCEEEEEC
Q ss_conf             443000012---3443222010000089999986204623566445448985570----489998865147751044332
Q gi|254780206|r  222 GMGACSPAL---GMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG----PYLIEYNVRFGDPECQAMMMR  294 (424)
Q Consensus       222 GMGa~~p~~---~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g----p~viE~N~R~GDPE~q~ilp~  294 (424)
                      |||||||+|   +++++..+++.++|++||+++|++||.+|+||||+|||||++|    |+||||||||||||||+||||
T Consensus       241 GMGAYsP~phlL~~~~e~~~~~~~~I~~pt~~~l~~eG~~y~GvLYaglMl~~~G~~L~PkVlEfN~RFGDPEtq~vL~l  320 (459)
T TIGR00877       241 GMGAYSPAPHLLVFTEEVEKRIAEEIVEPTVKALRKEGTPYKGVLYAGLMLTKEGGVLVPKVLEFNVRFGDPETQAVLPL  320 (459)
T ss_pred             CCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCEEEEEEEEECCCCCCHHHHHHHHH
T ss_conf             86330278784423717899998777899999998528972478741389976898864478897052788534446454


Q ss_pred             CC--CCCHHHHHHHHHCCCC--CCCCCCCCCCEEEEEECC----------CCCCCCCCCCCCCCCCCC--CCCCCEEEEE
Q ss_conf             65--4411566654201333--321234444206754225----------446687757976248766--6898689983
Q gi|254780206|r  295 LE--SDILEILNSCVHGNLH--NTHINWKAEYALTVVVAT----------KGYPEEYPHGTIISKIPQ--NTGTTQLFHA  358 (424)
Q Consensus       295 L~--~dl~~il~~~~~g~L~--~~~~~~~~~~~v~Vvlas----------~GYP~~~~kg~~I~~l~~--~~~~~~ifha  358 (424)
                      |+  |||+++|+++++|+|+  ..+++|++.+||||||||          +|||.+|.+|++|+++..  ...+..||||
T Consensus       321 L~dqsdL~e~~~a~~eg~L~d~~~~~~~~~~~av~VvlA~GalkGR~~~~~GYP~~~~~G~~I~Gd~~~~~~~~~~vf~A  400 (459)
T TIGR00877       321 LKDQSDLLEVCLAAVEGKLDDSEVELRFDNRAAVTVVLASGALKGREYLKEGYPEDYRKGDPITGDEEEAEAEGVKVFHA  400 (459)
T ss_pred             HCCCCCHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHCCCCEEEEC
T ss_conf             23888889999998456665641124881783599998047532567788877888601226526718975269789973


Q ss_pred             E--EEEECCEEEECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHHHHHH
Q ss_conf             3--58778879981880799999628989999999999852589995753517898875
Q gi|254780206|r  359 G--TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE  415 (424)
Q Consensus       359 g--t~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~~~~~  415 (424)
                      |  |..+||.++|||||||+||+.|+||++|+++||+.+++|+|+|+|||+|||+|++.
T Consensus       401 g~~~~~~~g~~vt~GGRVL~V~a~g~~l~eA~~~Ay~a~~~i~f~G~~yRkDIG~ra~~  459 (459)
T TIGR00877       401 GTKTEQDNGKLVTNGGRVLAVVALGKDLEEARERAYEAVEKIKFEGMFYRKDIGLRALE  459 (459)
T ss_pred             CEEEEECCCEEEECCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEECCCCCCCCCC
T ss_conf             32576208737971873999983262578999999998875137987761232432469


No 2  
>PRK00885 phosphoribosylamine--glycine ligase; Provisional
Probab=100.00  E-value=0  Score=1070.79  Aligned_cols=417  Identities=52%  Similarity=0.903  Sum_probs=408.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHH
Q ss_conf             95899886588999999998589967899954983575117055128789899999998718979999795578748998
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISD   80 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d   80 (424)
                      |||||||||||||||+|||++|+++.++||+||||||+.+++|++++.+|++++++||++++|||||||||+||++|++|
T Consensus         1 MkVLviGsGgREHAia~kl~~s~~v~~v~~~PGN~G~~~~~~~~~i~~~d~~~l~~~a~~~~idlviiGPE~pL~~Gi~D   80 (424)
T PRK00885          1 MKVLVIGSGGREHALAWKLAQSPLVEKVYVAPGNAGTALEAENVAIDVTDIEALVAFAKEEGIDLTVVGPEAPLVAGIVD   80 (424)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEECCCCCCHHHHHHHHHHCCCCEEEECCCHHHHHHHHH
T ss_conf             97999888889999999997397989899928975887417365128579999999999849999998966788735799


Q ss_pred             HHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             98605880670106665552010235788876531011112234401111121012420256304653430002323567
Q gi|254780206|r   81 ALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVD  160 (424)
Q Consensus        81 ~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~  160 (424)
                      .|++.||+||||++.+||||+||.|+|+||++|+||||+|+.|+|.++|++|++++++|+|||+||||+||||.||.+.+
T Consensus        81 ~l~~~gi~vfGP~k~aA~lE~SK~faK~~m~~~~IPTa~~~~f~~~~~A~~~l~~~~~p~VIKaDGLAaGKGV~V~~~~~  160 (424)
T PRK00885         81 AFRAAGLKIFGPTKAAAQLEGSKAFAKDFMARYGIPTAAYEVFTDAEEAKAYLDEQGAPIVVKADGLAAGKGVVVAMTLE  160 (424)
T ss_pred             HHHHCCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEECCHH
T ss_conf             99506994689497898876637999999998298987548868999999999857998899617656777517637899


Q ss_pred             HHHHHHHHHHC-----CCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCC
Q ss_conf             78887887514-----4531777887752057523442157763103520001113566544444344300001234432
Q gi|254780206|r  161 EATSAIDRCFQ-----QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE  235 (424)
Q Consensus       161 e~~~~~~~~~~-----~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~  235 (424)
                      |+.++++++|.     +++++|||||||+|+|+|+++||||+++++||++|||||+||+|+||||||||||||+|+++++
T Consensus       161 ea~~al~~i~~~~~fg~ag~~VvIEE~L~G~E~S~~a~~DG~~~~~lp~aqDhKR~~dgD~GPNTGGMGa~sP~p~~~~~  240 (424)
T PRK00885        161 EAEAAVDDMLAGNKFGDAGARVVIEEFLDGEEASFFALVDGENVLPLPTAQDHKRAGDGDTGPNTGGMGAYSPAPVVTEE  240 (424)
T ss_pred             HHHHHHHHHHCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             99999999850332345687289997058831799999789972647021147505689999889988566788679999


Q ss_pred             CCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCCCCC
Q ss_conf             22010000089999986204623566445448985570489998865147751044332654411566654201333321
Q gi|254780206|r  236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTH  315 (424)
Q Consensus       236 ~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~~~~  315 (424)
                      +.+++.++|++||+++|+++|++|+|+||+|+|+|++|||||||||||||||||++||||++||+++|.++++|+|++.+
T Consensus       241 ~~~~i~~~Ii~pt~~~l~~eg~~y~GiLy~GlMit~~GpkVlEyN~RfGDPE~qvllp~L~~dl~~l~~~~~~g~L~~~~  320 (424)
T PRK00885        241 VHDRVMEEIIEPTVKGMAAEGIPYTGVLYAGLMITKDGPKVIEFNCRFGDPETQVVLPRLKSDLVELLLAAAEGKLDEVP  320 (424)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCEEEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHCCCCCCCC
T ss_conf             99999998799999999857984799987799986797558986313488588899875236199999987539855455


Q ss_pred             CCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHHHHH
Q ss_conf             23444420675422544668775797624876668986899833587788799818807999996289899999999998
Q gi|254780206|r  316 INWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMV  395 (424)
Q Consensus       316 ~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~ay~~i  395 (424)
                      ++|++++++||||||+|||.+|.+|.+|.++++...++.||||||+..+|+++|+|||||+|++.|+|+++||++||+.+
T Consensus       321 ~~~~~~~~v~Vvlas~GYP~~~~~g~~I~~~~~~~~~~~ifhagt~~~~g~l~t~GGRVl~vva~g~tl~~A~~~aY~~i  400 (424)
T PRK00885        321 LEWDDRAAVGVVLAAKGYPGDYRKGDVITGLDEAEDGVKVFHAGTKLEDGKLVTNGGRVLCVTALGDTLEEAQKRAYAAL  400 (424)
T ss_pred             CCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCEEEEEEEECCCHHHHHHHHHHHH
T ss_conf             33347833799991698898888998704876678998999710362799899778948999998799999999999998


Q ss_pred             HCCCCCCCEECCHHHHHHHHHH
Q ss_conf             5258999575351789887516
Q gi|254780206|r  396 ENIDWKHGYWREDIGLQKKERN  417 (424)
Q Consensus       396 ~~I~~~g~~yR~DIG~~~~~~~  417 (424)
                      ++|+|+|+|||+|||+|++.+.
T Consensus       401 ~~I~~~~~~yR~DIG~k~l~~~  422 (424)
T PRK00885        401 DKIDFDGGFYRRDIGWRALARE  422 (424)
T ss_pred             HCCCCCCCCCCCCCCHHHHHHC
T ss_conf             5267899894574336888533


No 3  
>PRK13789 phosphoribosylamine--glycine ligase; Provisional
Probab=100.00  E-value=0  Score=1059.12  Aligned_cols=414  Identities=40%  Similarity=0.696  Sum_probs=402.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH--CCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             958998865889999999985899678999549835751--170551287898999999987189799997955787489
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~--~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      |||||||||||||||||||++|+.+.++||+|||+||+.  ...+..+++.|++++++||++++|||||||||+||++|+
T Consensus         5 MkVLviGsGGREHAia~kl~~S~~v~~v~~aPGN~G~~~~~~~~~~~i~~~d~~~i~~fa~~~~idLvvvGPE~PL~~Gi   84 (426)
T PRK13789          5 LKVLLIGSGGRESAIAFALRKSNLLSELKVFPGNGGFPDDELLPADSFSILDKSSVQSFLKSNPFDLIVVGPEDPLVAGF   84 (426)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCHHHHHHH
T ss_conf             88999898889999999996198988799988976112345454443386699999999998499999989668886317


Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHH
Q ss_conf             98986058806701066655520102357888765310111122344011111210124202563046534300023235
Q gi|254780206|r   79 SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAAT  158 (424)
Q Consensus        79 ~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~  158 (424)
                      +|.|++.||+||||++++||||+||.|+|+||++||||||+|+.|+|.++|++|+++.++|+|||+||||+||||.||.+
T Consensus        85 ~D~l~~~gi~vfGP~k~aA~LE~SK~faK~fm~~~~IPTa~~~~f~~~~~A~~~l~~~~~P~VIKaDGLAaGKGV~V~~~  164 (426)
T PRK13789         85 ADWAAELGIPCFGPDSYCAQVEGSKHFAKSLMKEAKIPTASYKTFTEYSSSLSYLESEMLPIVIKADGLAAGKGVTVATE  164 (426)
T ss_pred             HHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEECC
T ss_conf             99984169916895989950512698999999972999760157368999999998579988996787689996695399


Q ss_pred             HHHHHHHHHHHH-----CCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCC
Q ss_conf             677888788751-----445317778877520575234421577631035200011135665444443443000012344
Q gi|254780206|r  159 VDEATSAIDRCF-----QQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS  233 (424)
Q Consensus       159 ~~e~~~~~~~~~-----~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~  233 (424)
                      .+|+.++++++|     ++++.+|||||||.|+|+|+++||||+++++||++|||||+||+|+||||||||||||+|+++
T Consensus       165 ~~eA~~al~~i~~~~~fg~ag~~VvIEE~L~G~E~S~~a~~dG~~~~~lp~aQDhKR~~dgD~GPNTGGMGaysP~p~~~  244 (426)
T PRK13789        165 KKMAKRALKEIFKDKKFGQSGNQVVIEEFMEGQEASIFAISDGDSYFLLPAAQDHKRAFDGDQGPNTGGMGAYCPAPVIT  244 (426)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCEEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99999999997544233035875999974589844799997299778688644442133799999999876777786689


Q ss_pred             CCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCC
Q ss_conf             3222010000089999986204623566445448985570-489998865147751044332654411566654201333
Q gi|254780206|r  234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLH  312 (424)
Q Consensus       234 ~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~  312 (424)
                      +++.+++.++|++||+++|+++|++|+|+||+|+|+|++| ||||||||||||||||++||||++||+++|.++++|+|+
T Consensus       245 ~~~~~~i~~~ii~pt~~~l~~~g~~y~GvLy~GlMlt~~G~pkVlEfN~RfGDPE~q~iLp~L~~dl~~~~~a~~~g~L~  324 (426)
T PRK13789        245 EAILQKVKERIFDPMFDDFRKKGHPYRGLLYAGLMISPEGEPKVVEFNCRFGDPETQCVLAMLDGDLLELLYAASTGKIK  324 (426)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCEEEEEEEEECCCCHHHHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             99999999860489999998589998867653289926997699998853189168889887415499999999708866


Q ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHH
Q ss_conf             32123444420675422544668775797624876668986899833587788799818807999996289899999999
Q gi|254780206|r  313 NTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAY  392 (424)
Q Consensus       313 ~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~ay  392 (424)
                      ..+++|++++++||||||+|||++|.||.+|...+....+.++|||||+..+|+++|+|||||+|++.|+|+++|+++||
T Consensus       325 ~~~~~~~~~~~v~vvlas~GYP~~~~kg~~I~~~~~~~~~~~vfhagt~~~~g~l~t~GGRVL~v~a~g~tl~eA~~~aY  404 (426)
T PRK13789        325 VVNLKLKQGAAAVVVLAAQGYPDSYEKNIPLNLPETSGQNVVLFHAGTKKKDGKVFSSGGRILGIVAQGKDLKDSVDQAY  404 (426)
T ss_pred             CCCCCCCCCCCEEEEECCCCCCCCCCCCCEECCCCCCCCCEEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHH
T ss_conf             45443026740699974688999777998851866677986999703441799899735938999997699999999999


Q ss_pred             HHHHCCCCCCCEECCHHHHHHH
Q ss_conf             9985258999575351789887
Q gi|254780206|r  393 HMVENIDWKHGYWREDIGLQKK  414 (424)
Q Consensus       393 ~~i~~I~~~g~~yR~DIG~~~~  414 (424)
                      +++++|+|+|+|||+|||+|++
T Consensus       405 ~~i~~I~~~g~~yR~DIG~ral  426 (426)
T PRK13789        405 SFLEKIQAPKTFYRKDIGRRAL  426 (426)
T ss_pred             HHHHHCCCCCCEECCCCCHHHC
T ss_conf             9996068999880583202019


No 4  
>PRK13790 phosphoribosylamine--glycine ligase; Provisional
Probab=100.00  E-value=0  Score=1041.60  Aligned_cols=412  Identities=41%  Similarity=0.733  Sum_probs=398.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCE-EEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHH
Q ss_conf             958998865889999999985899678999549835751170-5512878989999999871897999979557874899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ-CVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGIS   79 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~-~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~   79 (424)
                      |||||||||||||||||+|+||+.+.+|||+||||||+.+++ +++++.+|++++++||++++|||||||||+||++|++
T Consensus         1 MkVLviGsGgREHAla~~l~~s~~v~~v~~aPGN~g~~~~a~~~~~i~~~d~~~i~~~a~~~~iDLvvvGPE~PL~~Giv   80 (415)
T PRK13790          1 MNVLVIGAGGREHALAYKLNQSNLVKQVFVIPGNEAMTPIAEVHTEISESDHQAILDFAKQQNVDWVVIGPEQPLIDGLA   80 (415)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCHHHHHHHH
T ss_conf             97999887889999999996298989899978955765223024676855899999999981999999896078663488


Q ss_pred             HHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHH
Q ss_conf             89860588067010666555201023578887653101111223440111112101242025630465343000232356
Q gi|254780206|r   80 DALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATV  159 (424)
Q Consensus        80 d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~  159 (424)
                      |.|+++||+||||++++||||+||.|+|+||++||||||+|+.|+|.++|++|++++++|+|||+||||+||||+||++.
T Consensus        81 D~l~~~gi~vfGP~k~aA~LE~SK~faK~~m~~~~IPTa~~~~f~~~~~A~~~l~~~~~p~VIKaDGLAaGKGV~V~~~~  160 (415)
T PRK13790         81 DILRANGFKVFGPNKQAAQIEGSKLFAKKIMEKYNIPTADYKEVERKKDALTYIENCELPVVVKKDGLAAGKGVIIADTI  160 (415)
T ss_pred             HHHHCCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEECCH
T ss_conf             88643897598949799515126999999999829797772550879999999861799889966866789956997999


Q ss_pred             HHHHHHHHHHHCC-CCHHHHHHHHHHCCCCCEEEECCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCC
Q ss_conf             7788878875144-5317778877520575234421577631035-2000111356654444434430000123443222
Q gi|254780206|r  160 DEATSAIDRCFQQ-INSTVIIEEYLEGFEVSFFALCDGKTAIPFT-TARDHKRIHDGDIGPNTGGMGACSPALGMSQELY  237 (424)
Q Consensus       160 ~e~~~~~~~~~~~-~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~-~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~  237 (424)
                      +|+.++++++|.+ ...+|+|||||+|+|+|+++||||+++++|| ++|||||++|+|+||||||||||||.|++++++.
T Consensus       161 ~eA~~al~~i~~~~~~g~VvIEE~L~G~E~S~~a~~DG~~~~p~~~~aQDhKR~~dgD~GPNTGGMGaysp~p~~~~~~~  240 (415)
T PRK13790        161 EAARSAIEIMYGDEEEGTVVFETFLEGEEFSLMTFVNGDLAVPFDCIAQDHKRAFDHDEGPNTGGMGAYCPVPHISDDVL  240 (415)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEEECCCCCEEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             99999999985555476599987157863489999739979957754321202468999999998756677744698999


Q ss_pred             EEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCC
Q ss_conf             01000008999998620462356644544898557048999886514775104433265441156665420133332123
Q gi|254780206|r  238 STVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHIN  317 (424)
Q Consensus       238 ~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~~~~~~  317 (424)
                      +++.++|++||+++|+++|++|+|+||+|+|+|++|||||||||||||||||++||||++||+++|.++++++  ..+++
T Consensus       241 ~~~~~~I~~p~~~~l~~eg~~y~GvLy~GlMlt~~GpkVlEyN~RfGDPE~q~iLp~L~~Dl~~~~~~~~~g~--~~~~~  318 (415)
T PRK13790        241 KLTNETIAQPIAKAMLNEGYQFFGVLYIGAILTKDGPKVIEFNARFGDPEAQVLLSRMESDLMQHIIDLDEGK--RTEFK  318 (415)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEECCCCEEEEEEEECCCCHHHHHHHHCCCHHHHHHHHHHCCC--CCCEE
T ss_conf             9999870899999998559984899887799868986699987411892288898760551999999997599--87157


Q ss_pred             CCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             44442067542254466877579762487666898689983358778879981880799999628989999999999852
Q gi|254780206|r  318 WKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVEN  397 (424)
Q Consensus       318 ~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~ay~~i~~  397 (424)
                      |++++++||||||+|||++|.||.+|.+++.   +..+|||||+..+++++|+|||||+|++.|+|+++|+++||+++++
T Consensus       319 ~~~~~~v~vvlas~GYP~~~~kg~~I~g~~~---~~~vf~ag~~~~~~~l~t~GGRVL~v~a~g~~l~eA~~~ay~~i~~  395 (415)
T PRK13790        319 WKNESIVGVMLASKGYPDAYEKGHKVSGFDL---NENYFVSGLKKQGDTFVTSGGRVILAIGKGDNVQDAQRDAYEKVSQ  395 (415)
T ss_pred             ECCCCEEEEEECCCCCCCCCCCCCCCCCCCC---CCCEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHHHHHHC
T ss_conf             6378369999645889977779972557777---7619986678779989977692899999859999999999999852


Q ss_pred             CCCCCCEECCHHHHHHHHHH
Q ss_conf             58999575351789887516
Q gi|254780206|r  398 IDWKHGYWREDIGLQKKERN  417 (424)
Q Consensus       398 I~~~g~~yR~DIG~~~~~~~  417 (424)
                      |+|+|+|||+|||+|++++.
T Consensus       396 I~~~g~~yR~DIG~kal~~k  415 (415)
T PRK13790        396 IQSDHLFYRHDIANKALQLK  415 (415)
T ss_pred             CCCCCCEECCCHHHHHHHCC
T ss_conf             68999990370667886139


No 5  
>PRK05784 phosphoribosylamine--glycine ligase; Provisional
Probab=100.00  E-value=0  Score=1025.85  Aligned_cols=420  Identities=30%  Similarity=0.507  Sum_probs=385.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECC--CHHHHHCCE-----EEECCCCCHHHHHHHHHHHCCCEEEECCCHH
Q ss_conf             958998865889999999985899678999549--835751170-----5512878989999999871897999979557
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPG--NPGIAQHAQ-----CVAIDIQNHSAIIHFCQEKHIDLVVVGPELP   73 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pg--N~g~~~~~~-----~~~i~~~d~~~i~~~a~~~~iDlvivgpE~p   73 (424)
                      |||||||||||||||||||+||+.+.++||+||  |||++.+++     ++.++.+|++++++||++++|||||||||+|
T Consensus         1 MkVLVIGsGGREHAla~kl~~Sp~v~~l~~aPGn~NpG~~~~a~~~~~~~~~~~~~d~~~i~~fa~~~~IDLvvVGPE~P   80 (485)
T PRK05784          1 MKVLLVGDGAREHAIAEALAKSPKGYRIYALSSHLNPGIEEIVKKTGGEYFIGNPTSPGEVVKAAEEVSPDLVVIGPEEP   80 (485)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHCCCCEECCCCCCHHHHHHHHHHCCCCEEEECCHHH
T ss_conf             98999898889999999996098989899973898752567764258721204877999999999981999999897388


Q ss_pred             HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             8748998986058806701066655520102357888765310-111122344011111210124202563046534300
Q gi|254780206|r   74 LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP-TATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKG  152 (424)
Q Consensus        74 L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP-t~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkG  152 (424)
                      |++|++|.|+++||+||||++++||||+||.|+|+||++|||| |+.|+.|+|.++|++|++..+ |+|||+||||+|||
T Consensus        81 L~~Gi~D~l~~~gi~vFGP~k~aA~LE~SK~FaK~fm~~~~IPtta~~~~f~~~~~A~~~l~~~~-piVIKaDGLAaGKG  159 (485)
T PRK05784         81 LFAGVADALREEGFPVFGASSKCAEIEKSKVFARSLMWKYGIPGRLRYGVFKDVEEAYSFAEYGG-SVAIKPARQAGGKG  159 (485)
T ss_pred             HHHHHHHHHHHCCCCEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCC-CEEEECCHHCCCCC
T ss_conf             76125899973799078968899414127889999999728996640121389999999986489-84992113306785


Q ss_pred             CCCHHHHH--------HHH-HHHH------HHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             02323567--------788-8788------75144531777887752057523442157763103520001113566544
Q gi|254780206|r  153 VVVAATVD--------EAT-SAID------RCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIG  217 (424)
Q Consensus       153 V~i~~~~~--------e~~-~~~~------~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~G  217 (424)
                      |.|+.+..        |+. +.++      ..|++++++|+|||||+|+|+|+++||||+++++||++|||||++|+|+|
T Consensus       160 V~V~~~~~~~~~~~~~e~~~~~~~~~~~~~~~fg~ag~~VvIEEfL~G~E~S~~a~~DG~~~~~lp~aQDhKR~~dgD~G  239 (485)
T PRK05784        160 VKVIYDLQAYLSNEKDEVLTKGAEEIKEQLASYRDVEEKILVEEKVDGVEYTVQVLTDGESVFPLPPVQDNPHAYEYGIG  239 (485)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEEECCEEEECCCCCCCCCCCCCCCC
T ss_conf             18822727777778999999999999987654324687099996446817999999829969989222057655689999


Q ss_pred             CCCCCCCEEECC----CCCCCCCCEEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEE
Q ss_conf             444344300001----23443222010000089999986204-6235664454489855704899988651477510443
Q gi|254780206|r  218 PNTGGMGACSPA----LGMSQELYSTVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMM  292 (424)
Q Consensus       218 pnTGGMGa~~p~----~~~~~~~~~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~il  292 (424)
                      |||||||||||+    |++++++.+++ .+|++||+++|+++ |++|+|+||+|||+|++|||||||||||||||||++|
T Consensus       240 PNTGGMGAysP~~~~~P~l~~~~~~~~-~~Ii~pti~~l~~e~g~~y~GvLY~GlMit~~GPkVlEfN~RfGDPEtQ~iL  318 (485)
T PRK05784        240 PETGGMGSVSGPGELLPFIEEEEYEEA-VEIVKATVEAIRKETGERYVGVLSGQMMLTALGPTVIEYYSRLGDPEALNAL  318 (485)
T ss_pred             CCCCCCEECCCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCEEEEEECCCCCCHHHHHH
T ss_conf             899987006787667754479999999-8748999999986169972788876788618984899996887883388899


Q ss_pred             ECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCCCCC--CCCCCCCCCC--CCCCCEEEEEEEEEECCEEE
Q ss_conf             3265441156665420133332123444420675422544668775--7976248766--68986899833587788799
Q gi|254780206|r  293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYP--HGTIISKIPQ--NTGTTQLFHAGTAIVNNNLT  368 (424)
Q Consensus       293 p~L~~dl~~il~~~~~g~L~~~~~~~~~~~~v~Vvlas~GYP~~~~--kg~~I~~l~~--~~~~~~ifhagt~~~~g~l~  368 (424)
                      |||++||+++|.++++|+|++.+++|++++++||||||+|||++|+  ++..|.....  ...++.||||||...||+++
T Consensus       319 p~L~sDl~~l~~a~~~g~L~~~~~~~~~~~av~VVlAs~GYP~~~~~~~g~~i~~~~~~~~~~~~~vfhagt~~~~g~l~  398 (485)
T PRK05784        319 YLYEGDFYELFELAATGKLHKAERRFKEEPTVVKAIAPLGYPLRRDLATGRRIWVDWDSIRREGCLVYFGSVEVEGGKLV  398 (485)
T ss_pred             HHHHCCHHHHHHHHHCCCCCCCCEEECCCCEEEEEEECCCCCCCCCCCCCCEEECCCCCCCCCCCEEEEEEEEEECCEEE
T ss_conf             87426399999999819988787047689569999946999997567899565268422235697899704387799899


Q ss_pred             ECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCC-CEECCHHHHHHH-HHHHHHHC
Q ss_conf             8188079999962898999999999985258999-575351789887-51644430
Q gi|254780206|r  369 ANGGRVLSATALGKTITESRELAYHMVENIDWKH-GYWREDIGLQKK-ERNVKYRN  422 (424)
Q Consensus       369 t~GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g-~~yR~DIG~~~~-~~~~~~~~  422 (424)
                      |+|||||+|++.|+|+++||++||+++++|+|+| +|||+|||.+++ ++++++|.
T Consensus       399 t~GGRVL~v~a~g~tl~eAr~~aY~~i~~I~f~g~~~yR~DIGt~~~~~~~i~~m~  454 (485)
T PRK05784        399 TLGSRALEILAPGDTYEEAYEKAERCASAVKGDGKLIYRHDIGSPEYMSEMAEKAE  454 (485)
T ss_pred             ECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             83692899999869899999999999850659998877288898799999999999


No 6  
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism]
Probab=100.00  E-value=0  Score=1023.36  Aligned_cols=417  Identities=51%  Similarity=0.865  Sum_probs=398.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCC-CCHHHHHHHHHHHCCCEEEECCCHHHHHHHH
Q ss_conf             958998865889999999985899678999549835751170551287-8989999999871897999979557874899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI-QNHSAIIHFCQEKHIDLVVVGPELPLVNGIS   79 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~-~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~   79 (424)
                      |||||||||||||||||||.||+.+.++|++||||||+....++++++ +|.+.|++||++++|||+|||||+||++||+
T Consensus         1 mkVLviGsGGREHAiA~kla~s~~v~~~~~apgN~G~a~~~~~~~~~~~~~~~~lv~fA~~~~idl~vVGPE~pL~~Gvv   80 (428)
T COG0151           1 MKVLVIGSGGREHALAWKLAQSPLVLYVYVAPGNPGTALEAYLVNIEIDTDHEALVAFAKEKNVDLVVVGPEAPLVAGVV   80 (428)
T ss_pred             CEEEEECCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEECCCHHHHHHHH
T ss_conf             94999868816999999984087624999937997421134433676555889999999973999899897178764468


Q ss_pred             HHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHH
Q ss_conf             89860588067010666555201023578887653101111223440111112101242025630465343000232356
Q gi|254780206|r   80 DALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATV  159 (424)
Q Consensus        80 d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~  159 (424)
                      |.|+++||++|||++.+||||+||.|+|+||++|||||+.|+.|++.++|++|+++++.|+|||||||++||||.|+.+.
T Consensus        81 D~l~~~Gi~vFGPsk~AA~lE~SK~faK~fm~k~~IPta~y~~f~~~e~a~ayi~~~g~piVVKadGLaaGKGV~V~~~~  160 (428)
T COG0151          81 DALRAAGIPVFGPTKAAAQLEGSKAFAKDFMKKYGIPTAEYEVFTDPEEAKAYIDEKGAPIVVKADGLAAGKGVIVAMTL  160 (428)
T ss_pred             HHHHHCCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEECCCHHHHHHHHHHCCCCEEEECCCCCCCCCEEECCCH
T ss_conf             99987799623867889887753999999999819996411100898999999997299889934544678985982779


Q ss_pred             HHHHHHHHHHHC-----CCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCC
Q ss_conf             778887887514-----453177788775205752344215776310352000111356654444434430000123443
Q gi|254780206|r  160 DEATSAIDRCFQ-----QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ  234 (424)
Q Consensus       160 ~e~~~~~~~~~~-----~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~  234 (424)
                      +|+.+++++++.     +.+.+|+|||||+|+|+|++++|||++++|||++|||||+||+|+||||||||||||+|++++
T Consensus       161 eeA~~a~~~~l~~~~fg~~g~~VVIEEfL~GeE~S~~a~~DG~~v~p~p~aQDhKra~dgD~GPNTGGMGaysp~P~~t~  240 (428)
T COG0151         161 EEAEAAVDEMLEGNAFGSAGARVVIEEFLDGEEFSLQAFVDGKTVIPMPTAQDHKRAYDGDTGPNTGGMGAYSPAPFITD  240 (428)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEECCCCEEEEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
T ss_conf             99999999997400014788748998533461799999976986787853145643348998998888777779887998


Q ss_pred             CCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCCCC
Q ss_conf             22201000008999998620462356644544898557048999886514775104433265441156665420133332
Q gi|254780206|r  235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNT  314 (424)
Q Consensus       235 ~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~~~  314 (424)
                      +..+++.++|++||+++|.++|.+|+||||+|||+|++|||||||||||||||||++||||+|||+++|+++++|+|+++
T Consensus       241 e~~~~~~~~Iv~ptv~gm~~EG~~f~GvLy~glMlt~~GPkViEfN~RFGDPEtq~vL~~l~sdl~~~~~a~~~g~L~~~  320 (428)
T COG0151         241 EVVERAVEEIVEPTVEGMAKEGYPFRGVLYAGLMLTADGPKVIEFNARFGDPETQVVLPLLESDLVELLLAAVDGKLDEV  320 (428)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCEEEEEECCCCCHHHHHHHHHCCCCHHHHHHHHHHCCCCCC
T ss_conf             99999999999999999997189814788767898289967999856668835777787602609999999971875564


Q ss_pred             CCCC-CCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCC-CCEEEEEEEEEECC-EEEECCCCEEEEEEECCCHHHHHHHH
Q ss_conf             1234-444206754225446687757976248766689-86899833587788-79981880799999628989999999
Q gi|254780206|r  315 HINW-KAEYALTVVVATKGYPEEYPHGTIISKIPQNTG-TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELA  391 (424)
Q Consensus       315 ~~~~-~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~-~~~ifhagt~~~~g-~l~t~GGRVL~vv~~g~~l~eA~~~a  391 (424)
                      ++.| ++++++|||+||.|||.+|.+|..|+++++..+ +..+|||||+.+++ .++|+|||||+|+++|+|+++|+++|
T Consensus       321 ~~~~~~~~a~v~vvlA~~GYP~~~~kG~~I~~~~~~~~~~~~vf~Agv~~~~~~~lvt~GgRvL~v~~~g~t~~eA~~~a  400 (428)
T COG0151         321 EILFWDKGAAVGVVLAAEGYPGDPEKGDVITGDEEAEEEGAKVFHAGVKLDDGGQLVTSGGRVLAVVGTGDTLEEAQEKA  400 (428)
T ss_pred             CHHHCCCCCEEEEEEECCCCCCCCCCCCEEECCHHHCCCCCEEEEEEEECCCCCEEEECCCEEEEEEECCCCHHHHHHHH
T ss_conf             42221578569999905888988889988764756426683899966721579559964885899996589999999999


Q ss_pred             HHHHHCCCCCCCEECCHHHHHHHHHH
Q ss_conf             99985258999575351789887516
Q gi|254780206|r  392 YHMVENIDWKHGYWREDIGLQKKERN  417 (424)
Q Consensus       392 y~~i~~I~~~g~~yR~DIG~~~~~~~  417 (424)
                      |+.+++|+|+|+|||+|||+|++.+.
T Consensus       401 y~~~~~i~~~g~~yRkDIG~~a~~~~  426 (428)
T COG0151         401 YEALEKIHFDGLFYRKDIGSRALERK  426 (428)
T ss_pred             HHHHHHCCCCCCEEECCCCHHHHHHH
T ss_conf             99996357789556343346655420


No 7  
>PRK06395 phosphoribosylamine--glycine ligase; Provisional
Probab=100.00  E-value=0  Score=977.54  Aligned_cols=418  Identities=30%  Similarity=0.432  Sum_probs=381.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEE-EECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHH
Q ss_conf             9589988658899999999858996789995498357511705-512878989999999871897999979557874899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC-VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGIS   79 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~-~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~   79 (424)
                      |||||||||||||||||+|+||+.+..+++.|||||+...+++ +.++..|++.|++||++++|||||||||+||++|++
T Consensus         3 MkVLViGsGGREHAla~kl~~s~~~~~~~~g~gn~g~~~~~~~~~~~~~~d~~~i~~~a~~~~idLvvvGPE~pL~~Gi~   82 (435)
T PRK06395          3 MKVMLVGSGGREDAIARAIKRSGAILFSVIGHENPSIKKLSKKYLFYDEKDYDLIEDFALKNNVDIVFVGPDPVLATPLV   82 (435)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCHHHHCCHH
T ss_conf             77999887889999999985598844999899967877623234656856999999999984999999897678866145


Q ss_pred             HHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHH-
Q ss_conf             8986058806701066655520102357888765310-11112234401111121012420256304653430002323-
Q gi|254780206|r   80 DALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP-TATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAA-  157 (424)
Q Consensus        80 d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP-t~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~-  157 (424)
                      |.|++.|+|||||++++||||+||.|+|+||++|||| |++|..+.|.+++..++.+.++|+||||||||+||||.|+. 
T Consensus        83 D~l~~~gi~vFGP~k~aA~LE~SK~FaK~fm~~~~IP~ta~~~~~~~~~ea~~~~~~~~~piVIKadGLAaGKGV~V~~~  162 (435)
T PRK06395         83 NNLLKRGIKVASPTMEAAMIETSKMFMRYLMERHNIPGNINFNACFSEKDAARDYITSMKDVAVKPIGLTGGKGVKVTGE  162 (435)
T ss_pred             HHHHHCCCCEECCHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECC
T ss_conf             59976899466842887326327988999999809985664532399999999999709984897342257896489558


Q ss_pred             ---HHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCC----
Q ss_conf             ---5677888788751445317778877520575234421577631035200011135665444443443000012----
Q gi|254780206|r  158 ---TVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPAL----  230 (424)
Q Consensus       158 ---~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~----  230 (424)
                         +.+|+..++.+.+ +.++.|+|||||.|+|+|+++||||+++++||++|||||++|+|+||||||||||||++    
T Consensus       163 ~~~~~~ea~~~~~~~~-~~~~~vvIEE~L~G~E~S~~a~~dG~~~~~lp~aqDhKR~~dgD~GPNTGGMGaysp~~~~~p  241 (435)
T PRK06395        163 QLNSVDEAIRYAIEIL-DRDGVVLIEKKMTGEEFSLQAFSDGKHLSFMPIVQDYKRAYEGDHGPNTGGMGSISDRDFSLP  241 (435)
T ss_pred             CHHHHHHHHHHHHHHH-HCCCEEEEEEEEECCEEEEEEEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             5778999999999887-348859999998441689999976995585873012533447999999998745688888874


Q ss_pred             CCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCC
Q ss_conf             34432220100000899999862046235664454489855704899988651477510443326544115666542013
Q gi|254780206|r  231 GMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGN  310 (424)
Q Consensus       231 ~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~  310 (424)
                      +++++..+++ ++|++||+++|++++++|+|+||+|||+|++|||||||||||||||||++||||++||+++|.++++|+
T Consensus       242 ~l~~~~~e~~-~~Ii~pti~~l~~eg~~y~GvLy~GlMit~~gpkVlEyN~RfGDPE~QviLp~L~~Dl~~ll~a~~~g~  320 (435)
T PRK06395        242 FLSKDAPERA-KHILNDIIRAMKDENNPFKGIMYGQFMDTPNGVKVIEINARFADPEGINVLYLLKSDFVETLHQIYSGN  320 (435)
T ss_pred             CCCHHHHHHH-HHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCEEEEEEECCCCCHHHHHHHHHCCCHHHHHHHHHCCC
T ss_conf             3277899999-999999999999649970899877898508996489986203880688887760052999999997088


Q ss_pred             CCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHH
Q ss_conf             33321234444206754225446687757976248766689868998335877887998188079999962898999999
Q gi|254780206|r  311 LHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESREL  390 (424)
Q Consensus       311 L~~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~  390 (424)
                      |+. ++.|++++++|||+||.|||++|.+|...........++.+|||||+..+++++|+|||||+||+.|+|+++||++
T Consensus       321 L~~-~~~~~~~~~v~vvlas~GYP~~~~kg~i~i~~~~~~~~~~vfhagt~~~~~~l~t~GGRVl~v~a~g~sl~eA~~~  399 (435)
T PRK06395        321 LNG-SIKFERKATVLKYIVPPGYGENPSPGRIKIDKTIFDSNSDVYYASVSGTLNDVKTSGSRSLAIIAKGDSIPEASEK  399 (435)
T ss_pred             CCC-CCEEECCCEEEEEEECCCCCCCCCCCCEECCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHH
T ss_conf             887-7543069879999977888877808763256444579998998167767993998238489999987999999999


Q ss_pred             HHHHHHCCCCCCCEECCHHHHHHH-HHHHHHHC
Q ss_conf             999985258999575351789887-51644430
Q gi|254780206|r  391 AYHMVENIDWKHGYWREDIGLQKK-ERNVKYRN  422 (424)
Q Consensus       391 ay~~i~~I~~~g~~yR~DIG~~~~-~~~~~~~~  422 (424)
                      ||+.+++|++. +|||+|||.|++ +++++.+.
T Consensus       400 aY~~i~~I~~~-~y~R~DIG~r~~~~~~i~~~~  431 (435)
T PRK06395        400 VDSDLNAVHGS-YYVRRDIGDSDFIRKKIKNAK  431 (435)
T ss_pred             HHHHHHCCCCC-CCCCCCCCHHHHHHHHHHHHH
T ss_conf             99998431589-667188772899999999899


No 8  
>KOG0237 consensus
Probab=100.00  E-value=0  Score=964.18  Aligned_cols=416  Identities=49%  Similarity=0.846  Sum_probs=401.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCC----EEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             95899886588999999998589967899954983575117----05512878989999999871897999979557874
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA----QCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~----~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      |+|||||||||||||||||+|||.+.+|||+|||.|++..+    .+.+|+..|++++..||++++|.+|+||||.||++
T Consensus         3 ~~vLviGsGgREHal~wkL~qSp~v~~v~vaPGn~G~a~~~~~~~~~~dI~~~d~~ala~f~~e~~I~lVvvGPE~PL~~   82 (788)
T KOG0237           3 VNVLVIGSGGREHALAWKLKQSPKVKKVYVAPGNGGTASGDASKVPNLDISVADFEALASFCKEHNINLVVVGPELPLVA   82 (788)
T ss_pred             EEEEEECCCCHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEECCCHHHHH
T ss_conf             37999758842768888763287555389836988745675123755655765599999999874621899787326542


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCC-EEEEEECCCCCCCCCCC
Q ss_conf             89989860588067010666555201023578887653101111223440111112101242-02563046534300023
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSM-PIVVKADGLCAGKGVVV  155 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~-PvVVKp~~~agGkGV~i  155 (424)
                      |++|.|+..|||||||++.+||||+||.|+|+||.+|||||++|+.|++.++|+.|+++.++ ++|||+||+|+||||.|
T Consensus        83 Gl~~~l~~~gi~~FGPs~~aAqlE~sK~fsK~fm~r~~IPTA~y~~ft~~e~a~sfi~~~~~~~~ViKAdGLAAGKGViv  162 (788)
T KOG0237          83 GLADVLRSAGIPCFGPSKQAAQLEASKNFSKDFMHRHNIPTAKYKTFTDPEEAKSFIQSATDKALVIKADGLAAGKGVIV  162 (788)
T ss_pred             HHHHHHHCCCCCEECCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCEEE
T ss_conf             35666640585101743777776641788998898639983202640787998999984898564896055245771574


Q ss_pred             HHHHHHHHHHHHHH-----HCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCC
Q ss_conf             23567788878875-----1445317778877520575234421577631035200011135665444443443000012
Q gi|254780206|r  156 AATVDEATSAIDRC-----FQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPAL  230 (424)
Q Consensus       156 ~~~~~e~~~~~~~~-----~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~  230 (424)
                      +.+.+|+.+|++.+     |++++..|+|||||+|.|+|+.+|+||.++.+||++|||||++|+|+||||||||||+|.|
T Consensus       163 ~~~~~EA~eAv~sIl~~~~fg~AG~tvViEE~LEGeEvS~laftDG~s~~~mp~aQDHKRl~dgD~GpNTGgmGaY~paP  242 (788)
T KOG0237         163 AKSKEEAFEAVDSILVKKVFGSAGKTVVIEELLEGEEVSFLAFTDGYSVRPLPPAQDHKRLGDGDTGPNTGGMGAYAPAP  242 (788)
T ss_pred             ECCHHHHHHHHHHHHHHHHHCCCCCEEEHHHHCCCCEEEEEEEECCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCC
T ss_conf             05479999999999854441356645861123076257899985573023388510025530789999888865565477


Q ss_pred             CCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCC
Q ss_conf             34432220100000899999862046235664454489855704899988651477510443326544115666542013
Q gi|254780206|r  231 GMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGN  310 (424)
Q Consensus       231 ~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~  310 (424)
                      ..++++.+.++++|++||+++|+.+|++|.|+||+|+|+|++||+||||||||||||||++||+|++||.+++++|++++
T Consensus       243 v~s~~ll~~v~~~I~~~Tv~Gm~~eg~~y~GVLfaGlMl~k~~P~vLEfN~RFGDPEtQv~l~lLesDL~evi~a~~~~~  322 (788)
T KOG0237         243 VASPKLLDTVQSTIIEPTVDGMAEEGIPYVGVLFAGLMLTKDGPKVLEFNVRFGDPETQVLLPLLESDLAEVILACCNGR  322 (788)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             56989999999887667665787639962568765468835996079984013892065659878767999999986187


Q ss_pred             CCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCC-CCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHH
Q ss_conf             33321234444206754225446687757976248766689-86899833587788799818807999996289899999
Q gi|254780206|r  311 LHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG-TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRE  389 (424)
Q Consensus       311 L~~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~-~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~  389 (424)
                      |+..++.|++.++|+|||||.|||++|.||..|+++++... ...||||||...+++++|||||||+|++.++++++|++
T Consensus       323 L~~~~i~w~~~sa~~VV~as~gYP~sy~KG~~It~~~~~~~~~~rVFHAGTs~~ss~vvTNGGRVLsVTA~~~~L~sA~e  402 (788)
T KOG0237         323 LDTVDIVWSKKSAVTVVMASGGYPGSYTKGSIITGLPEADRPGTRVFHAGTSLDSSNVVTNGGRVLSVTATGDDLESAAE  402 (788)
T ss_pred             CCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCEEECCCEEEEEEECCCHHHHHHH
T ss_conf             45567541146148999905898987768763016766678762698625630245247538659999716730999999


Q ss_pred             HHHHHHHCCCCCCCEECCHHHHHHHHH
Q ss_conf             999998525899957535178988751
Q gi|254780206|r  390 LAYHMVENIDWKHGYWREDIGLQKKER  416 (424)
Q Consensus       390 ~ay~~i~~I~~~g~~yR~DIG~~~~~~  416 (424)
                      .||+.++.|+|.|+|||+|||+|+++.
T Consensus       403 ~Ayk~v~~I~Fsg~~yRkDI~~ra~~~  429 (788)
T KOG0237         403 TAYKAVQVISFSGKFYRKDIAWRAFKN  429 (788)
T ss_pred             HHHHHHEEEEECCCCCCCHHHHHHCCH
T ss_conf             998776187305522110346553021


No 9  
>pfam01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain. Phosphoribosylglycinamide synthetase catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by Phosphoribosylglycinamide synthetase is the ATP- dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide. This domain is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase (see pfam02786).
Probab=100.00  E-value=0  Score=371.99  Aligned_cols=188  Identities=54%  Similarity=0.924  Sum_probs=180.1

Q ss_pred             HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCC-----CCH
Q ss_conf             010235788876531011112234401111121012420256304653430002323567788878875144-----531
Q gi|254780206|r  101 SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ-----INS  175 (424)
Q Consensus       101 ~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~-----~~~  175 (424)
                      +||.|||++|+++|||||+|..++|.++++++++++|||+||||++++||+||.+|+|.+|+.+++.+++..     .+.
T Consensus         1 gdK~~~r~~l~~~gip~p~~~~~~~~~ea~~~~~~~g~P~VvKp~~~~gs~Gv~~v~~~~e~~~a~~~~~~~~~~~~~~~   80 (193)
T pfam01071         1 GSKSFAKDFMKRHGIPTAEYETFTDPEEAKSYIREAGFPAVVKADGLAAGKGVIVAMDNEEAIKAVDEILEQKKFGEAGE   80 (193)
T ss_pred             CCHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             98899999999869899990787899999999997699889997434678837995458999999999985230357899


Q ss_pred             HHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHC
Q ss_conf             77788775205752344215776310352000111356654444434430000123443222010000089999986204
Q gi|254780206|r  176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKE  255 (424)
Q Consensus       176 ~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~  255 (424)
                      +|||||||+|+|+|+++++||+++.++++++||||++++|.||+|||||+|+|.|.+++++.+++.+.++++++++|+.+
T Consensus        81 ~vlvEefl~G~E~sv~~~~dg~~~~~~~~~~~~k~~~~~d~g~~tg~~g~~~p~~~~~~~~~~~~~~~i~~~~~~al~~~  160 (193)
T pfam01071        81 PVVIEEFLEGEEVSVLAFVDGKTVKPLPPAQDHKRLGEGDTGPNTGGMGAYSPAPVLTPELLERIKETIVEPTVDGLRKE  160 (193)
T ss_pred             CEEEEEECCCCEEEEEEEEECCEEEEEEEEEEEEEECCCCCCCCCCCCCEECCCCCCCHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             78998720571655789840997997142176445015788887799724634755898999999999999999999974


Q ss_pred             CCEEEEEEEEEEEEECCEEEEEEEEEEECCCCC
Q ss_conf             623566445448985570489998865147751
Q gi|254780206|r  256 QNPFQGVLFAGLMITEQGPYLIEYNVRFGDPEC  288 (424)
Q Consensus       256 ~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~  288 (424)
                      |++|+|++|+++|+|++||||||+|+|||||||
T Consensus       161 g~~~~G~~h~e~~lt~~GP~vIEiN~RlGdpe~  193 (193)
T pfam01071       161 GIPYKGVLYAGLMLTKDGPKVLEFNCRFGDPET  193 (193)
T ss_pred             CCCCEEEEEEEEEEECCCEEEEEEECCCCCCCC
T ss_conf             999688999999998995799999399989998


No 10 
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated
Probab=100.00  E-value=5.5e-36  Score=280.04  Aligned_cols=367  Identities=21%  Similarity=0.296  Sum_probs=259.7

Q ss_pred             EEEEECCC--HHHHHHHHHHHHCCCCCEEEEE-C--CCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             58998865--8899999999858996789995-4--98357511705512878989999999871897999979557874
Q gi|254780206|r    2 RVLLIGSG--GREHALAWKIAQSPLLSELWSI-P--GNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         2 kILviGsG--grEhAl~~~l~~s~~~~~v~~~-p--gN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      ||+|+|+|  ||.-|  .+.++-+.  ++++. |  +.|+.....+.+..+..|.+++.+|+++.++|.+....|.. ..
T Consensus        14 kIgIlGgGQLg~Mla--~aA~~LG~--~vivld~~~d~PA~~vAd~~~~~~~~D~~al~~~a~~~~~DvvT~E~E~V-~~   88 (395)
T PRK09288         14 RVMLLGSGELGKEVA--IEAQRLGV--EVIAVDRYANAPAMQVAHRSHVIDMLDGDALRAVIEREKPDLIVPEIEAI-AT   88 (395)
T ss_pred             EEEEECCCHHHHHHH--HHHHHCCC--EEEEECCCCCCCHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCCC-CH
T ss_conf             899989889999999--99998799--89998489959446728657977878999999999983899899785447-88


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHH-HHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCC
Q ss_conf             8998986058806701066655520102357888-765310111122344011111210124202563046534300023
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC-TKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVV  155 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l-~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i  155 (424)
                      ...+.|++.|++++ |+.++.++..||...|+++ +++|||||+|..+++.+++.++++++|||+|+||....+|||+.+
T Consensus        89 ~~L~~le~~G~~v~-Ps~~al~i~qdR~~~k~~~~~~lgIPt~~f~~v~s~~el~~~~~~lG~P~vlK~~~G~DGKGq~~  167 (395)
T PRK09288         89 DALVELEAEGFNVV-PTARATRLTMNREGIRRLAAEELGLPTSPYRFADSLEELRAAVEEIGYPCVVKPVMSSSGKGQSV  167 (395)
T ss_pred             HHHHHHHHCCCEEC-CCHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHHCCCEEEECCCCCCCCCEEE
T ss_conf             99999986893367-99999999876789999999746999999547089999999999829875872241578875289


Q ss_pred             HHHHHHHHHHHHHHHCC---CCHHHHHHHHHH-CCCCCEEEECC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             23567788878875144---531777887752-05752344215--7763103520001113566544444344300001
Q gi|254780206|r  156 AATVDEATSAIDRCFQQ---INSTVIIEEYLE-GFEVSFFALCD--GKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA  229 (424)
Q Consensus       156 ~~~~~e~~~~~~~~~~~---~~~~VliEefl~-G~E~Sv~~i~d--G~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~  229 (424)
                      +++.+|+.++++.+...   ...++++|+|++ ..|+|+.+..+  |+ +.++|++. |.+. +++.-      =++.|+
T Consensus       168 v~~~~dl~~a~~~a~~~~~~~~~~~ivE~~v~f~~E~Svi~aR~~~g~-~~~~~pve-~~~~-~gil~------~s~~Pa  238 (395)
T PRK09288        168 VRSPEDIEAAWEYAQEGGRGGAGRVIVEEFIDFDYEITLLTVRAVDGG-THFCAPIG-HRQE-DGDYR------ESWQPQ  238 (395)
T ss_pred             ECCHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCEEEEEEEEECCCCC-EEEECCCC-CEEE-CCEEE------EEECCC
T ss_conf             668788899999998507578970899888536179999999969998-89966854-2553-34279------971577


Q ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHC
Q ss_conf             23443222010000089999986204623566445448985570489998865147751044332654411566654201
Q gi|254780206|r  230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHG  309 (424)
Q Consensus       230 ~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g  309 (424)
                      + ++++..+++ +++.++++++|     .|+|++.++|.+++++.+|.|+++|..+.---++-..-.+-|-..+-+++.-
T Consensus       239 ~-i~~~v~~~a-~~ia~~i~~~L-----~~vGvl~VEfFv~~d~llvNEiAPR~HNSGH~Ti~~~~~sQFe~hlRai~gl  311 (395)
T PRK09288        239 P-MSPAALEEA-QEIAKKVTDAL-----GGRGLFGVELFVKGDEVYFSEVSPRPHDTGMVTLISQNLSEFELHARAILGL  311 (395)
T ss_pred             C-CCHHHHHHH-HHHHHHHHHHC-----CCCCEEEEEEEEECCEEEEEEECCCCCCCCEEEEHHCCCCHHHHHHHHHCCC
T ss_conf             8-999999999-99999999974-----8714488999997890899992078778621762103541999999998099


Q ss_pred             CCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCC--CCCCEEEEEEEEEECCEEEECCCCEEEE-EEECCCHHH
Q ss_conf             3333212344442067542254466877579762487666--8986899833587788799818807999-996289899
Q gi|254780206|r  310 NLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TGTTQLFHAGTAIVNNNLTANGGRVLSA-TALGKTITE  386 (424)
Q Consensus       310 ~L~~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~--~~~~~ifhagt~~~~g~l~t~GGRVL~v-v~~g~~l~e  386 (424)
                      -|  .+.++....++.++|...-+     .+..+.++++.  .++.++.+      -|+-.+.+||.+.. |.+|+|+++
T Consensus       312 Pl--g~~~~~~p~a~~~~lg~~~~-----~~~~~~~~~~~~~~p~~~~h~------YGK~~~r~gRKmGHvt~~g~~~~~  378 (395)
T PRK09288        312 PI--PDIRLYGPAASAVILAEGES-----ANPSFDGLAEALAVPGTDVRL------FGKPEIRGGRRMGVALATAEDVEE  378 (395)
T ss_pred             CC--CCCCCCCCCEEEEEECCCCC-----CCCCHHHHHHHHCCCCCEEEE------ECCCCCCCCCCEEEEEEEECCHHH
T ss_conf             88--98520367379999526667-----786634699997199987999------289999899833899986099999


Q ss_pred             HHHHHHHHHHCCCCCCC
Q ss_conf             99999999852589995
Q gi|254780206|r  387 SRELAYHMVENIDWKHG  403 (424)
Q Consensus       387 A~~~ay~~i~~I~~~g~  403 (424)
                      |+++||.++.+|+.+|.
T Consensus       379 a~~~a~~a~~~i~v~g~  395 (395)
T PRK09288        379 AREKAKKAAAKVKVRGS  395 (395)
T ss_pred             HHHHHHHHHHHEEECCC
T ss_conf             99999999744582789


No 11 
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=100.00  E-value=1.7e-37  Score=290.96  Aligned_cols=288  Identities=20%  Similarity=0.391  Sum_probs=240.2

Q ss_pred             EEEEECCC------HHH------HHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865------889------99999998589967899954983575----117055128789899999998718979
Q gi|254780206|r    2 RVLLIGSG------GRE------HALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsG------grE------hAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||||||||      |-|      || +|+|++...  +..+.+-||.|.    .+++..++++..+|.|+++.+.+++++
T Consensus       575 ~~lvlGSGp~RIGqgvEFDYc~Vh~-~~aLr~~Gy--e~ImiN~NPETVSTDyD~sDrLYFEplt~E~Vm~I~e~E~~~G  651 (1089)
T TIGR01369       575 KVLVLGSGPNRIGQGVEFDYCCVHA-VLALREAGY--ETIMINYNPETVSTDYDTSDRLYFEPLTFEDVMNIIELEKPEG  651 (1089)
T ss_pred             EEEEECCCCEECCCCEEEHHHHHHH-HHHHHHCCC--EEEEEECCCCCCCCCHHHHHHCCCCCCCCCCCEEHEEECCCCE
T ss_conf             6899878451406631205678999-999987299--5999977899743666651011587635031001100058667


Q ss_pred             EEE--CCCHHHHHHHHHHHHHCC-CCEEECCHHHHH-HHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEE
Q ss_conf             999--795578748998986058-806701066655-5201023578887653101111223440111112101242025
Q gi|254780206|r   66 VVV--GPELPLVNGISDALNAAG-FKVFGPSQRAAK-LESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIV  141 (424)
Q Consensus        66 viv--gpE~pL~~gi~d~l~~~g-i~v~Gp~~~aa~-le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvV  141 (424)
                      |||  |-..|+  .+|+.|++.| ++++|.|.++.- .|.+..| -++|++.|||+|+|..++|.++|.++++++||||+
T Consensus       652 VIVq~GGQtp~--nlA~~L~~~GG~~iLGTS~~~ID~AEDR~kF-s~~l~~Lgi~QP~~~~a~s~eea~~~A~~iGYPvl  728 (1089)
T TIGR01369       652 VIVQFGGQTPL--NLAKELEEAGGVPILGTSPESIDRAEDREKF-SELLDELGIPQPEWKIATSVEEAKEFASEIGYPVL  728 (1089)
T ss_pred             EEEECCCHHHH--HHHHHHHHCCCCEEECCCHHHHHHHCCHHHH-HHHHHHCCCCCCCCCEECCHHHHHHHHHHCCCCEE
T ss_conf             99974873267--8999999708931736885787513186799-99997158798988527287999999854699289


Q ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CHHHHHHHHHH-CCCCCEEEECCCCCCCCCCCCCCC-CC--CCCCCC
Q ss_conf             63046534300023235677888788751445-31777887752-057523442157763103520001-11--356654
Q gi|254780206|r  142 VKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIEEYLE-GFEVSFFALCDGKTAIPFTTARDH-KR--IHDGDI  216 (424)
Q Consensus       142 VKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-~~~VliEefl~-G~E~Sv~~i~dG~~~~~l~~~~dy-Kr--~~~~d~  216 (424)
                      |+|++.-||++|.|++|.+|+..+++.++.-+ .++|||.+||+ |.|+-|+++|||+++++..+. .| .+  +|.||.
T Consensus       729 vRPSYVLgG~aM~iv~~~eeL~~yl~~a~~~S~~~PVlidky~e~A~E~dVD~v~Dg~~v~i~gI~-EHiE~AGVHSGDs  807 (1089)
T TIGR01369       729 VRPSYVLGGRAMEIVYNEEELARYLEEAVEVSPEHPVLIDKYLEDAVEIDVDAVSDGEEVLIPGIM-EHIEEAGVHSGDS  807 (1089)
T ss_pred             ECCCCCCCCCCHHEECCHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEEEEEEECCEEEEEEHH-HHHHHCCCCCCCH
T ss_conf             816830033621002678899999999997208997698885288889999899728848996231-2342136761305


Q ss_pred             CCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC-CEEEEEEEEEEECCCCCEEEEEC-
Q ss_conf             4444344300001234432220100000899999862046235664454489855-70489998865147751044332-
Q gi|254780206|r  217 GPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE-QGPYLIEYNVRFGDPECQAMMMR-  294 (424)
Q Consensus       217 GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~-~gp~viE~N~R~GDPE~q~ilp~-  294 (424)
                      -       ++.|++.++++..+++ +.+.+..+++|+     ++|++.+||.+++ +.+||||.|+|=.=  |--.+.- 
T Consensus       808 ~-------~~~Pp~~L~~~~~~~i-~~~~~~iA~~L~-----v~Gl~NiQf~~~~E~~~yVIE~NpRASR--tVPFvSKa  872 (1089)
T TIGR01369       808 T-------CVLPPQTLSEDIVKRI-KDIVRKIAKELN-----VKGLFNIQFVVKDEGEVYVIEVNPRASR--TVPFVSKA  872 (1089)
T ss_pred             H-------HCCCCCCCCHHHHHHH-HHHHHHHHHHCC-----CCCCEEEEEEEECCCCEEEEEECCCCCC--CCCCEEEE
T ss_conf             3-------1176977788999999-999999998706-----6072224555616996799997174206--65413210


Q ss_pred             CCCCCHHHHHHHHHCCC
Q ss_conf             65441156665420133
Q gi|254780206|r  295 LESDILEILNSCVHGNL  311 (424)
Q Consensus       295 L~~dl~~il~~~~~g~L  311 (424)
                      +.-||+.+.-+++-|+.
T Consensus       873 ~Gipl~~~A~~~~~G~~  889 (1089)
T TIGR01369       873 TGIPLAKLAVRVMLGKK  889 (1089)
T ss_pred             CCCCHHHHHHHHHHCCC
T ss_conf             37887999999970882


No 12 
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional
Probab=100.00  E-value=5.6e-35  Score=272.77  Aligned_cols=297  Identities=22%  Similarity=0.319  Sum_probs=220.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEE---CCCHHHHHCCEEEECC-CCC---HHHHHHHHHHHCCCEEEECCC--
Q ss_conf             9589988658899999999858996789995---4983575117055128-789---899999998718979999795--
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSI---PGNPGIAQHAQCVAID-IQN---HSAIIHFCQEKHIDLVVVGPE--   71 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~---pgN~g~~~~~~~~~i~-~~d---~~~i~~~a~~~~iDlvivgpE--   71 (424)
                      |||||.|.|+|.+ ++++|+++..-.+|+.+   |.+||+....+.+.+. ..|   .+.++++|++++||+++|+.|  
T Consensus         2 ~nILvt~~G~~~~-ii~~lk~~~~~~~Vi~~D~~~~a~~~~~aD~~y~~P~~~d~~y~~~ll~i~~~~~id~iiP~~d~E   80 (325)
T PRK12767          2 MNILVTSAGRRVQ-LVKALKKSLLGGKVIGADISPLAPALYFADKFYVVPKVTDPNYIDALLDICKKENIDALIPLIDPE   80 (325)
T ss_pred             CEEEEECCCCHHH-HHHHHHHCCCCCEEEEECCCCCCCCHHHCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEECCCHH
T ss_conf             4899986786899-999999769985999968998995344548899878889878999999999987999999778502


Q ss_pred             HHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHH-HHHCCCCEEEEEECCCCCC
Q ss_conf             578748998986058806701066655520102357888765310111122344011111-2101242025630465343
Q gi|254780206|r   72 LPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQ-YVQNKSMPIVVKADGLCAG  150 (424)
Q Consensus        72 ~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~-~~~~~g~PvVVKp~~~agG  150 (424)
                      .++.+...+.|++.|+.+++|+.++.++..||..++++|+++|||+|++..+++.+++.+ +.++++||+||||...+||
T Consensus        81 l~~la~~~~~l~~~gi~v~~~~~e~i~~~~DK~~~~~~l~~~gip~P~t~~~~~~~~~~~~~~~~~~fP~vvKP~~g~gs  160 (325)
T PRK12767         81 LPLLAQHRDEFKEIGVKVLVSSKEVIEICNDKWLTYEFLKENGINTPKSYLPEDLEDLLKALAEELGFPLIVKPRDGSGS  160 (325)
T ss_pred             HHHHHHHHHHHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             66899999999967998956979999985499999999997599989820558999999999865699669853567887


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             00023235677888788751445317778877520575234421577-63103520001113566544444344300001
Q gi|254780206|r  151 KGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGK-TAIPFTTARDHKRIHDGDIGPNTGGMGACSPA  229 (424)
Q Consensus       151 kGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~-~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~  229 (424)
                      +|+.++++.+|+..++..     ...+++||||+|.|+++++++|.+ +++... .+  +|..-      .+|..  ++.
T Consensus       161 ~Gv~~i~~~~el~~~~~~-----~~~~ivqe~i~G~E~tvdv~~d~~g~~~~~~-~~--~r~~~------~~G~~--~~~  224 (325)
T PRK12767        161 IGVFKVNNREELEFLLRY-----NPNLIIQEFIEGQEYTVDVLCDLNGEVISIV-PR--KRIEV------RAGET--SKG  224 (325)
T ss_pred             CCEEEECCHHHHHHHHHH-----CCCEEEEECCCCCEEEEEEEEECCCCEEEEE-EE--EECCC------CCCCC--CCC
T ss_conf             754997999999999974-----8974987034898899999997899999999-98--73364------45786--775


Q ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHC
Q ss_conf             23443222010000089999986204623566445448985570489998865147751044332654411566654201
Q gi|254780206|r  230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHG  309 (424)
Q Consensus       230 ~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g  309 (424)
                      .....   .++ .+..++++++|   +  ++|++.+|+++++++||++|+|+|||--  -.+--.-.-|+.+++.+..-|
T Consensus       225 ~~~~~---~~l-~~~~~~i~~~l---~--~~G~~~vq~~~~~g~~~iiEiNPRf~g~--~~l~~~aG~n~p~~~~~~~lg  293 (325)
T PRK12767        225 VTVKN---PEL-FKLAERIAEKL---G--ARGPLNIQCFVVDGEPYLFEINPRFGGG--YPLRAMAGFNEPDILIRNLLG  293 (325)
T ss_pred             EECCH---HHH-HHHHHHHHHHC---C--CCCEEEEEEEEECCEEEEEEEECCCCCC--HHHHHHHCCCHHHHHHHHHCC
T ss_conf             30579---999-99999999981---9--8545999999989969999997887864--673988398999999999849


Q ss_pred             CCC-CCCCCCCCCCEEE
Q ss_conf             333-3212344442067
Q gi|254780206|r  310 NLH-NTHINWKAEYALT  325 (424)
Q Consensus       310 ~L~-~~~~~~~~~~~v~  325 (424)
                      .-. .....|+++..+-
T Consensus       294 ~~~~~~~~~~~~g~~~~  310 (325)
T PRK12767        294 GENIPIIGEYKEGLYMR  310 (325)
T ss_pred             CCCCCCCCCCCCCEEEE
T ss_conf             99898755435782899


No 13 
>PRK02186 argininosuccinate lyase; Provisional
Probab=100.00  E-value=1.5e-33  Score=262.52  Aligned_cols=372  Identities=16%  Similarity=0.145  Sum_probs=254.5

Q ss_pred             HHHHHHHCCCCCEEEEECCCH----HHHHC-CEEEECCCCCHHHHHHHHHHHC-CCEEEECCCHHHHHHHHHHHHHCCCC
Q ss_conf             999998589967899954983----57511-7055128789899999998718-97999979557874899898605880
Q gi|254780206|r   15 LAWKIAQSPLLSELWSIPGNP----GIAQH-AQCVAIDIQNHSAIIHFCQEKH-IDLVVVGPELPLVNGISDALNAAGFK   88 (424)
Q Consensus        15 l~~~l~~s~~~~~v~~~pgN~----g~~~~-~~~~~i~~~d~~~i~~~a~~~~-iDlvivgpE~pL~~gi~d~l~~~gi~   88 (424)
                      ++-+..+.... +.++.-.+|    +.... .+.+.+|+.|.+++...+.+.. |..|+...|-.+. -.+...+..|+|
T Consensus        18 l~lk~A~~lG~-~pv~LT~dP~rY~~L~~~~~evI~vDT~d~dal~~~v~~~~~IaGV~s~sDyyl~-~AA~LA~~LGLP   95 (892)
T PRK02186         18 LLLRKALLRGF-TPYFLTANRGKYPFLDAIRVVTISADTSDPDRIHRFVSSLDGVAGIMSSSEYFIE-VASEVARRLGLP   95 (892)
T ss_pred             HHHHHHHHCCC-EEEEEECCHHHCHHHHHCCCEEEEECCCCHHHHHHHHHCCCCCCEEEECCHHHHH-HHHHHHHHHCCC
T ss_conf             99999997498-5589836834352467517659993699999999997423685269874054499-999999981989


Q ss_pred             EEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             67010666555201023578887653101111223440111112101242025630465343000232356778887887
Q gi|254780206|r   89 VFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR  168 (424)
Q Consensus        89 v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~  168 (424)
                        ||+.++.+.+.||..+|+.+.++|+|.|.|..+++.+++..++.++|||+||||...+||.||.+|.|.+|+.++...
T Consensus        96 --Gp~peAV~~cRdK~~~Rq~L~~aGVp~P~~~lv~~~~e~~~aAa~IGfPvVVKP~dgSGS~GVrLc~s~aEL~e~~~~  173 (892)
T PRK02186         96 --AANTEAIRTCRDKKRLARTLRDHGIDVPRTHALALDAVALDALDGLTYPVVVKPRMGSGSVGVRLCASVAEAAAHCAA  173 (892)
T ss_pred             --CCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHH
T ss_conf             --989999999871999999999669999956883588789999984799989716888877685876899999999999


Q ss_pred             HHCCCCHHHHHHHHHHCCCCCEEEECC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHH
Q ss_conf             514453177788775205752344215-7763103520001113566544444344300001234432220100000899
Q gi|254780206|r  169 CFQQINSTVIIEEYLEGFEVSFFALCD-GKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILP  247 (424)
Q Consensus       169 ~~~~~~~~VliEefl~G~E~Sv~~i~d-G~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~  247 (424)
                      ..+.....||||||++|+|||++.++. |++.+ +.+++  |++...   |--=-.|...|.| +    .+...++|.+-
T Consensus       174 l~~~r~~~vLVEEFieGpEYSVEt~s~~G~~~V-IGIT~--K~l~~~---P~FVE~GH~fPAp-L----~~~~~~~I~d~  242 (892)
T PRK02186        174 LRRAGTRAALVQAYVEGDEYSVETLTVARGHQV-LGITR--KHLGPP---PHFVEIGHDFPAP-L----SAPQRERIVRT  242 (892)
T ss_pred             HHHCCCCCEEEEECCCCCEEEEEEEEECCCEEE-EEEEE--EECCCC---CEEEEECCCCCCC-C----CHHHHHHHHHH
T ss_conf             971548866999715688789999997796799-99986--533899---7178706767899-9----85899999999


Q ss_pred             HHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEE-CCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEE
Q ss_conf             999862046235664454489855704899988651-4775104433265441156665420133332123444420675
Q gi|254780206|r  248 TIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRF-GDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTV  326 (424)
Q Consensus       248 ~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~-GDPE~q~ilp~L~~dl~~il~~~~~g~L~~~~~~~~~~~~v~V  326 (424)
                      +..+|...|+. +|+-++++++|++||+|||+|.|+ |+.--|.+=.-..-||++++...--|.-..+...-+--.++-.
T Consensus       243 v~raL~AlGl~-~GpAHTEvklT~~GPvVIEINPRLAGGmIP~Lve~A~GvDll~~~~~~~~g~~~~~~~~~~~~~ai~f  321 (892)
T PRK02186        243 VLRALDAVGYA-FGPAHTELRVRGDTVVIIEINPRLAGGMIPVLLEEAFGVDLLDHVIDLHLGVAAFADPTAKRYGAIRF  321 (892)
T ss_pred             HHHHHHHCCCC-CCCCEEEEEEECCCEEEEEECCCCCCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCEEEE
T ss_conf             99999970866-68832899993897389997885446765899988718418999999863877778975001231689


Q ss_pred             EECCCCCCCCCCCCCCCCCCCC--CCCCCEEEEEEEEEECCEEEECC---CCEEEEEEECCCHHHHHHHHHHHHHCCCCC
Q ss_conf             4225446687757976248766--68986899833587788799818---807999996289899999999998525899
Q gi|254780206|r  327 VVATKGYPEEYPHGTIISKIPQ--NTGTTQLFHAGTAIVNNNLTANG---GRVLSATALGKTITESRELAYHMVENIDWK  401 (424)
Q Consensus       327 vlas~GYP~~~~kg~~I~~l~~--~~~~~~ifhagt~~~~g~l~t~G---GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~  401 (424)
                      ++..-+-  .++.   +..++.  +..-..-++-+.+..++.+.-.|   .|+-.|++.|++.+.+-.-+.+.+..+   
T Consensus       322 ~~p~~~~--~~~~---~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~gdf~dr~~~vi~~~~~~~~~~~~~~~~~~~l---  393 (892)
T PRK02186        322 VLPARSG--VLRG---PLALPADRAARPELRHFHPIKQPGDALRLEGDFRDRIAAVVCAGDHRDSVAAAAERAVAGL---  393 (892)
T ss_pred             EECCCCC--CCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHH---
T ss_conf             8456555--2046---6567410136753102466589986424477766543633103788778998888776676---


Q ss_pred             CCEECCHHHHHHH
Q ss_conf             9575351789887
Q gi|254780206|r  402 HGYWREDIGLQKK  414 (424)
Q Consensus       402 g~~yR~DIG~~~~  414 (424)
                          |.||+.+..
T Consensus       394 ----~~~i~~~~~  402 (892)
T PRK02186        394 ----SIDIGDAAR  402 (892)
T ss_pred             ----HHHHCCCCC
T ss_conf             ----443122444


No 14 
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=100.00  E-value=2.9e-32  Score=253.18  Aligned_cols=284  Identities=19%  Similarity=0.347  Sum_probs=222.0

Q ss_pred             EEEEECCC------HHH------HHHHHHHHHCCCCCEEEEECCCHHHHH----CCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865------889------999999985899678999549835751----17055128789899999998718979
Q gi|254780206|r    2 RVLLIGSG------GRE------HALAWKIAQSPLLSELWSIPGNPGIAQ----HAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsG------grE------hAl~~~l~~s~~~~~v~~~pgN~g~~~----~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||+|||||      |-|      || +|+|++...  +..+.+-||.|..    .++..++++...|.++++++.++++.
T Consensus       556 kvliLGsGP~RIGqgiEFDYc~vha-~~aLr~~G~--etImiN~NPETVSTDyD~sDrLYFEPlt~E~V~~I~~~E~p~g  632 (1068)
T PRK12815        556 KVLILGSGPIRIGQGIEFDYMCVHA-AFALKKEGY--ETIMINNNPETVSTDYDTADRLYFEPITLEDILNVAEAENIKG  632 (1068)
T ss_pred             EEEEECCCCCEECCCCCCHHHHHHH-HHHHHHCCC--EEEEECCCCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHCCCE
T ss_conf             4999567871422442400258999-999996897--4899627843123674557735753687999999999858997


Q ss_pred             EEE--CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             999--795578748998986058806701066655520102357888765310111122344011111210124202563
Q gi|254780206|r   66 VVV--GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus        66 viv--gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVK  143 (424)
                      |++  |-..||  .++..|++.|++++|.+.++..+.-|+...+++|.+.|||.|++..++|.++|.++++++|||++|+
T Consensus       633 VivqfGGQt~l--nla~~L~~~gv~IlGts~~~Id~aEdR~~F~~ll~~l~i~~p~~~~~~~~~ea~~~a~~iGyPvlvR  710 (1068)
T PRK12815        633 VIVQFGGQTAI--NLAKPLEEAGLPILGTSPDTIDRLEDRDRFYQLLDELGLPHVPGLTATSEEEALAFAKRIGYPVLIR  710 (1068)
T ss_pred             EEEECCCCCHH--HHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCHHHHHHHHHHCCCCEEEC
T ss_conf             99964882367--9999999769949827868864241399999999973899999635456679999998649977842


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCC-C--CCCCCCCCCCC
Q ss_conf             04653430002323567788878875144531777887752057523442157763103520001-1--13566544444
Q gi|254780206|r  144 ADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDH-K--RIHDGDIGPNT  220 (424)
Q Consensus       144 p~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dy-K--r~~~~d~GpnT  220 (424)
                      |+..-||+++.+++|.+|+..++.++.. ..++|+|++||+|.|+.|++++||+++++..+. +| .  -++.||.    
T Consensus       711 PSyvLgG~~m~iv~~~~eL~~y~~~a~~-~~~pvlIdkfl~g~E~evDai~Dg~~v~I~gIm-EHIE~AGVHSGDS----  784 (1068)
T PRK12815        711 PSYVIGGQGMAVVYDEPALEAYLEENVQ-QLYPILIDQFIDGKEYEVDAISDGEDVTIPGII-EHIEQAGVHSGDS----  784 (1068)
T ss_pred             CCCCCCCCEEEEECCHHHHHHHHHHHCC-CCCCEEEEECCCCCEEEEEEEECCCCEEEEEEE-ECHHHCCCCCCCC----
T ss_conf             4433577423897599999999985157-888556230005404688999649955999964-2113146656885----


Q ss_pred             CCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECC----C
Q ss_conf             344300001234432220100000899999862046235664454489855704899988651477510443326----5
Q gi|254780206|r  221 GGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL----E  296 (424)
Q Consensus       221 GGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L----~  296 (424)
                         -++.|+..++++..+++ +++..+..++|   +  .+|.+.+||.+.++..||||.|.|-+-     -+|.+    .
T Consensus       785 ---~~v~Pp~~Ls~~~~~~i-~~~t~kia~~L---~--v~Gl~NiQfavk~~~vyVIEvNpRASR-----TvPFvSKatG  850 (1068)
T PRK12815        785 ---IAVLPPQSLSPEQQAKI-RDQAIKIAKKL---G--FRGIMNIQFLLAGDEIYVLEVNPRASR-----TVPFVSKATG  850 (1068)
T ss_pred             ---EEEECCCCCCHHHHHHH-HHHHHHHHHHC---E--EECCEEEEEEEECCEEEEEEEECCCCC-----CHHHHHHHCC
T ss_conf             ---48838987899999999-99999999648---3--545126999997998999996187554-----3266787329


Q ss_pred             CCCHHHHHHHHHCC
Q ss_conf             44115666542013
Q gi|254780206|r  297 SDILEILNSCVHGN  310 (424)
Q Consensus       297 ~dl~~il~~~~~g~  310 (424)
                      -||+.+--.++-|+
T Consensus       851 ~pl~~iAtkvmlG~  864 (1068)
T PRK12815        851 VPLAKLATKVLLGK  864 (1068)
T ss_pred             CCHHHHHHHHHCCC
T ss_conf             88999999998499


No 15 
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=100.00  E-value=1.4e-31  Score=248.24  Aligned_cols=286  Identities=20%  Similarity=0.351  Sum_probs=219.1

Q ss_pred             EEEEECCC------HHH------HHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865------889------99999998589967899954983575----117055128789899999998718979
Q gi|254780206|r    2 RVLLIGSG------GRE------HALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsG------grE------hAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||||||||      |-|      || +|+|++...  +..+.+-||.|.    ..++..++++...|.+.++++.++++.
T Consensus       555 kvlvlGsGp~rIGqgiEFDY~~v~a-~~alk~~G~--~~imIN~NPETVSTD~d~sDrLYFEplt~E~V~~I~~~E~p~g  631 (1063)
T PRK05294        555 KVMILGGGPNRIGQGIEFDYCCVHA-ALALREAGY--ETIMVNCNPETVSTDYDTSDRLYFEPLTLEDVLEIIEKEKPKG  631 (1063)
T ss_pred             CEEEECCCCCCCCCCCCCHHHHHHH-HHHHHHCCC--EEEEECCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHCCCE
T ss_conf             3799657773204442300679999-999996598--1589537811111565667614543688999999999758987


Q ss_pred             EEE--CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             999--795578748998986058806701066655520102357888765310111122344011111210124202563
Q gi|254780206|r   66 VVV--GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus        66 viv--gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVK  143 (424)
                      |++  |-..|+  .++..|++.|++++|.+.++..+.-|+...+++|.+.|||+|++..++|.++|+++++++|||++|+
T Consensus       632 vi~qfGGQt~~--nla~~L~~~g~~ilGts~~~Id~aEDR~~F~~~l~~l~i~qp~~~~a~s~~ea~~~a~~iGyPvlvR  709 (1063)
T PRK05294        632 VIVQFGGQTPL--KLAKALEAAGVPILGTSPDAIDLAEDRERFQKLLEKLGIKQPPNGTATSVEEALEIAEEIGYPVLVR  709 (1063)
T ss_pred             EEEECCCCCHH--HHHHHHHHCCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCEECCHHHHHHHHHHCCCCEEEC
T ss_conf             99973883678--9999999879947778878878787588899999865999999707668999999998649866843


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHC-CCCCEEEECCCCCCCCCCCCCCCC--CCCCCCCCCC
Q ss_conf             0465343000232356778887887514-45317778877520-575234421577631035200011--1356654444
Q gi|254780206|r  144 ADGLCAGKGVVVAATVDEATSAIDRCFQ-QINSTVIIEEYLEG-FEVSFFALCDGKTAIPFTTARDHK--RIHDGDIGPN  219 (424)
Q Consensus       144 p~~~agGkGV~i~~~~~e~~~~~~~~~~-~~~~~VliEefl~G-~E~Sv~~i~dG~~~~~l~~~~dyK--r~~~~d~Gpn  219 (424)
                      |+...||+|+.+++|.+|+..++.+++. +..++|||++||+| .|+-+++++||+++++..+.+--.  -++.||.   
T Consensus       710 PSyVLGG~~M~iv~~~~eL~~yl~~a~~vs~~~pvlIdkfl~ga~E~eVDai~Dg~~v~I~gImEHIE~AGVHSGDS---  786 (1063)
T PRK05294        710 PSYVLGGRAMEIVYDEEELERYMREAVKVSPDHPVLIDRFLEDAIEVDVDAICDGEDVLIGGIMEHIEEAGVHSGDS---  786 (1063)
T ss_pred             CCCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEEHHHHHCHHHHHHEEECCCEEEEEEEEEECCCCCCCCCCC---
T ss_conf             43102577147856999999999999863899977863543202454430231488489999872001457566784---


Q ss_pred             CCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECC----
Q ss_conf             4344300001234432220100000899999862046235664454489855704899988651477510443326----
Q gi|254780206|r  220 TGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL----  295 (424)
Q Consensus       220 TGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L----  295 (424)
                          -++.|+-.++++..+++ +++.....++|   +  .+|.+.+||++.++..||||.|.|-.-     -+|.+    
T Consensus       787 ----~~V~Pp~~Ls~~~~~~i-~~~t~~ia~~l---~--v~G~~NiQf~vk~~~vyVIE~NpRaSR-----tvPfvSKat  851 (1063)
T PRK05294        787 ----ACSLPPYTLSEEIIDEI-REQTKKLALEL---N--VVGLMNVQFAVKDDEVYVIEVNPRASR-----TVPFVSKAT  851 (1063)
T ss_pred             ----EEEECCCCCCHHHHHHH-HHHHHHHHHHC---C--CCCCCEEEEEECCCEEEEEEECCCCCC-----CCHHHHHHC
T ss_conf             ----28816855899999999-99999999855---6--666420335540983899994474445-----304457641


Q ss_pred             CCCCHHHHHHHHHCC
Q ss_conf             544115666542013
Q gi|254780206|r  296 ESDILEILNSCVHGN  310 (424)
Q Consensus       296 ~~dl~~il~~~~~g~  310 (424)
                      .-||+.+--.++-|+
T Consensus       852 g~pl~~iAtk~~lG~  866 (1063)
T PRK05294        852 GVPLAKIAARVMLGK  866 (1063)
T ss_pred             CCCHHHHHHHHHCCC
T ss_conf             997999999998299


No 16 
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=99.97  E-value=3.4e-29  Score=231.00  Aligned_cols=381  Identities=18%  Similarity=0.250  Sum_probs=254.6

Q ss_pred             EEEEECCC------HHH------HHHHHHHHHCCCCCEEEEECCCHHHHH----CCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865------889------999999985899678999549835751----17055128789899999998718979
Q gi|254780206|r    2 RVLLIGSG------GRE------HALAWKIAQSPLLSELWSIPGNPGIAQ----HAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsG------grE------hAl~~~l~~s~~~~~v~~~pgN~g~~~----~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||||||||      |-|      || +++|++...  ++.+.+-||.|..    .++.+++.+...+.+.+++++++||.
T Consensus         9 kvLviGsGp~~IGqa~EfDysg~qa-~~al~e~g~--~vilvN~NpaTv~Td~~~ad~vY~ePlt~e~v~~Ii~~E~Pd~   85 (1063)
T PRK05294          9 KILIIGSGPIVIGQACEFDYSGTQA-CKALREEGY--RVVLVNSNPATIMTDPEMADATYIEPITPEFVEKIIEKERPDA   85 (1063)
T ss_pred             EEEEECCCCCHHCCHHHHHHHHHHH-HHHHHHCCC--EEEEECCCCCHHCCCCCCCCEEEECCCCHHHHHHHHHHHCCCE
T ss_conf             8999898825103723326569999-999998699--8999879854410787766437872798999999999759997


Q ss_pred             EEE--CCCHHHHH--HHHH--HHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             999--79557874--8998--98605880670106665552010235788876531011112234401111121012420
Q gi|254780206|r   66 VVV--GPELPLVN--GISD--ALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus        66 viv--gpE~pL~~--gi~d--~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P  139 (424)
                      +++  |...+|..  .+.+  .|++.|++++|.+.++.++.-|+...+++|++.|+|+|++..+++.++|.++++++|||
T Consensus        86 il~~~GGQtaLnla~~L~~~GiL~~~~v~lLGt~~~~I~~aedR~~F~~~l~~i~~p~~~s~~~~s~~ea~~~a~~igyP  165 (1063)
T PRK05294         86 ILPTMGGQTALNLALELAESGVLEKYGVELIGAKLEAIDKAEDRELFKEAMKKIGLPVPRSGIAHTMEEALEVAEEIGYP  165 (1063)
T ss_pred             EEECCCCHHHHHHHHHHHHCCCHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCHHCCCHHHHHHHHHHCCCC
T ss_conf             88667780599999999975967764972756999999977789999999997699999725309999999999865998


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHCC-CCCEEEECCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             2563046534300023235677888788751445-3177788775205-752344215776-310352000111356654
Q gi|254780206|r  140 IVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIEEYLEGF-EVSFFALCDGKT-AIPFTTARDHKRIHDGDI  216 (424)
Q Consensus       140 vVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-~~~VliEefl~G~-E~Sv~~i~dG~~-~~~l~~~~dyKr~~~~d~  216 (424)
                      ++|+|+...||+|..+++|.+|+.+++..+|..+ .++|+||++|.|. |+.++++.|++. .+......+..     ..
T Consensus       166 vivRps~~LGG~g~~i~~n~~eL~~~~~~~~~~S~~~qvLie~sl~gwkEie~ev~rD~~~n~i~v~~mEnid-----p~  240 (1063)
T PRK05294        166 VIIRPSFTLGGTGGGIAYNREELEEIVERGLDLSPTTEVLIEESLLGWKEYEMEVMRDKADNCIIVCSIENID-----PM  240 (1063)
T ss_pred             EEEEECCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCCEEEEHHCCCCEEEEEEEEEECCCCEEEEEEECCCC-----CC
T ss_conf             8998442167876404349999999999999619998689661117988999999981899989995411354-----56


Q ss_pred             CCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC--CEEEEEEEEEEECCCCCEEEEEC
Q ss_conf             4444344300001234432220100000899999862046235664454489855--70489998865147751044332
Q gi|254780206|r  217 GPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE--QGPYLIEYNVRFGDPECQAMMMR  294 (424)
Q Consensus       217 GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~--~gp~viE~N~R~GDPE~q~ilp~  294 (424)
                      |-+||-=-+++|+-.++++..+++ +....+++++|   |+- +|.+.+||-+..  +.-||||+|+|+.--  -++...
T Consensus       241 GIHtGDSi~vaP~qTL~d~e~q~l-R~~a~kI~~~L---~iv-~G~~NiQfA~~p~~~~~~VIEvNPR~SRs--salaSK  313 (1063)
T PRK05294        241 GVHTGDSITVAPAQTLTDKEYQML-RDASIAILREI---GVE-TGGSNVQFAVNPKDGRYVVIEMNPRVSRS--SALASK  313 (1063)
T ss_pred             CCCCCCCCEECCCCCCCHHHHHHH-HHHHHHHHHHC---CCC-CCCEEEEEEECCCCCCEEEEECCCCCCCC--HHHHHH
T ss_conf             456667253568865898999999-99999999982---957-36447999874899848999637750010--688888


Q ss_pred             CCC-CCHHHHHHHHHCC-CCCCCCCCCCCCEEEEEECCCCCCC-CCC-CCCCCCCCCCCCCCCEEEEEEEEEECCEEEEC
Q ss_conf             654-4115666542013-3332123444420675422544668-775-79762487666898689983358778879981
Q gi|254780206|r  295 LES-DILEILNSCVHGN-LHNTHINWKAEYALTVVVATKGYPE-EYP-HGTIISKIPQNTGTTQLFHAGTAIVNNNLTAN  370 (424)
Q Consensus       295 L~~-dl~~il~~~~~g~-L~~~~~~~~~~~~v~Vvlas~GYP~-~~~-kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~  370 (424)
                      -.. ++..+.-.++-|. |+++.-......+     |+-- |. .|. .-.+.+.+++-....  .+=||     ...+ 
T Consensus       314 aTGyPiA~vaaklalG~~L~ei~n~vT~~t~-----A~fE-P~ldyv~vK~p~~~f~kf~~~~--~~Lg~-----~mks-  379 (1063)
T PRK05294        314 ATGYPIAKVAAKLAVGYTLDEIKNDITGKTP-----ASFE-PSIDYVVTKIPRFAFEKFPGAD--RRLTT-----QMKS-  379 (1063)
T ss_pred             HHCCCHHHHHHHHHHCCCHHHHCCCCCCCCC-----CCCC-CCCCEEEEEECCCCCCCCCCCC--HHHCC-----CCCC-
T ss_conf             7388789999998717975783676446631-----4447-7566599970477710035854--43243-----0113-


Q ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHHHHHH
Q ss_conf             880799999628989999999999852589995753517898875
Q gi|254780206|r  371 GGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE  415 (424)
Q Consensus       371 GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~~~~~  415 (424)
                         +-.|.+.|.|+++|..+|.+.++ +.+.+...........+.
T Consensus       380 ---~Gevm~igr~feea~~KAirSle-~~~~gl~~~~~~~~eel~  420 (1063)
T PRK05294        380 ---VGEVMAIGRTFEESLQKALRSLE-IGLTGLDEKEDLALEEIR  420 (1063)
T ss_pred             ---CCHHHHHCCHHHHHHHHHHHHHC-CCCCCCCCCCCCCHHHHH
T ss_conf             ---41022222328999999998442-586677777778999999


No 17 
>PRK07206 hypothetical protein; Provisional
Probab=99.97  E-value=8.9e-30  Score=235.19  Aligned_cols=373  Identities=19%  Similarity=0.226  Sum_probs=231.7

Q ss_pred             HHHHHHHHHHHHCCC-CCEEEEECCCHHHHHC--CEE---EECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHH
Q ss_conf             889999999985899-6789995498357511--705---5128789899999998718979999795578748998986
Q gi|254780206|r   10 GREHALAWKIAQSPL-LSELWSIPGNPGIAQH--AQC---VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALN   83 (424)
Q Consensus        10 grEhAl~~~l~~s~~-~~~v~~~pgN~g~~~~--~~~---~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~   83 (424)
                      |+-  |+.++++-.. +-.|+..+.-|.+...  ...   ......|.+++++..++.+|+.||+|.|.-.  -++|.|.
T Consensus        14 G~~--la~a~~~~G~~~v~V~S~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~aVi~g~E~gV--~lAd~La   89 (415)
T PRK07206         14 GKF--LAPAFKKRGIELIAVTSACDLDPLYYAGFDENIYRQQRIIKHIDETIEFLRQLGPDAVIAGAESGV--ELADRLA   89 (415)
T ss_pred             HHH--HHHHHHHCCCEEEEEEECCCCCHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCEEEECCHHHH--HHHHHHH
T ss_conf             879--999999739828999837988435442324343433210578999999998629729997855659--9999999


Q ss_pred             H-CCCCE-EECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHC---CCCEEEEEECCCCCCCCCCCHHH
Q ss_conf             0-58806-7010666555201023578887653101111223440111112101---24202563046534300023235
Q gi|254780206|r   84 A-AGFKV-FGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQN---KSMPIVVKADGLCAGKGVVVAAT  158 (424)
Q Consensus        84 ~-~gi~v-~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~---~g~PvVVKp~~~agGkGV~i~~~  158 (424)
                      + .|+|. -+|....++  +||..||+.++++|||+|++..+++.+|+..++++   ++||+||||...+|+.||++|.|
T Consensus        90 ~~LgLp~~N~~~~~~aR--RdK~~m~~~L~~aGl~~~~~~~~~~~~e~~~~~~~~~~~~~PvVvKP~~gagS~gV~~c~~  167 (415)
T PRK07206         90 ERLGLCYANAPALSSAR--RNKYEMINALANAGLPAIRQIDTADWEEASAWIRVNNLWDSPVVIKPLESAGSDGVFFCPD  167 (415)
T ss_pred             HHHCCCCCCCHHHHHHH--CCHHHHHHHHHHCCCCCCCEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCEEEECC
T ss_conf             98689989955688774--5999999999975998553885299999999998605579998995899998799899799


Q ss_pred             HHHHHHHHHHHHCC------CCHHHHHHHHHHCCCCCEEEE-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCC
Q ss_conf             67788878875144------531777887752057523442-15776310352000111356654444434430000123
Q gi|254780206|r  159 VDEATSAIDRCFQQ------INSTVIIEEYLEGFEVSFFAL-CDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG  231 (424)
Q Consensus       159 ~~e~~~~~~~~~~~------~~~~VliEefl~G~E~Sv~~i-~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~  231 (424)
                      .+|+.++++.+.+.      .+..+|+||||+|+|+||.++ .||++++.- ..+-+|...+  .++..-......|   
T Consensus       168 ~~el~~a~~~i~~~~n~~g~~~~~vLveEyl~G~EysVe~vs~~G~h~v~~-i~~y~k~~~~--~~~~~~~~~~~~p---  241 (415)
T PRK07206        168 KQDAYHAFNAILGKANKLGLVNESVLVQEFLIGTEYVVNTVSINGNHLVTE-IVRYHKTSLN--RGSVVYDYDELLP---  241 (415)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCEEEEEEEEECCCEEEEE-EEEECCCCCC--CCCEEEECCEECC---
T ss_conf             999999999985665435786753887541468578999998789689999-9997255689--9865653203569---


Q ss_pred             CCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEE-CCCCCEEEEECCCCCCHHHHHHHHHCC
Q ss_conf             4432220100000899999862046235664454489855704899988651-477510443326544115666542013
Q gi|254780206|r  232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRF-GDPECQAMMMRLESDILEILNSCVHGN  310 (424)
Q Consensus       232 ~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~-GDPE~q~ilp~L~~dl~~il~~~~~g~  310 (424)
                        .  .....+++++-+.+++++.|+.+ |+.|+++|+|++||++||+|+|+ |++-.+.+-.....|.+++...+.-+.
T Consensus       242 --~--~~~~~~~l~~y~~~~l~ALGi~~-G~~H~Ev~lt~~gp~liE~~~R~~G~~~~~~~~~~~g~~~~~~~v~~~l~~  316 (415)
T PRK07206        242 --C--TSPEYQELVDYTKKALDALGIKN-GPAHAEIMLTSDGPVLIETGARLDGGLHPDAARVATGFSQLDLTAQSLADP  316 (415)
T ss_pred             --C--CHHHHHHHHHHHHHHHHHHCCCC-CCCEEEEEECCCCCEEEEECCCCCCCCCHHHHHHCCCCCHHHHHHHHHCCC
T ss_conf             --9--84899999999999999838775-772189998289828999678778986478998705879999999985093


Q ss_pred             --CCCCCCCCC-CCCEEEEEECCC--CCCCCCCCCCCCCCCCCCCCCCEEEE-EEEEEE-CCEEEECCCCEEEEEEECCC
Q ss_conf             --333212344-442067542254--46687757976248766689868998-335877-88799818807999996289
Q gi|254780206|r  311 --LHNTHINWK-AEYALTVVVATK--GYPEEYPHGTIISKIPQNTGTTQLFH-AGTAIV-NNNLTANGGRVLSATALGKT  383 (424)
Q Consensus       311 --L~~~~~~~~-~~~~v~Vvlas~--GYP~~~~kg~~I~~l~~~~~~~~ifh-agt~~~-~g~l~t~GGRVL~vv~~g~~  383 (424)
                        ........+ +.++++|.|.|.  |-=....--..|..++.- .+..++. .|-... --.+.|.-|.|   .=..++
T Consensus       317 ~~~~~~~~~y~~~~~~~~v~Lis~~~G~l~~~~gl~~i~~Lpsf-~~~~~~~~~G~~v~~T~Dl~s~pG~v---~L~~~d  392 (415)
T PRK07206        317 DRFRETRESYKLQAHSLNVFLISQAAGVISGKHFLRELQKLPSF-KKSVYYVNEGDNVKVTVDLFSQPGIV---YLVHSD  392 (415)
T ss_pred             HHCCCCCCCCCCCCEEEEEEEECCCCCEEECCHHHHHHHHCCCE-EEEEEECCCCCCCCCCCCCCCCCEEE---EEECCC
T ss_conf             11046788766443489999853999358577269999838875-37999669979808876678998799---997699


Q ss_pred             HHHHHHHHHHHHHCCCCCCCE
Q ss_conf             899999999998525899957
Q gi|254780206|r  384 ITESRELAYHMVENIDWKHGY  404 (424)
Q Consensus       384 l~eA~~~ay~~i~~I~~~g~~  404 (424)
                       .+..++-|+.+..++-+|.|
T Consensus       393 -~~~l~~D~~~iR~le~~g~~  412 (415)
T PRK07206        393 -KEQLEQDYRKIRKMESDGFF  412 (415)
T ss_pred             -HHHHHHHHHHHHHHHHCCCE
T ss_conf             -99999999999998645865


No 18 
>pfam02844 GARS_N Phosphoribosylglycinamide synthetase, N domain. Phosphoribosylglycinamide synthetase catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by Phosphoribosylglycinamide synthetase is the ATP- dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide. This domain is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (see pfam00289).
Probab=99.97  E-value=1.9e-30  Score=240.09  Aligned_cols=99  Identities=63%  Similarity=1.026  Sum_probs=97.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHH
Q ss_conf             58998865889999999985899678999549835751170551287898999999987189799997955787489989
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDA   81 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~   81 (424)
                      ||||||||||||||+|+|++|+.+.++||+||||||+.+++++.++.+|++.+++||++++||+||||||+||++|++|.
T Consensus         1 kILvIGsGgREHAi~~~l~~s~~~~~l~~~pgN~gi~~~~~~~~i~~~d~~~i~~~~~~~~idlviiGPE~pL~~Gl~D~   80 (99)
T pfam02844         1 KVLVVGSGGREHALAWKLAQSPRVEKVYVAPGNPGTAQLAKNVNIDITDFEALADFAKEENIDLVVVGPEAPLVAGIVDA   80 (99)
T ss_pred             CEEEECCCHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHCEEECCCCCCHHHHHHHHHHCCCCEEEECCCHHHHHHHHHH
T ss_conf             98998788799999999964999776999589815777475014584479999999998197499989606778788999


Q ss_pred             HHHCCCCEEECCHHHHHHH
Q ss_conf             8605880670106665552
Q gi|254780206|r   82 LNAAGFKVFGPSQRAAKLE  100 (424)
Q Consensus        82 l~~~gi~v~Gp~~~aa~le  100 (424)
                      |++.||+||||++++||||
T Consensus        81 l~~~gi~vfGP~k~aA~LE   99 (99)
T pfam02844        81 LRAAGIPVFGPSKAAARLE   99 (99)
T ss_pred             HHHCCCEEECCCHHHHHCC
T ss_conf             9868991799286887367


No 19 
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism]
Probab=99.97  E-value=5.7e-28  Score=222.14  Aligned_cols=360  Identities=23%  Similarity=0.354  Sum_probs=253.4

Q ss_pred             EEEEECCC--HHHHHHHHHHHHCCCCCEEEEEC---CCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             58998865--88999999998589967899954---98357511705512878989999999871897999979557874
Q gi|254780206|r    2 RVLLIGSG--GREHALAWKIAQSPLLSELWSIP---GNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         2 kILviGsG--grEhAl~~~l~~s~~~~~v~~~p---gN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      |||++|||  |+|-||.  +++-. + +|+...   +-|.|.-....+.||+.|.+++...++++++|++|+--|+--.+
T Consensus        14 kvmLLGSGELGKEvaIe--~QRLG-~-eVIAVDrY~~APAmqVAhrs~Vi~MlD~~al~avv~re~Pd~IVpEiEAI~td   89 (394)
T COG0027          14 KVMLLGSGELGKEVAIE--AQRLG-V-EVIAVDRYANAPAMQVAHRSYVIDMLDGDALRAVVEREKPDYIVPEIEAIATD   89 (394)
T ss_pred             EEEEECCCCCCHHHHHH--HHHCC-C-EEEEECCCCCCHHHHHHHHEEEEECCCHHHHHHHHHHHCCCEEEEHHHHHHHH
T ss_conf             89996388644699998--88638-7-79996376898066421111345456999999999865898133135666478


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHH-HHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCC
Q ss_conf             8998986058806701066655520102357888-765310111122344011111210124202563046534300023
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC-TKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVV  155 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l-~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i  155 (424)
                      .+ ..|++.|+.|+ |+++|+++..++.--|++. ++.|+||++|..+++.++..+.++++||||||||..+++|||.++
T Consensus        90 ~L-~elE~~G~~VV-P~ArAt~ltMnRegiRrlAAeeLglpTs~Y~fa~s~~e~~~a~~~iGfPcvvKPvMSSSGkGqsv  167 (394)
T COG0027          90 AL-VELEEEGYTVV-PNARATKLTMNREGIRRLAAEELGLPTSKYRFADSLEELRAAVEKIGFPCVVKPVMSSSGKGQSV  167 (394)
T ss_pred             HH-HHHHHCCCEEC-CCHHHHHHHHCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCEECCCCCCCCCCCCEE
T ss_conf             89-99986796675-53277773426898999889972999766321355999999999749970213320268898214


Q ss_pred             HHHHHHHHHHHHHHHCC---CCHHHHHHHHHHC-CCCCEEEEC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECC
Q ss_conf             23567788878875144---5317778877520-575234421--57763103520001113566544444344300001
Q gi|254780206|r  156 AATVDEATSAIDRCFQQ---INSTVIIEEYLEG-FEVSFFALC--DGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA  229 (424)
Q Consensus       156 ~~~~~e~~~~~~~~~~~---~~~~VliEefl~G-~E~Sv~~i~--dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~  229 (424)
                      +.+.++..++++++...   .+.+|++|+|++- .|+++..++  ||.+..+-|+-  | |--|+|-      --+|.|.
T Consensus       168 v~~~e~ve~AW~~A~~g~R~~~~RVIVE~fv~fd~EITlLtvr~~~~~~~Fc~PIG--H-rq~dgdY------~ESWQP~  238 (394)
T COG0027         168 VRSPEDVEKAWEYAQQGGRGGSGRVIVEEFVKFDFEITLLTVRAVDGTGSFCAPIG--H-RQEDGDY------RESWQPQ  238 (394)
T ss_pred             ECCHHHHHHHHHHHHHCCCCCCCCEEEEEEECCEEEEEEEEEEEECCCCCCCCCCC--C-CCCCCCH------HCCCCCC
T ss_conf             35987889999999754788887189998732327999999997558877677766--4-0578870------1036841


Q ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHH--HHHHHH
Q ss_conf             234432220100000899999862046235664454489855704899988651477510443326544115--666542
Q gi|254780206|r  230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILE--ILNSCV  307 (424)
Q Consensus       230 ~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~--il~~~~  307 (424)
                      . +++...++. +.|-+.+.++|-     -+|++.++++++.+..+.=|+..|.-|--.-++   +..||-+  +-..++
T Consensus       239 ~-mS~~al~~A-~~IA~~vt~aLG-----G~GlFGVElfv~gDeV~FsEVSPRPHDTGmVTL---iSq~lsEF~LH~RAi  308 (394)
T COG0027         239 E-MSEAALEEA-QSIAKRVTDALG-----GRGLFGVELFVKGDEVIFSEVSPRPHDTGMVTL---ISQDLSEFALHVRAI  308 (394)
T ss_pred             C-CCHHHHHHH-HHHHHHHHHHHC-----CCCCEEEEEEEECCEEEEEECCCCCCCCCEEEE---EECCCHHHHHHHHHH
T ss_conf             0-389999999-999999998605-----863036899972887898525789888724999---706531899999999


Q ss_pred             HCCCCCCCCC-CCCCCEEEEEECCCCCCCCCCCCCCCCCCCCC----CCCCEEEEEEEEEECCEEEECCCCEEEE-EEEC
Q ss_conf             0133332123-44442067542254466877579762487666----8986899833587788799818807999-9962
Q gi|254780206|r  308 HGNLHNTHIN-WKAEYALTVVVATKGYPEEYPHGTIISKIPQN----TGTTQLFHAGTAIVNNNLTANGGRVLSA-TALG  381 (424)
Q Consensus       308 ~g~L~~~~~~-~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~----~~~~~ifhagt~~~~g~l~t~GGRVL~v-v~~g  381 (424)
                      -|= .-..++ ..+.+|. |.++..     ...+....++.+.    ..+..+|        |+-.+.|+|-|.| .+.+
T Consensus       309 LGL-Pi~~i~~~~P~AS~-vI~~~~-----~~~~~~f~~l~~AL~~p~t~vRlF--------GKP~~~~~RRmGVaLA~a  373 (394)
T COG0027         309 LGL-PIPEIRQISPAASA-VILAQE-----TSQAPTFDGLAEALGVPDTQVRLF--------GKPEADGGRRLGVALATA  373 (394)
T ss_pred             HCC-CCCCEEEECCCCCC-EEECCC-----CCCCCCHHHHHHHHCCCCCEEEEE--------CCCCCCCCCEEEEEEECC
T ss_conf             589-76421452543001-560333-----346775222888745898617980--------687566675046898427


Q ss_pred             CCHHHHHHHHHHHHHCCCCC
Q ss_conf             89899999999998525899
Q gi|254780206|r  382 KTITESRELAYHMVENIDWK  401 (424)
Q Consensus       382 ~~l~eA~~~ay~~i~~I~~~  401 (424)
                      ++.++|+++|-+...+|+.+
T Consensus       374 ~~Ve~Are~A~~aa~~i~v~  393 (394)
T COG0027         374 ESVEEARERARKAASAIEVK  393 (394)
T ss_pred             CCHHHHHHHHHHHHHHEECC
T ss_conf             61999999999887605568


No 20 
>COG0439 AccC Biotin carboxylase [Lipid metabolism]
Probab=99.97  E-value=3.1e-27  Score=216.84  Aligned_cols=388  Identities=19%  Similarity=0.222  Sum_probs=257.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCC-EEEEECCCHH--HHHCCEEEECC-------CCCHHHHHHHHHHHCCCEEEECC
Q ss_conf             95899886588999999998589967-8999549835--75117055128-------78989999999871897999979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLS-ELWSIPGNPG--IAQHAQCVAID-------IQNHSAIIHFCQEKHIDLVVVGP   70 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~-~v~~~pgN~g--~~~~~~~~~i~-------~~d~~~i~~~a~~~~iDlvivgp   70 (424)
                      +||||...|.+.--+..++++-.... .||--+.+..  .....+.+.+.       ..|.+.++..|++...|.+++|.
T Consensus         3 ~kiLIanrGeia~ri~ra~~~lGi~tvav~s~~d~~~~~~~~adeav~i~~~~~~~syl~i~~ii~~a~~~gadai~pGy   82 (449)
T COG0439           3 KKILIANRGEIAVRIIRACRELGIETVAVYSEADADALHVALADEAVCIGPAPSADSYLNIDAIIAAAEETGADAIHPGY   82 (449)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHHCCEEEECCCCCCHHHHHHHHHHHHHHHHCCCCEECCCC
T ss_conf             36999558536899999999849858999661002252566375679838865034565188899899860876672350


Q ss_pred             CHHH--HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCC--CCCCHHHHHHHHCCCCEEEEEECC
Q ss_conf             5578--748998986058806701066655520102357888765310111122--344011111210124202563046
Q gi|254780206|r   71 ELPL--VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQH--FSDPMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus        71 E~pL--~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~--~~~~~ea~~~~~~~g~PvVVKp~~  146 (424)
                      . .|  .+.+++.+++.|+..+||+.++.+..+||.-||++|+++|+|++++..  ..+.+++.+.++++||||+|||..
T Consensus        83 g-flsen~~fae~~~~~gl~fiGP~~~~i~~mgdK~~ar~~~~~aGVP~vpgs~~~~~~~ee~~~~a~~iGyPVivKa~~  161 (449)
T COG0439          83 G-FLSENAAFAEACAEAGLTFIGPSAEAIRRMGDKITARRLMAKAGVPVVPGSDGAVADNEEALAIAEEIGYPVIVKAAA  161 (449)
T ss_pred             H-HHHCCHHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECC
T ss_conf             3-421788999999974975108498999974458999999997499958997877688899999998719978999778


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCCCC-CEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             534300023235677888788751445-----317778877520575-23442157763103520001113566544444
Q gi|254780206|r  147 LCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGFEV-SFFALCDGKTAIPFTTARDHKRIHDGDIGPNT  220 (424)
Q Consensus       147 ~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~E~-Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnT  220 (424)
                      ..||+||++|++.+|+.+++..+.+..     +..|++|||+++++. .++++.||...++-...+|- .+     ....
T Consensus       162 GgGg~G~r~v~~~~el~~a~~~~~~ea~~~fg~~~v~iEk~i~~~rhievqv~gD~~g~~i~l~eRdc-si-----qrr~  235 (449)
T COG0439         162 GGGGRGMRVVRNEEELEAAFEAARGEAEAAFGNPRVYLEKFIEGPRHIEVQVLGDGHGNVIHLGERDC-SI-----QRRH  235 (449)
T ss_pred             CCCCCCEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEECCCCCEEEEEECCC-CC-----CCCC
T ss_conf             89965479979999999999999988887558972786341058846899998768665899986466-87-----6776


Q ss_pred             CCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC-CEEEEEEEEEEECCCCCEEEEECCCCCC
Q ss_conf             344300001234432220100000899999862046235664454489855-7048999886514775104433265441
Q gi|254780206|r  221 GGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE-QGPYLIEYNVRFGDPECQAMMMRLESDI  299 (424)
Q Consensus       221 GGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~-~gp~viE~N~R~GDPE~q~ilp~L~~dl  299 (424)
                      +-++--+|+|.++++    ..+.+.+..+++.+..|  |+|.-.++|+++. .++|+||.|+|++ -|--+.-....-||
T Consensus       236 qkvieeapsp~~~~e----~r~~i~~~a~~a~~~~g--Y~gagtvEfl~~~~~~~yfiEmN~Rlq-veh~vte~vtGiDl  308 (449)
T COG0439         236 QKVIEEAPSPLLTEE----LREKIGEAAVRAAKLIG--YRGAGTVEFLYDSNGEFYFIEMNTRLQ-VEHPVTEMVTGIDL  308 (449)
T ss_pred             CCEEEECCCCCCCHH----HHHHHHHHHHHHHHHCC--CCCCCEEEEEEECCCCEEEEEEECCCC-CCCCCEEEEHHHHH
T ss_conf             615530588889999----99999999999998638--777756999982799879999864113-67630100000428


Q ss_pred             HHHHHHHHHCCCCC---CCCCCCCCCEEEEEECCCCCCCCCCCC-----CCCCCCCCCCCCCEEEEEEEEEECC---EEE
Q ss_conf             15666542013333---212344442067542254466877579-----7624876668986899833587788---799
Q gi|254780206|r  300 LEILNSCVHGNLHN---THINWKAEYALTVVVATKGYPEEYPHG-----TIISKIPQNTGTTQLFHAGTAIVNN---NLT  368 (424)
Q Consensus       300 ~~il~~~~~g~L~~---~~~~~~~~~~v~Vvlas~GYP~~~~kg-----~~I~~l~~~~~~~~ifhagt~~~~g---~l~  368 (424)
                      +..++.++.|+--.   .++.++     +..+...-|=....++     -.|....-.......++++.. .+.   ..|
T Consensus       309 v~~qi~ia~ge~l~~~q~~~~~~-----g~aie~Ri~aedp~~~f~pspG~i~~~~~P~g~gvr~d~~~~-~~~~i~~~y  382 (449)
T COG0439         309 VKEQIRIAAGEPLSLKQEDIKFR-----GHAIECRINAEDPLGNFLPSPGKITRYAPPGGPGVRVDSGVY-DGYRVPPYY  382 (449)
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCC-----CEEEECEEECCCCCCCCCCCCCEEEEECCCCCCCEEEEEECC-CCCCCCCCH
T ss_conf             99999997699888777775613-----313100010568887857899765014079988668873213-585248641


Q ss_pred             ECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHHH
Q ss_conf             81880799999628989999999999852589995753517898
Q gi|254780206|r  369 ANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ  412 (424)
Q Consensus       369 t~GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~~  412 (424)
                        -+.+..+++.|.+.++|..+.++.+....-+|  +++-+-+.
T Consensus       383 --ds~i~k~i~~~~~r~~ai~~~~~aL~e~~i~G--~~t~~~~~  422 (449)
T COG0439         383 --DSMIGKVIVHGRTRDEAIARMRRALDELVIDG--IKTNIPLL  422 (449)
T ss_pred             --HHHEEEEEEECCCHHHHHHHHHHHHHHEEECC--CCCCHHHH
T ss_conf             --40136899964886999999998787627448--65786999


No 21 
>PRK08462 biotin carboxylase; Validated
Probab=99.96  E-value=1.8e-27  Score=218.52  Aligned_cols=379  Identities=16%  Similarity=0.215  Sum_probs=254.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC--C-CHHHHHC-CEEEEC-------CCCCHHHHHHHHHHHCCCEEEEC-
Q ss_conf             5899886588999999998589967899954--9-8357511-705512-------87898999999987189799997-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP--G-NPGIAQH-AQCVAI-------DIQNHSAIIHFCQEKHIDLVVVG-   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p--g-N~g~~~~-~~~~~i-------~~~d~~~i~~~a~~~~iDlvivg-   69 (424)
                      ||||...|--.-=++.++++.. +..|.+..  + +...... .+.+.+       +..|.+.|++.|++.+.|.+.|| 
T Consensus         6 kvLIANRGEIA~Ri~ra~~elg-i~tVavys~~D~~a~~v~~ad~~~~ig~~~~~~sYln~~~Ii~~a~~~~~dAihPGy   84 (446)
T PRK08462          6 RILIANRGEIALRAIRTIQEMG-KEAIAIYSTADKDALYLKYADAKICIGGAKSSESYLNIPAIISAAEIFEADAIFPGY   84 (446)
T ss_pred             EEEEECCHHHHHHHHHHHHHCC-CCEEEEECHHHHCCCHHHHCCEEEECCCCCCCCCCCCHHHHHHHHHHHCCCEEECCC
T ss_conf             8999896099999999999829-969999376771676287598989828998433414899999999995919898682


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEEE
Q ss_conf             ---9557874899898605880670106665552010235788876531011112--23440111112101242025630
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVKp  144 (424)
                         +|.+   .++..++++|+..+||+.++.+..+||..+|++|.++|+|+.++.  .+++.+++.++++++|||++|||
T Consensus        85 GfLSEn~---~fa~~~~~~Gi~fIGP~~~~i~~~GdK~~ar~~a~~~gvPvvpg~~~~v~~~~ea~~~a~~iGyPV~lKa  161 (446)
T PRK08462         85 GFLSENQ---NFVEICSHHSIKFIGPSVEVMALMSDKSKAKQVMKRAGVPVIPGSDGALKSYEEAKKIAKEIGYPVILKA  161 (446)
T ss_pred             HHHHHCH---HHHHHHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEE
T ss_conf             0554087---9999999779989895999999840959899999985998067867877999999999997299568763


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCC----CCCC-CCCCC
Q ss_conf             46534300023235677888788751445-----3177788775205-75234421577-631035----2000-11135
Q gi|254780206|r  145 DGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFT----TARD-HKRIH  212 (424)
Q Consensus       145 ~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~----~~~d-yKr~~  212 (424)
                      +...||||+.++++.+|+.++++.+..++     +..|+||+||.++ ++-++++.|+. +++.+.    ..|. |.++-
T Consensus       162 s~GGGGrGmriv~~~~el~~~~~~a~~ea~~~fg~~~v~vEk~i~~~rHIEvQvl~D~~Gn~ihl~eRdCSiQRr~QKvi  241 (446)
T PRK08462        162 AAGGGGRGMRVVEDESDLENLYLAAESEALSAFGDGTMYMEKFINNPRHIEVQILGDKHGNVIHVGERDCSMQRRHQKLI  241 (446)
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCEEEEEEEEECCCCCEEEEECCCCCCCCCCCCEE
T ss_conf             27899874289576799999999998778860588866999850355078999885289988885321236634678758


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE--EEEEEEEEEE--CCCCC
Q ss_conf             6654444434430000123443222010000089999986204623566445448985570--4899988651--47751
Q gi|254780206|r  213 DGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRF--GDPEC  288 (424)
Q Consensus       213 ~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g--p~viE~N~R~--GDPE~  288 (424)
                      |            .+|+|.+++++.+++.    +.+++..+.  +.|.|.--++|+++.++  -|+||+|+|+  --|=|
T Consensus       242 E------------eaPa~~l~~~~r~~m~----~~A~~la~~--vgY~gaGTvEFl~d~~~~~fyFlE~NtRlQVEH~VT  303 (446)
T PRK08462        242 E------------ESPAVVLDEKTRERLL----ETAIKAAKA--IGYVGAGTFEFLLDSNMKDFYFMEMNTRLQVEHTVS  303 (446)
T ss_pred             E------------ECCCCCCCHHHHHHHH----HHHHHHHHH--CCCCCCCEEEEEECCCCCEEEEEEEECCCCEECCCC
T ss_conf             9------------7899989989999988----899999986--483654338999807997189997433421001111


Q ss_pred             EEEEECCCCCCHHHHHHHHHCC-C-CCCCCCCCCCCEEEEEECCCCCCCCCC--CCCCCCCCCCCCCCCEEEEEEEEEEC
Q ss_conf             0443326544115666542013-3-332123444420675422544668775--79762487666898689983358778
Q gi|254780206|r  289 QAMMMRLESDILEILNSCVHGN-L-HNTHINWKAEYALTVVVATKGYPEEYP--HGTIISKIPQNTGTTQLFHAGTAIVN  364 (424)
Q Consensus       289 q~ilp~L~~dl~~il~~~~~g~-L-~~~~~~~~~~~~v~Vvlas~GYP~~~~--kg~~I~~l~~~~~~~~ifhagt~~~~  364 (424)
                      ..+   -.-||+..-+.++.|. | +..++.+ .++++-+=+.+.. |.++.  .| .|..+....+...-+..++  ..
T Consensus       304 E~v---tGiDLV~~Qi~iA~G~~l~~q~~i~~-~GhaIe~Ri~AEd-p~~F~Ps~G-~i~~~~~P~g~gvRvDt~~--~~  375 (446)
T PRK08462        304 EMV---SGLDLIEWMIKIAEGEELPSQESIKL-KGHAIECRITAED-PKKFYPSPG-KITKWIAPGGRNVRMDSHA--YA  375 (446)
T ss_pred             CCC---CCCCHHHHHHHHHCCCCCCCCCCCCC-CCEEEEEEEECCC-CCCCCCCCE-EEEEEECCCCCCEEEECCC--CC
T ss_conf             221---48779999999867999875666672-6434223420458-776799875-8878987999998963887--78


Q ss_pred             CEEEEC--CCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHHH
Q ss_conf             879981--880799999628989999999999852589995753517898
Q gi|254780206|r  365 NNLTAN--GGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ  412 (424)
Q Consensus       365 g~l~t~--GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~~  412 (424)
                      |..++.  -+=+.-+++.|.|.++|..+..+.++.....|.  .+.|.+-
T Consensus       376 G~~v~~~yDsmlaKlI~~g~~R~~Ai~rl~~aL~e~~I~Gv--~Tni~~l  423 (446)
T PRK08462        376 GYVVPPYYDSMIGKLIVWGEDRNRAIAKMKRALDEFKVEGI--KTTIPFH  423 (446)
T ss_pred             CCEECCCCCCHHHEEEEECCCHHHHHHHHHHHHHCCEEECC--CCCHHHH
T ss_conf             59879765574135889899999999999999844599893--2849999


No 22 
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=99.96  E-value=3.7e-29  Score=230.71  Aligned_cols=360  Identities=20%  Similarity=0.289  Sum_probs=254.4

Q ss_pred             EEEEECCCH------HH------HHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             589988658------89------99999998589967899954983575----117055128789899999998718979
Q gi|254780206|r    2 RVLLIGSGG------RE------HALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsGg------rE------hAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||||||||+      -|      +| |+||++.+.  .|.+++-||.|-    .+|+.+++.+...+.|.+++++++||.
T Consensus         8 kvLviGSGPi~IGQAaEFDYSGsQA-cKALkEEGy--~viLVNsNpATimTD~~~AD~vY~ePlT~e~V~~IIEKERPDg   84 (1089)
T TIGR01369         8 KVLVIGSGPIVIGQAAEFDYSGSQA-CKALKEEGY--EVILVNSNPATIMTDPEMADKVYIEPLTPEAVEKIIEKERPDG   84 (1089)
T ss_pred             EEEEECCCCCCHHHHCCCHHHHHHH-HHHHHHCCC--EEEEECCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHCCCCC
T ss_conf             8999666731131202302478999-999876495--7999758847233886686600252545888866653168660


Q ss_pred             EEE--CCCHHHHHHH----HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             999--7955787489----9898605880670106665552010235788876531011112234401111121012420
Q gi|254780206|r   66 VVV--GPELPLVNGI----SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus        66 viv--gpE~pL~~gi----~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P  139 (424)
                      +.+  |-..-|..||    ...|++.|+.++|.+-+|.+..=|+...|++|++.|+|+|++..+++.+||.++++++|||
T Consensus        85 iL~t~GGQTALNlav~L~~~GVL~kYgV~vLGT~~eaI~kaEDRe~F~~~M~ei~~pvp~S~~~~~~eEA~~~a~~~GyP  164 (1089)
T TIGR01369        85 ILPTLGGQTALNLAVELEESGVLEKYGVEVLGTPVEAIKKAEDRELFREAMKEIGEPVPKSEIVHSVEEALKAAKEIGYP  164 (1089)
T ss_pred             HHCCCCCHHHHHHHHHHHHCCCCHHHCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             00257603577778866206851452917852342435202027999999997389988110027889999999626896


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCCCCCCCCCCCCCCC
Q ss_conf             2563046534300023235677888788751445-3177788775205-75234421577-6310352000111356654
Q gi|254780206|r  140 IVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFTTARDHKRIHDGDI  216 (424)
Q Consensus       140 vVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~~~~dyKr~~~~d~  216 (424)
                      |+|+|+.-.||.|=.||+|.+|+.+-++++|..+ =++|||||-|.|. |+-.+++-|-. +.+........     ..+
T Consensus       165 viVRpAftLGG~GgGiA~n~eEL~~~~~~aL~~SpI~qvL~EkSl~GWKE~EYEVmRD~~dNCItVCNmEN~-----DPm  239 (1089)
T TIGR01369       165 VIVRPAFTLGGTGGGIASNEEELKEIVERALSASPINQVLVEKSLAGWKEIEYEVMRDSKDNCITVCNMENF-----DPM  239 (1089)
T ss_pred             EEECCCHHCCCCCCCEECCHHHHHHHHHHHHHHCCCCEEEEEEECCCCEEEEEEEEEECCCCEEEEECCCCC-----CCC
T ss_conf             898100323889985225778999999988630888557501100331788988986268788999745476-----898


Q ss_pred             CCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEE-EEEEEEEECCE--EEEEEEEEEECCCCCEEEEE
Q ss_conf             4444344300001234432220100000899999862046235664-45448985570--48999886514775104433
Q gi|254780206|r  217 GPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGV-LFAGLMITEQG--PYLIEYNVRFGDPECQAMMM  293 (424)
Q Consensus       217 GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~-l~~~~m~t~~g--p~viE~N~R~GDPE~q~ilp  293 (424)
                      |-.||-==.++|+=++++...+.+.+ .--++++.|.-+     |= -.+||=|.+++  -||||+|+|+.=-   .   
T Consensus       240 GVHTGdSIVVAPSQTLtD~EYQ~LR~-~sikIIR~lGi~-----GgGCNvQFAL~P~s~~Y~vIEvNPRvSRS---S---  307 (1089)
T TIGR01369       240 GVHTGDSIVVAPSQTLTDKEYQMLRD-ASIKIIRELGIV-----GGGCNVQFALDPDSGRYYVIEVNPRVSRS---S---  307 (1089)
T ss_pred             CEEECCCEEECCCCCCCCHHHHHHHH-HHHHHHHHCCCE-----ECCCCEEEEECCCCCCEEEEEECCCCCHH---H---
T ss_conf             45707833650763688078999999-999999873912-----16742132150789706999867882135---8---


Q ss_pred             CCCC-----CCHHHHHHHHHCC-CCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEE-ECCE
Q ss_conf             2654-----4115666542013-3332123444420675422544668775797624876668986899833587-7887
Q gi|254780206|r  294 RLES-----DILEILNSCVHGN-LHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAI-VNNN  366 (424)
Q Consensus       294 ~L~~-----dl~~il~~~~~g~-L~~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~-~~g~  366 (424)
                      -|-|     ++.-+--+.+-|- |++++-...+..+.|         +.+.-+..+..+|.=+-+ + | .++.+ -...
T Consensus       308 ALASKATGYPiAkvAAKLAvGY~LdEl~N~vT~~T~A~---------FEPSLDYvVvKIPRW~f~-K-F-~~v~r~LGt~  375 (1089)
T TIGR01369       308 ALASKATGYPIAKVAAKLAVGYGLDELKNPVTKTTPAS---------FEPSLDYVVVKIPRWDFD-K-F-EGVDRKLGTQ  375 (1089)
T ss_pred             HHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCC---------CCCCCCEEEECCCCCCCH-H-H-CCCCCCCCCE
T ss_conf             98766516628999999846887876568888853541---------046748088606788722-1-0-5788541521


Q ss_pred             EEECCCCEEEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             9981880799999628989999999999852
Q gi|254780206|r  367 LTANGGRVLSATALGKTITESRELAYHMVEN  397 (424)
Q Consensus       367 l~t~GGRVL~vv~~g~~l~eA~~~ay~~i~~  397 (424)
                      -.|    |--|=|.|-|+|||.+||-+-++.
T Consensus       376 MKS----vGEVMAIGRtFEEALQKA~Rsle~  402 (1089)
T TIGR01369       376 MKS----VGEVMAIGRTFEEALQKALRSLEI  402 (1089)
T ss_pred             EEE----EEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             015----777734671389999898876537


No 23 
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=99.96  E-value=6.7e-28  Score=221.62  Aligned_cols=363  Identities=16%  Similarity=0.225  Sum_probs=247.9

Q ss_pred             EEEEECCC------HHH------HHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865------889------99999998589967899954983575----117055128789899999998718979
Q gi|254780206|r    2 RVLLIGSG------GRE------HALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsG------grE------hAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||||||||      +-|      || +++|++...  ++.+.+-||.|-    ..+..+++.+...+.+.++.++++||.
T Consensus         9 kvLiiGsGpi~IGqa~EfDysg~qA-~~aLkeeG~--~vvlvN~NPaTi~TD~~~ad~vY~ePlt~e~v~~Ii~~E~Pd~   85 (1068)
T PRK12815          9 KILVIGSGPIIIGQAAEFDYSGTQA-CKALKEEGY--QVVLVNPNPATIMTDPEPADTVYFEPLTLEFVKRIIRREKPDA   85 (1068)
T ss_pred             EEEEECCCCCHHCCHHHHHHHHHHH-HHHHHHCCC--EEEEECCCCCHHHCCCCCCCEEEECCCCHHHHHHHHHHHCCCE
T ss_conf             8999898815312344656569999-999998699--8999889832620898744437885898999999999749998


Q ss_pred             EEE--CCCHHHHH--HHH--HHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             999--79557874--899--898605880670106665552010235788876531011112234401111121012420
Q gi|254780206|r   66 VVV--GPELPLVN--GIS--DALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus        66 viv--gpE~pL~~--gi~--d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P  139 (424)
                      +++  |...+|..  .+.  ..|++.|++++|.+.++.+..-|+...+++|++.|+|+|++..+++.++|.++++++|||
T Consensus        86 il~~~GGqtaLnla~~L~~~GiL~k~~v~llGt~~~~I~~aedR~~f~~~m~~ig~~~~~s~~~~s~~ea~~~a~~ig~P  165 (1068)
T PRK12815         86 LLATLGGQTALNLAVKLLEAGILEQYGVELLGTNVEAIQKGEDRERFRALMKELGEPVPESEIVDSEEEALRFAEKIGFP  165 (1068)
T ss_pred             EEECCCCHHHHHHHHHHHHCCCHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCHHCCCHHHHHHHHHHCCCC
T ss_conf             98677784799999999975977865964967999999864599999999997699999705219999999999866998


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHCC-CCCEEEECCCCC-CCCCCCCCCCCCCCCCCC
Q ss_conf             2563046534300023235677888788751445-3177788775205-752344215776-310352000111356654
Q gi|254780206|r  140 IVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIEEYLEGF-EVSFFALCDGKT-AIPFTTARDHKRIHDGDI  216 (424)
Q Consensus       140 vVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-~~~VliEefl~G~-E~Sv~~i~dG~~-~~~l~~~~dyKr~~~~d~  216 (424)
                      ++|+|+...||.|..+++|.+|+.+++.+.+..+ .++|+|||+|.|. |+.++++.|+.. .+.....++..     ..
T Consensus       166 vivRps~~lGg~g~~i~~n~~eL~~~~~~~~~~S~~~~vlie~sl~gwkEie~ev~RD~~~n~i~vc~mEnid-----P~  240 (1068)
T PRK12815        166 IIVRPAYTLGGDGGGIAENEEELEQLARQGLQASPIHQCLLEESIAGWKEIEYEVMRDRNDNCVTVCNMENID-----PV  240 (1068)
T ss_pred             EEEEECCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCCEEEEHHCCCCEEEEEEEEEECCCCEEEEEECCCCC-----CC
T ss_conf             9998361066896504459999999999999639998578650117976999999998898979985412354-----45


Q ss_pred             CCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECC--EEEEEEEEEEECCCCCEEEEEC
Q ss_conf             44443443000012344322201000008999998620462356644544898557--0489998865147751044332
Q gi|254780206|r  217 GPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ--GPYLIEYNVRFGDPECQAMMMR  294 (424)
Q Consensus       217 GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~--gp~viE~N~R~GDPE~q~ilp~  294 (424)
                      |-+||-==+++|+-.++++..+++.+ .   +++-++..|+  +|..++||-+..+  .-||||+|+|+.--  -++...
T Consensus       241 GIHTGDSi~vaP~qTL~d~e~q~lR~-~---a~~I~~~lgv--~G~~NiQFAv~p~~~~~~VIEvNPR~SRs--salaSK  312 (1068)
T PRK12815        241 GVHTGDSIVVAPSQTLTDDEYQMLRS-A---SLKIIRALGV--VGGCNIQFALDPRSKQYYVIEVNPRVSRS--SALASK  312 (1068)
T ss_pred             CCCCCCCCEECCCCCCCHHHHHHHHH-H---HHHHHHHCCE--ECCEEEEEEECCCCCCEEEEECCCCCCCH--HHHHHH
T ss_conf             43567745345781269999999999-9---9999997280--10105799886999828999647862202--478887


Q ss_pred             CCC-CCHHHHHHHHHCC-CCCCCCCCCCCCEEEEEECCCCCCC-CCCC-CCCCCCCCCCCCCCEEEEEEEEEECCEEEEC
Q ss_conf             654-4115666542013-3332123444420675422544668-7757-9762487666898689983358778879981
Q gi|254780206|r  295 LES-DILEILNSCVHGN-LHNTHINWKAEYALTVVVATKGYPE-EYPH-GTIISKIPQNTGTTQLFHAGTAIVNNNLTAN  370 (424)
Q Consensus       295 L~~-dl~~il~~~~~g~-L~~~~~~~~~~~~v~Vvlas~GYP~-~~~k-g~~I~~l~~~~~~~~ifhagt~~~~g~l~t~  370 (424)
                      -.. ++..+.-..+-|. |+++........     .|+- -|. .|.. -.+.+.+++-.....  +=     +....+ 
T Consensus       313 ATGyPiAkvaaklalG~~L~ei~n~iTg~t-----~A~f-EP~lDyvvvK~P~~~F~kf~~~d~--~L-----gt~Mks-  378 (1068)
T PRK12815        313 ATGYPIAKIAAKLAVGYTLDEIKNPLTGLT-----YASF-EPTLDYVVVKFPRWPFDKFGYADR--TL-----GTQMKA-  378 (1068)
T ss_pred             HCCCCHHHHHHHHHCCCCHHHCCCCCCCCC-----CCCC-CCCCCEEEEEEECCCCCCCCCCCC--CC-----CCCCCC-
T ss_conf             508848999999863887777066413773-----0333-775776999740566444678875--44-----751233-


Q ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHHC
Q ss_conf             880799999628989999999999852
Q gi|254780206|r  371 GGRVLSATALGKTITESRELAYHMVEN  397 (424)
Q Consensus       371 GGRVL~vv~~g~~l~eA~~~ay~~i~~  397 (424)
                         |-.|.+.|.|+++|..+|.+.++.
T Consensus       379 ---~Gevm~igr~f~eA~~KAlrsle~  402 (1068)
T PRK12815        379 ---TGEVMAIGRNFESAFQKALRSLEI  402 (1068)
T ss_pred             ---CHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             ---322200300289999999986335


No 24 
>PRK08654 pyruvate carboxylase subunit A; Validated
Probab=99.96  E-value=1.1e-26  Score=212.81  Aligned_cols=371  Identities=19%  Similarity=0.264  Sum_probs=250.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHH-----HHHCCEEEEC-------CCCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             58998865889999999985899678999549835-----7511705512-------87898999999987189799997
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG-----IAQHAQCVAI-------DIQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g-----~~~~~~~~~i-------~~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      ||||---|--.-=+.+++++-. +..|.+.. |+-     ....++.+.+       +..|.+.|++.|++.++|.+.||
T Consensus         4 kvLIANRGEIA~RiiRa~relG-i~tVaVyS-~~D~~s~hv~~ADe~~~ig~~~~~~sYLni~~Ii~~A~~~g~dAIhPG   81 (497)
T PRK08654          4 KILIANRGEIAIRVMRACRELG-IKTVAVYS-EADKNALFVKYADEAYPIGPAPPSKSYLNMERILEVAKKAGAEAIHPG   81 (497)
T ss_pred             EEEEECCCHHHHHHHHHHHHCC-CEEEEECC-HHHHCCCCHHHCCEEEECCCCCCCCCCCCHHHHHHHHHHHCCCEEECC
T ss_conf             0899878799999999999859-93999888-378548997888989984898832121689999999998099999577


Q ss_pred             ----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             ----9557874899898605880670106665552010235788876531011112--2344011111210124202563
Q gi|254780206|r   70 ----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus        70 ----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVK  143 (424)
                          +|.|   .+++.++++||.++||+.++.+..+||..+|++|+++|+|+.++.  .+++.+++.++++++|||++||
T Consensus        82 YGFLSEn~---~fA~~~~~~Gi~fIGP~~~~I~~~GDK~~ar~la~~~gVPvvPG~~~~v~~~~ea~~~A~~IGyPV~iK  158 (497)
T PRK08654         82 YGFLSENP---KFAKACEKEGITFIGPSSNVIEAMGSKINAKKLMKKAGVPVLPGTEEGIEDIEEAKEVAEEIGYPVIIK  158 (497)
T ss_pred             HHHHHHCH---HHHHHHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             76755489---999999987999999399999986588999999998099868997566799999999998649845876


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCCC----CC-CCCCC
Q ss_conf             046534300023235677888788751445-----3177788775205-75234421577-6310352----00-01113
Q gi|254780206|r  144 ADGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFTT----AR-DHKRI  211 (424)
Q Consensus       144 p~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~~----~~-dyKr~  211 (424)
                      |+...||||+.++++.+|+.++++.+...+     +..|+||+||+++ ++-++++.|+. +++.+..    .| -|.++
T Consensus       159 As~GGGGrGmriV~~~~eL~~~~~~a~~eA~~~fgd~~v~iEk~i~~~RHIEVQvl~D~~GnvihlgeRdCSiQRr~QKv  238 (497)
T PRK08654        159 ASAGGGGIGMRVVYNEEELEEAIESTQSIAQSAFGDSTVFIEKYLEKPRHIEIQVLADKHGNVIHLGDRECSIQRRHQKL  238 (497)
T ss_pred             ECCCCCCCCCEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEEEEEEECCCCEEEECCEECCEEECCCCE
T ss_conf             52688888658996025689999999999887459984579884155537899999844797867146023436268636


Q ss_pred             CCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEE--CCCCCE
Q ss_conf             566544444344300001234432220100000899999862046235664454489855704899988651--477510
Q gi|254780206|r  212 HDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRF--GDPECQ  289 (424)
Q Consensus       212 ~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~--GDPE~q  289 (424)
                      -|            .+|+|.+++++.+++    .+.+++..+..|  |+|.--++|+++++..|+||.|+|+  --|=|.
T Consensus       239 IE------------eaPap~l~~~~r~~m----~~~Av~la~~vg--Y~gaGTVEFl~d~g~fyFlEmNtRlQVEHpVTE  300 (497)
T PRK08654        239 IE------------EAPSPIMTPELRERM----GEAAVKAAKAIN--YENAGTVEFLYSNGNFYFLEMNTRLQVEHPITE  300 (497)
T ss_pred             EE------------ECCCCCCCHHHHHHH----HHHHHHHHHHHC--EECCCEEEEEEECCEEEEEEEECCCCCCCCCCH
T ss_conf             99------------789998988999999----999999888734--302332799874883999961244224554216


Q ss_pred             EEEECCCCCCHHHHHHHHHCC-CC--CCCCCCCCCCEEEEEECCCCCCC---CCCCCCCCCCCCCCCCCCEEEEEEEEEE
Q ss_conf             443326544115666542013-33--32123444420675422544668---7757976248766689868998335877
Q gi|254780206|r  290 AMMMRLESDILEILNSCVHGN-LH--NTHINWKAEYALTVVVATKGYPE---EYPHGTIISKIPQNTGTTQLFHAGTAIV  363 (424)
Q Consensus       290 ~ilp~L~~dl~~il~~~~~g~-L~--~~~~~~~~~~~v~Vvlas~GYP~---~~~kg~~I~~l~~~~~~~~ifhagt~~~  363 (424)
                      .+   -.-||+..-..++.|. |.  ..++.. .++++-+=+.+.. |.   .+..|. |+.+....+.      |+ +.
T Consensus       301 ~v---TGiDLV~~Qi~iA~G~~L~~~q~~i~~-~GhAIe~Ri~AEd-P~~~F~Ps~G~-i~~~~~P~g~------gv-Rv  367 (497)
T PRK08654        301 MV---TGIDIVKEQIKIAAGEKLSFKQEDITI-RGHAIECRINAED-PLNDFAPSPGK-IKRYRSPGGP------GV-RV  367 (497)
T ss_pred             HH---CCCCHHHHHHHHHCCCCCCCCCCCCCC-CEEEEEEECCCCC-CCCCCCCCCCE-EEEEECCCCC------CE-EE
T ss_conf             66---087199999998679988910037777-5139999810358-88786458736-6079759999------88-99


Q ss_pred             CCEEEECC--------CCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             88799818--------8079999962898999999999985258999575351789
Q gi|254780206|r  364 NNNLTANG--------GRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       364 ~g~l~t~G--------GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                      |..++ .|        +=+.-+++.|.|.++|..+..+++......|  -+|.|.+
T Consensus       368 D~~v~-~G~~v~~~yDsmlaKli~~g~~R~~Ai~r~~rAL~e~~I~G--v~Tni~~  420 (497)
T PRK08654        368 DSGVH-MGYTIPPYYDSMISKLIVWGRTREEAIARMKRALYEYIILG--VKTNIPF  420 (497)
T ss_pred             ECCCC-CCCCCCCCCCCHHCEEEEECCCHHHHHHHHHHHHHCCEEEC--CCCCHHH
T ss_conf             64564-68973886543330367988999999999999985469989--5487999


No 25 
>PRK05586 biotin carboxylase; Validated
Probab=99.96  E-value=2.9e-26  Score=209.85  Aligned_cols=379  Identities=15%  Similarity=0.201  Sum_probs=253.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEE-ECC--C-HHHHHCCEEEEC-------CCCCHHHHHHHHHHHCCCEEEEC-
Q ss_conf             58998865889999999985899678999-549--8-357511705512-------87898999999987189799997-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWS-IPG--N-PGIAQHAQCVAI-------DIQNHSAIIHFCQEKHIDLVVVG-   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~-~pg--N-~g~~~~~~~~~i-------~~~d~~~i~~~a~~~~iDlvivg-   69 (424)
                      ||||---|--.-=+..+.++- .+..|.+ .+.  | +......+.+.+       +..|.+.|++.|++.+.|.|.|| 
T Consensus         4 kvLIANRGEIA~Ri~rt~~~l-gi~tVavys~~D~~a~hv~~Ade~~~lg~~~~~~sYln~~~ii~~A~~~g~dAihPGY   82 (447)
T PRK05586          4 KILIANRGEIAVRIIRACREM-GIETVAVYSEIDKDALHVQLADEAVCIGPASSKDSYLNIYNILSATVLTGAQAIHPGF   82 (447)
T ss_pred             EEEEECCCHHHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHCCEEEECCCCCHHHHHCCHHHHHHHHHHHCCCEEECCC
T ss_conf             499989879999999999983-9959999170336785476498998739999565114899999999984998997185


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEEE
Q ss_conf             ---9557874899898605880670106665552010235788876531011112--23440111112101242025630
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVKp  144 (424)
                         +|.|   .++.+++++|+..+||+.++.+..+||..+|+++.++|+|+.++.  .+++.+++.++++++|||++|||
T Consensus        83 GFLSEna---~Fa~~~~~~Gi~fIGP~~~~i~~~GdK~~ar~~a~~~gvPv~pg~~~~v~~~~ea~~~a~~iGyPv~lKA  159 (447)
T PRK05586         83 GFLSENS---KFAKMCKECNIVFIGPDSETIELMGNKSNAREIMKKAGVPVVPGSEGEIENEEEALKIAEEIGYPVMVKA  159 (447)
T ss_pred             CHHHCCH---HHHHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             5322389---9999999879879895999999853849999999984997656868888999999999986298237630


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCC----CCC-CCCCCC
Q ss_conf             46534300023235677888788751445-----3177788775205-75234421577-631035----200-011135
Q gi|254780206|r  145 DGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFT----TAR-DHKRIH  212 (424)
Q Consensus       145 ~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~----~~~-dyKr~~  212 (424)
                      +...||||+.++++.+|+.++++.+..++     ++.|+||+||+++ ++-++++.|+. +++.+.    ..| -|.++-
T Consensus       160 a~GGGGrGmriv~~~~el~~~~~~a~~ea~~aFg~~~v~vEk~i~~~RHIEVQvl~D~~Gn~vhlgeRdCSiQRr~QKvI  239 (447)
T PRK05586        160 SAGGGGRGIRIVRSEEELIKAFNTAKSEAKAAFGDDSMYIEKFIENPRHIEFQILGDNYGNVVHLGERDCSLQRRNQKVL  239 (447)
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEECCCCCEEEEECCCCCCCCCCCCEE
T ss_conf             56999773699899999999999999999982799846887724787179999997079988884064246656886379


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEEE
Q ss_conf             6654444434430000123443222010000089999986204623566445448985570-489998865147751044
Q gi|254780206|r  213 DGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAM  291 (424)
Q Consensus       213 ~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~i  291 (424)
                      |            .+|+|.+++++.+++    .+.+++..+.  +.|.|.--++|++++++ .|+||.|+|+= .|--+-
T Consensus       240 E------------eaPap~l~~~~r~~m----~~~A~~la~~--vgY~gaGTvEFl~d~~~~fyFlEvNtRlQ-VEH~VT  300 (447)
T PRK05586        240 E------------EAPSPVMTEELRKKM----GEIAVKAAKA--VNYKNAGTIEFLLDKDGNFYFMEMNTRIQ-VEHPIT  300 (447)
T ss_pred             E------------ECCCCCCCHHHHHHH----HHHHHHHHHH--CCCCCCCEEEEEECCCCCEEEEEEECCCC-CCCCCE
T ss_conf             9------------889998889999999----9999988886--06033324788875899789993343555-566411


Q ss_pred             EECCCCCCHHHHHHHHHCCCCC---CCCCCCCCCEEEEEECCCCCCC---CCCCCCCCCCCCCCCC-CCEEEEEEEEEEC
Q ss_conf             3326544115666542013333---2123444420675422544668---7757976248766689-8689983358778
Q gi|254780206|r  292 MMRLESDILEILNSCVHGNLHN---THINWKAEYALTVVVATKGYPE---EYPHGTIISKIPQNTG-TTQLFHAGTAIVN  364 (424)
Q Consensus       292 lp~L~~dl~~il~~~~~g~L~~---~~~~~~~~~~v~Vvlas~GYP~---~~~kg~~I~~l~~~~~-~~~ifhagt~~~~  364 (424)
                      =..-.-||+...+.++.|.--.   .++.+ .++++-+=+.+.. |.   .+..|. |+.+....+ ++.+ ..++  ..
T Consensus       301 E~vtGvDLV~~Qi~iA~G~~L~~~q~~i~~-~GhAIe~Ri~AEd-p~~~f~Ps~G~-i~~~~~P~g~gvRv-Dt~~--~~  374 (447)
T PRK05586        301 EMITGVDLVKEQIKIAYGEKLSITQEDIKI-NGHAIECRINAED-PENGFMPCPGK-IEELYIPGGLGVRL-DSAI--YS  374 (447)
T ss_pred             EECCCCCHHHHHHHHHCCCCCCCCCCCCCC-CCEEEEEEEECCC-CCCCCCCCCCE-EEEEECCCCCCEEE-ECCC--CC
T ss_conf             000377689999998679999977010787-8569999821457-88785058756-65897699998898-7874--58


Q ss_pred             CEEEECC--CCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             8799818--8079999962898999999999985258999575351789
Q gi|254780206|r  365 NNLTANG--GRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       365 g~l~t~G--GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                      |..++.-  +=+.-+++.|.|.++|..+..+.++.....|.  ++.|.+
T Consensus       375 G~~v~~~yDsllaK~I~~g~~R~~Ai~rl~~aL~~~~i~Gv--~Tni~~  421 (447)
T PRK05586        375 GYTIPPYYDSMIGKLIVYGKDREEAIQKMKRALGEFIIEGV--KTNIDF  421 (447)
T ss_pred             CCCCCCCCCCHHCEEEEECCCHHHHHHHHHHHHHCCEEECC--CCCHHH
T ss_conf             79648864622324779889999999999999843799793--487999


No 26 
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed
Probab=99.96  E-value=9.6e-28  Score=220.49  Aligned_cols=275  Identities=21%  Similarity=0.253  Sum_probs=191.8

Q ss_pred             CEEEEECCC-HHHHH--------HHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEEC--
Q ss_conf             958998865-88999--------9999985899678999549835751170551287898999999987189799997--
Q gi|254780206|r    1 MRVLLIGSG-GREHA--------LAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVG--   69 (424)
Q Consensus         1 MkILviGsG-grEhA--------l~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivg--   69 (424)
                      |||+||-+| ..||.        +..+|.+...  +++               .+|+.+  ......++.++|+|++.  
T Consensus         5 ~kI~vl~GG~S~E~eVSl~S~~~v~~aL~~~~y--~v~---------------~id~~~--~~~~~l~~~~~D~vf~~lH   65 (304)
T PRK01372          5 GKVAVLMGGTSAEREVSLNSGAAVLAALREAGY--DAH---------------PIDPGE--DPAAELKELGFDRVFNALH   65 (304)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHHHHHCCC--EEE---------------EECCCC--CHHHHHHHCCCCEEEEECC
T ss_conf             718999367871289999999999998837599--799---------------982896--4677875339999999068


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECC
Q ss_conf             ---95578748998986058806701066655520102357888765310111122344011111210124202563046
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~  146 (424)
                         -|+=-   +...|+..|||..|++..++.+..||..+|.+|+.+|||||+|..++..++..+..+.++||+||||..
T Consensus        66 G~~GEDG~---iQglLe~~~IPYtGs~~~asal~mDK~~tK~i~~~~gI~tp~~~~~~~~~~~~~~~~~l~~P~iVKP~~  142 (304)
T PRK01372         66 GRGGEDGT---IQGLLELLGIPYTGSGVLASALAMDKLRTKLVWQAAGLPTAPWVVLTRAEDLLAAIDKLGLPLVVKPAR  142 (304)
T ss_pred             CCCCCCHH---HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCCCEEEEECC
T ss_conf             99985649---999999859983579989987765389999999986999898499865313999987618987997668


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCC
Q ss_conf             534300023235677888788751445317778877520575234421577631035200--011135665444443443
Q gi|254780206|r  147 LCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTAR--DHKRIHDGDIGPNTGGMG  224 (424)
Q Consensus       147 ~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~--dyKr~~~~d~GpnTGGMG  224 (424)
                      ..++.||.++++.+|+.++++.+|. .+++|||||||+|.|++|.++  |...  +|++.  .-...||.+.--+.|+--
T Consensus       143 ~GSSiGv~~V~~~~el~~ai~~a~~-~~~~vLvE~~I~GrEitv~Vl--g~~~--lp~~eI~~~~~fyDy~aKY~~~~s~  217 (304)
T PRK01372        143 EGSSVGVTKVKEADELPAALELAFK-YDDEVLVEKYIKGRELTVAVL--GGKA--LPVIRIVPPGEFYDYEAKYLAGDTQ  217 (304)
T ss_pred             CCCCCCEEEECCHHHHHHHHHHHHH-CCCCCEEEEEECCEEEEEEEE--CCCC--CCEEEEECCCCCCCHHHCCCCCCCC
T ss_conf             8866653896698899999999874-488625450256569999998--9977--7538994599875776612557741


Q ss_pred             EEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEEEEECCC----CCC
Q ss_conf             0000123443222010000089999986204623566445448985570-48999886514775104433265----441
Q gi|254780206|r  225 ACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMRLE----SDI  299 (424)
Q Consensus       225 a~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~ilp~L~----~dl  299 (424)
                      .++|++ +++++.    ++|-+-+.++.+..|+  +|+..+||+++++| ||++|+|+=.| .....++|.+-    -++
T Consensus       218 ~~~Pa~-l~~~~~----~~i~~~a~~~~~aLg~--~g~aRvDf~~~~~g~~~~lEiNt~PG-mT~~Sl~P~~a~~~G~s~  289 (304)
T PRK01372        218 YLCPAG-LPAELE----AELQALALRAYKALGC--RGWGRVDFMLDEDGKPYLLEVNTSPG-MTSHSLVPMAARAAGISF  289 (304)
T ss_pred             EECCCC-CCHHHH----HHHHHHHHHHHHHHCC--CCEEEEEEEEECCCCEEEEEECCCCC-CCCCCHHHHHHHHCCCCH
T ss_conf             100689-999999----9999999999998499--73698899990799789998339999-874158999999819999


Q ss_pred             HHHHHHHHHCC
Q ss_conf             15666542013
Q gi|254780206|r  300 LEILNSCVHGN  310 (424)
Q Consensus       300 ~~il~~~~~g~  310 (424)
                      -+++..+++.-
T Consensus       290 ~~li~~ii~~A  300 (304)
T PRK01372        290 SELVVWILEDA  300 (304)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 27 
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated
Probab=99.95  E-value=2.1e-25  Score=203.53  Aligned_cols=380  Identities=16%  Similarity=0.203  Sum_probs=248.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEE--C-CCH-HHHHCCEEEEC-------CCCCHHHHHHHHHHHCCCEEEEC-
Q ss_conf             589988658899999999858996789995--4-983-57511705512-------87898999999987189799997-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSI--P-GNP-GIAQHAQCVAI-------DIQNHSAIIHFCQEKHIDLVVVG-   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~--p-gN~-g~~~~~~~~~i-------~~~d~~~i~~~a~~~~iDlvivg-   69 (424)
                      ||||---|=-.-=+..++++-. +..|-+.  + .|. ......+.+.+       +..|.+.|++.|++.+.|.+.|| 
T Consensus         4 kvLIANRGEIA~Ri~rt~~elg-i~tvavys~~D~~a~hv~~Ade~v~ig~~~~~~sYln~~~Ii~~A~~~g~dAIHPGY   82 (449)
T PRK06111          4 KVLIANRGEIAVRIIRTCQKLG-IRTVAIYSEADEDALHVKLADEAYLIGGPRVQESYLNLEKIIEIAKKTGAEAIHPGY   82 (449)
T ss_pred             EEEEECCCHHHHHHHHHHHHCC-CCEEEECCHHHCCCHHHHHCCEEEEECCCCHHHHHCCHHHHHHHHHHHCCCEEECCC
T ss_conf             1899878799999999999849-979999173645683587498988808997454333999999999983999997798


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEEE
Q ss_conf             ---9557874899898605880670106665552010235788876531011112--23440111112101242025630
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVKp  144 (424)
                         +|.   +.+++.++++|+..+||+.++.+..+||.-+|+++.++|||+.++.  .+++.+++.++++++|||++|||
T Consensus        83 GFLSEn---a~FA~~~~~~gi~fIGP~~~~i~~~GdK~~ar~~a~~~gvPvvPG~~~~~~~~~ea~~~a~~iGyPvliKA  159 (449)
T PRK06111         83 GLLSEN---ASFAERCKEEGIVFIGPSAEIIAKMGSKIEARRAMQAAGVPVVPGITTALEDAEEAIAIARQIGYPVMLKA  159 (449)
T ss_pred             CCCCCC---HHHHHHHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             731169---89999999889989992999999864869999999983998557867778999999999986598026620


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCC----C-CHHHHHHHHHHC-CCCCEEEECCCC-CCCCCCC----CC-CCCCCC
Q ss_conf             4653430002323567788878875144----5-317778877520-575234421577-6310352----00-011135
Q gi|254780206|r  145 DGLCAGKGVVVAATVDEATSAIDRCFQQ----I-NSTVIIEEYLEG-FEVSFFALCDGK-TAIPFTT----AR-DHKRIH  212 (424)
Q Consensus       145 ~~~agGkGV~i~~~~~e~~~~~~~~~~~----~-~~~VliEefl~G-~E~Sv~~i~dG~-~~~~l~~----~~-dyKr~~  212 (424)
                      +...||||+.++++.+|+.++++.+..+    . +..|++|+|+++ ..+-|+++.|+. +++.+..    .| -|.++-
T Consensus       160 a~GGGGrGmriv~~~~el~~~~~~~~~eA~~~Fg~~~v~iEk~i~~~RHIEVQvl~D~~Gn~vhlgeRdCSiQRr~QKvi  239 (449)
T PRK06111        160 SAGGGGIGMQLVETEQELTKAFESNKKRAANFFGNGEMYLEKYIEDARHIEIQLLADTHGNTVYLWERECSVQRRHQKVI  239 (449)
T ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEECCCCCEEEEECCCCCCCCCCCCEE
T ss_conf             35898672089579999999999999999986399602554413577337999997068888883051226635774169


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEEE
Q ss_conf             6654444434430000123443222010000089999986204623566445448985570-489998865147751044
Q gi|254780206|r  213 DGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAM  291 (424)
Q Consensus       213 ~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~i  291 (424)
                      |            -+|+|.+++++.+++    .+.+++..+.  +.|+|.--++|++++++ .|+||.|+|+- .|--+-
T Consensus       240 E------------eaPap~l~~~~r~~~----~~~A~~la~~--v~Y~g~gTvEFl~d~~~~fyFlEvNtRlQ-VEHpVT  300 (449)
T PRK06111        240 E------------EAPSPFLDEETRKAM----GEAAVQAAKA--IGYTNAGTIEFLVDNQKNFYFLEMNTRLQ-VEHPVT  300 (449)
T ss_pred             E------------ECCCCCCCHHHHHHH----HHHHHHHHHH--CCEEEEEEEEEEEECCCCEEEEEEECCCC-CCCCEE
T ss_conf             9------------789999999999999----9999999887--17102468999994898689995343544-466404


Q ss_pred             EECCCCCCHHHHHHHHHCCCCC---CCCCCCCCCEEEEEECCCCCCCCCC--CCCCCCCCCCCCCCCEEEEEEEEEECCE
Q ss_conf             3326544115666542013333---2123444420675422544668775--7976248766689868998335877887
Q gi|254780206|r  292 MMRLESDILEILNSCVHGNLHN---THINWKAEYALTVVVATKGYPEEYP--HGTIISKIPQNTGTTQLFHAGTAIVNNN  366 (424)
Q Consensus       292 lp~L~~dl~~il~~~~~g~L~~---~~~~~~~~~~v~Vvlas~GYP~~~~--kg~~I~~l~~~~~~~~ifhagt~~~~g~  366 (424)
                      =..-.-||+...+.++.|.--.   .++.. +++++-+=+.+.. |..+.  .| .|..+....+...-+.+++  ..|.
T Consensus       301 E~vtGiDLV~~Qi~iA~G~~L~~~q~~i~~-~GhAIe~Ri~AEd-p~~f~Ps~G-~i~~~~~P~g~gvRvDs~~--~~G~  375 (449)
T PRK06111        301 EEITGIDLVEQQLRIAAGEKLSFTQDDIKR-SGHAIEVRIYAED-PKTFFPSPG-KITDLTLPGGEGVRHDHAV--ENGV  375 (449)
T ss_pred             EEECCCCHHHHHHHHHCCCCCCCCHHHCCC-CCEEHHHHHHCCC-CCCCCCCCE-EEEEEECCCCCCEEEECCC--CCCC
T ss_conf             555388489999998679989989666685-6120555551378-565789986-9999984899988885366--6859


Q ss_pred             EEECC--CCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             99818--8079999962898999999999985258999575351789
Q gi|254780206|r  367 LTANG--GRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       367 l~t~G--GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                      .++..  +=+.-+++.|.|.++|..+..+.++.....|.  .|-|.+
T Consensus       376 ~v~~~yDsmlaKlI~~g~~R~~Ai~rl~~aL~e~~I~Gv--~Tni~~  420 (449)
T PRK06111        376 TVTPFYDPMIAKVIAHGETREEAIARLHDALEELKVEGI--KTNIPL  420 (449)
T ss_pred             EECCCCCCHHHEEEEECCCHHHHHHHHHHHHHCCEEECC--CCCHHH
T ss_conf             708875653325679879999999999999851699894--385999


No 28 
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed
Probab=99.95  E-value=1e-25  Score=205.88  Aligned_cols=359  Identities=19%  Similarity=0.217  Sum_probs=243.2

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEECC-C-HHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             958998865--889999999985899678999549-8-357511705512878989999999871897999979557874
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIPG-N-PGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~pg-N-~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      ++|.|||+|  ||.-  +.+.++-..-..+ +.|. | |......+.+..+..|.+++.+|+++  .|.+-.-.|.- -.
T Consensus         8 ~tIGIlGgGQLgrMl--a~aA~~lG~~v~v-ldp~~~~PA~~va~~~~~~~~~D~~al~~fa~~--~DviT~E~EnI-~~   81 (377)
T PRK06019          8 KTIGIIGGGQLGRML--ALAAAPLGYKVIV-LDPDADCPAAQVADRVIVADYDDVAALRELAEQ--CDVITYEFENV-PA   81 (377)
T ss_pred             CEEEEECCCHHHHHH--HHHHHHCCCEEEE-ECCCCCCCHHHHCCEEEECCCCCHHHHHHHHHC--CCEEEECCCCC-CH
T ss_conf             999998786899999--9999978998999-848984984783784898688989999999845--99999781768-99


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC-CCCCCCCCCC
Q ss_conf             899898605880670106665552010235788876531011112234401111121012420256304-6534300023
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD-GLCAGKGVVV  155 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~-~~agGkGV~i  155 (424)
                      ...+.|++. .+++ |+.++.++..||...|+|+.++|||||+|..+++.+++.++++++|||+|+|+. +..-|||+.+
T Consensus        82 ~~L~~le~~-~~v~-P~~~al~i~QdR~~eK~~l~~lgiptapf~~v~s~~dl~~~~~~lg~P~vlKt~~~GYDGKGq~~  159 (377)
T PRK06019         82 EALDLLAAR-VPVP-PGPDALAIAQDRLTEKQFLDELGIPVAPFALVDSAEDLDAAIADLGLPAVLKTRRGGYDGKGQWV  159 (377)
T ss_pred             HHHHHHHHC-CCCC-CCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCCCCEE
T ss_conf             999999708-9668-79899998862799999999769998880671899999999997299769951334618870189


Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCCEEEECCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCC
Q ss_conf             235677888788751445317778877520-57523442157-7631035200011135665444443443000012344
Q gi|254780206|r  156 AATVDEATSAIDRCFQQINSTVIIEEYLEG-FEVSFFALCDG-KTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS  233 (424)
Q Consensus       156 ~~~~~e~~~~~~~~~~~~~~~VliEefl~G-~E~Sv~~i~dG-~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~  233 (424)
                      +++.+|+.++++..-   +.++++|+|++- .|+|+.+..+. .++..+|+++.+.+-  +..      .-+++|++ ++
T Consensus       160 i~s~~dl~~a~~~l~---~~~~i~E~~i~f~~ElSvivaR~~~G~~~~yP~~en~h~~--gil------~~s~~Pa~-~~  227 (377)
T PRK06019        160 LRSEADLDAAWAALG---SGPCILEEFVPFEREVSVIVARGRDGEVVFYPLVENVHRN--GIL------RTSIAPAP-IS  227 (377)
T ss_pred             ECCHHHHHHHHHHCC---CCCEEEEEEECCEEEEEEEEEECCCCCEEEECCHHCEEEC--CEE------EEEECCCC-CC
T ss_conf             778889999998656---9988999654351899999998489999994441147777--755------89988999-99


Q ss_pred             CCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCCC
Q ss_conf             32220100000899999862046235664454489855704899988651477510443326544115666542013333
Q gi|254780206|r  234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHN  313 (424)
Q Consensus       234 ~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~~  313 (424)
                      ++..+++ +++...++++     +.|.|+|-++|-++++|.+|=|+.+|.-+----++-....|-|-..+-+++.--|.+
T Consensus       228 ~~~~~~a-~~ia~~i~~~-----l~~vGvl~VE~F~~~~~llvNEiAPRpHNSGH~Ti~~~~~SQFe~HlRAi~glpl~~  301 (377)
T PRK06019        228 ADLQAQA-EEIASRIAEE-----LDYVGVLAVEFFVTGDGLLVNEIAPRVHNSGHWTIDACSTSQFEQHLRAIAGLPLGS  301 (377)
T ss_pred             HHHHHHH-HHHHHHHHHH-----CCCCCEEEEEEEEECCCEEEEEECCCCCCCCCEEECCCCCCHHHHHHHHHCCCCCCC
T ss_conf             9999999-9999999997-----487624999999918938999725887687547642341248999999982998888


Q ss_pred             CCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCC-EEEEEEECCCHHHHHHHHH
Q ss_conf             212344442067542254466877579762487666898689983358778879981880-7999996289899999999
Q gi|254780206|r  314 THINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGR-VLSATALGKTITESRELAY  392 (424)
Q Consensus       314 ~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGR-VL~vv~~g~~l~eA~~~ay  392 (424)
                      +.+  ...+.|.-+|-...+|..    ..+  +....-..++|+        +-.+.-|| .-.++.+|+|.++|++++-
T Consensus       302 ~~~--~~pa~M~NilG~~~~~~~----~~~--~~~~~~~~h~Yg--------K~e~r~gRKmGHit~~~~~~~~~~~~~~  365 (377)
T PRK06019        302 TEL--LSPAVMVNLLGDDVEPDW----DDL--LALPGAHLHWYG--------KAEARPGRKMGHVTVLGDDVEALLEKAE  365 (377)
T ss_pred             CCC--CCCEEEEEEECCCCCHHH----HHH--HHCCCCEEEECC--------CCCCCCCCCEEEEEEECCCHHHHHHHHH
T ss_conf             544--476699998377531369----999--719998899768--------9878899826899983199999999999


Q ss_pred             HHHHCCCCC
Q ss_conf             998525899
Q gi|254780206|r  393 HMVENIDWK  401 (424)
Q Consensus       393 ~~i~~I~~~  401 (424)
                      .....+.-+
T Consensus       366 ~~~~~l~~~  374 (377)
T PRK06019        366 ALAALLPIE  374 (377)
T ss_pred             HHHHHCCCC
T ss_conf             999765864


No 29 
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional
Probab=99.95  E-value=1.8e-25  Score=204.01  Aligned_cols=378  Identities=15%  Similarity=0.195  Sum_probs=253.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC--C-C-HHHHHCCEEEEC-------CCCCHHHHHHHHHHHCCCEEEEC-
Q ss_conf             5899886588999999998589967899954--9-8-357511705512-------87898999999987189799997-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP--G-N-PGIAQHAQCVAI-------DIQNHSAIIHFCQEKHIDLVVVG-   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p--g-N-~g~~~~~~~~~i-------~~~d~~~i~~~a~~~~iDlvivg-   69 (424)
                      ||||---|--.-=+..++++- .+..|-+..  + + +......+.+.+       +..|.+.|++.|++.+.|.|.|| 
T Consensus         7 kvLIANRGEIA~Riirt~rel-gi~tVavys~~D~~~~hv~~ADeav~ig~~~~~~sYln~~~Ii~~A~~~g~dAiHPGY   85 (458)
T PRK12833          7 TVLVANRGEIAVRVIRAAHEL-GMRAVAVVSDADRDSLAARMADEAVHIGPSHAAKSYLNPAAILAAARQCGADAIHPGY   85 (458)
T ss_pred             EEEEECCCHHHHHHHHHHHHC-CCCEEEEECHHHCCCHHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCEEECCC
T ss_conf             899977869999999999983-9989999185765583587499999828987001326999999999982999997686


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEEE
Q ss_conf             ---9557874899898605880670106665552010235788876531011112--23440111112101242025630
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVKp  144 (424)
                         +|.   +.++.+++++|+..+||+.++.+..+||..+|+++.+.|+|+.++.  .+++.+++.++++++|||++|||
T Consensus        86 GFLSEn---a~FA~~~~~~gi~fIGPs~~~i~~~GdK~~ar~~a~~~gvPvvpgs~~~v~~~~ea~~~a~~iGyPv~iKA  162 (458)
T PRK12833         86 GFLSEN---AAFAAQVEAAGLIFVGPDAQVIATMGDKARARETARRAGVPTVPGSDGVVASLDAALEVAARIGYPVMIKA  162 (458)
T ss_pred             CHHHHC---HHHHHHHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHH
T ss_conf             625529---99999999789989994999999850969999999984999668966766779999999986597542133


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHC-CCCCEEEECCCCCCCCCCC----CC-CCCCCCC
Q ss_conf             46534300023235677888788751445-----317778877520-5752344215776310352----00-0111356
Q gi|254780206|r  145 DGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEG-FEVSFFALCDGKTAIPFTT----AR-DHKRIHD  213 (424)
Q Consensus       145 ~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G-~E~Sv~~i~dG~~~~~l~~----~~-dyKr~~~  213 (424)
                      +...||||+.++.+.+|+.++++.+..++     +..|++|+|+++ .++-++++.||.+++.|..    .| .|.++-|
T Consensus       163 s~GGGGrGmriv~~~~el~~~~~~a~~ea~~~Fg~~~v~iEk~i~~~RHIEVQvl~D~~~~vhl~eRdCSiQRr~QKviE  242 (458)
T PRK12833        163 AAGGGGRGIRVAHDAAQLAAELPLAQREAQAAFGDGGVYLERFIARARHIEVQILGDGENVVHLFERECSLQRRRQKILE  242 (458)
T ss_pred             CCCCCCCCEEEECCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEEEEEECCCCEEEEEECCCCCCCCCCCEEE
T ss_conf             25899871079526411489999999999972699764787613675079999985478769985025656567775588


Q ss_pred             CCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC-CE-EEEEEEEEEE--CCCCCE
Q ss_conf             6544444344300001234432220100000899999862046235664454489855-70-4899988651--477510
Q gi|254780206|r  214 GDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE-QG-PYLIEYNVRF--GDPECQ  289 (424)
Q Consensus       214 ~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~-~g-p~viE~N~R~--GDPE~q  289 (424)
                                  .+|+|.+++++.+++.    +.+++-.+.  +.|.|.--++|++++ ++ .|+||+|+|+  --|=|+
T Consensus       243 ------------eaPsp~l~~~~r~~l~----~~a~~la~~--v~y~gagTvEFl~d~~~~~fyFlEvNtRlQVEH~VTE  304 (458)
T PRK12833        243 ------------EAPSPSLTPAQRDALC----ASATRLARA--VGYRGAGTLEYLFDDARGEFYFIEMNTRIQVEHPVTE  304 (458)
T ss_pred             ------------ECCCCCCCHHHHHHHH----HHHHHHHHH--CCCCEEEEEEEEEECCCCCEEEEEEECCCCCCCCEEH
T ss_conf             ------------7799978999999998----899999885--3310000266678658896899962136444442122


Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCC---CCCCCCCCCEEEEEECCCCCCC---CCCCCCCCCCCCCCCC-CCEEEEEEEEE
Q ss_conf             443326544115666542013333---2123444420675422544668---7757976248766689-86899833587
Q gi|254780206|r  290 AMMMRLESDILEILNSCVHGNLHN---THINWKAEYALTVVVATKGYPE---EYPHGTIISKIPQNTG-TTQLFHAGTAI  362 (424)
Q Consensus       290 ~ilp~L~~dl~~il~~~~~g~L~~---~~~~~~~~~~v~Vvlas~GYP~---~~~kg~~I~~l~~~~~-~~~ifhagt~~  362 (424)
                      .+   -.-||+...+.++.|.--.   .++.+ .++++-+=+.+.. |.   .+..| .|+.+....+ ++.+. .++  
T Consensus       305 ~v---tGiDLV~~Qi~iA~G~~L~~~q~~i~~-~GhaIe~RI~AEd-p~~~f~Ps~G-~i~~~~~P~g~gvRvD-t~v--  375 (458)
T PRK12833        305 AI---TGIDLVREMLRIADGEPLRFAQGDIAL-RGAALECRINAED-PLQDFRPNPG-RIDALVWPAGPGVRVD-SLL--  375 (458)
T ss_pred             HH---CCCCHHHHHHHHHCCCCCCCCHHCCCC-CCEEEEEEEECCC-CCCCCCCCCE-EEEEEECCCCCCEEEE-CCC--
T ss_conf             33---188599999999779977864210666-7508999752258-8778676883-8526863999988888-870--


Q ss_pred             ECCEEEECC--CCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHHH
Q ss_conf             788799818--80799999628989999999999852589995753517898
Q gi|254780206|r  363 VNNNLTANG--GRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ  412 (424)
Q Consensus       363 ~~g~l~t~G--GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~~  412 (424)
                      ..|..++..  +=+.-+++.|.|.++|..+..+.++.....|  .+|.|.+-
T Consensus       376 ~~G~~v~~~yDsllaKlI~~g~~R~~Ai~rl~~aL~e~~I~G--v~TNi~~l  425 (458)
T PRK12833        376 YPGYAVPPFYDSLLAKLIVHDESRAAALARAARALEELRIDG--MKTTAPLH  425 (458)
T ss_pred             CCCCCCCCCCCCHHHEEEEECCCHHHHHHHHHHHHHCCEEEC--CCCCHHHH
T ss_conf             277974887550430036888999999999999984479989--33879999


No 30 
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated
Probab=99.95  E-value=2e-25  Score=203.72  Aligned_cols=378  Identities=19%  Similarity=0.253  Sum_probs=250.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECC---C-HHHHHCCEEEEC-------CCCCHHHHHHHHHHHCCCEEEEC-
Q ss_conf             58998865889999999985899678999549---8-357511705512-------87898999999987189799997-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPG---N-PGIAQHAQCVAI-------DIQNHSAIIHFCQEKHIDLVVVG-   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pg---N-~g~~~~~~~~~i-------~~~d~~~i~~~a~~~~iDlvivg-   69 (424)
                      ||||---|--.-=+..++++- .+..|-+...   | +.....++.+.+       +..|.+.|++.|++.+.|.|.|| 
T Consensus         4 kvLIANRGEIA~RiiRt~~el-gi~tVavys~~D~~a~hv~~ADeav~ig~~~~~~sYln~~~Ii~~A~~~g~dAihPGY   82 (449)
T PRK08591          4 KILIANRGEIALRILRACKEL-GIKTVAVHSTADRDALHVQLADEAVCIGPAPSKKSYLNIPAIISAAEITGADAIHPGY   82 (449)
T ss_pred             EEEEECCCHHHHHHHHHHHHC-CCCEEEECCHHHCCCCHHHHCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCCEEECCC
T ss_conf             488967849999999999984-9949998685752785288598889958988433304899999999982999897274


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEEE
Q ss_conf             ---9557874899898605880670106665552010235788876531011112--23440111112101242025630
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVKp  144 (424)
                         +|.|   .++..++++|+..+||+.++.+..+||..+|+++.++|+|+.++.  .+++.+++.++++++|||++|||
T Consensus        83 GFLSEna---~FA~~~~~~Gi~fIGP~~~~i~~~GdK~~ar~~a~~agVPvvpgs~~~~~~~~ea~~~a~~iGyPv~iKA  159 (449)
T PRK08591         83 GFLSENA---DFAEICEDSGFTFIGPSAETIRLMGDKVTAKATMKKAGVPVVPGSDGPVDDEEEALAIAKEIGYPVIIKA  159 (449)
T ss_pred             CHHHCCH---HHHHHHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             2432589---9999999879999992999999876989999999983999788876655689999999987499669885


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCC----CC-CCCCCCC
Q ss_conf             46534300023235677888788751445-----3177788775205-75234421577-631035----20-0011135
Q gi|254780206|r  145 DGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFT----TA-RDHKRIH  212 (424)
Q Consensus       145 ~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~----~~-~dyKr~~  212 (424)
                      +...||||+.++++.+|+.++++.+-.++     +..|+||+|++.+ .+-|+++.|+. +++.|.    .. |-|.++-
T Consensus       160 ~~GGGGrGmrvv~~~~el~~~~~~~~~Ea~~aFg~~~v~iEk~i~~~RHIEVQilgD~~Gn~vhl~eRdCSiQRR~QKvI  239 (449)
T PRK08591        160 TAGGGGRGMRVVRTEAELEKAFSMARAEAKAAFGNPGVYMEKYLENPRHIEIQVLADGHGNAIHLGERDCSLQRRHQKVL  239 (449)
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEECCCCCEEECCCCCCCHHHCCCEEE
T ss_conf             26898776999856789999999999999973799856787712565367899986389988987477567201461379


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEE--CCCCCEE
Q ss_conf             66544444344300001234432220100000899999862046235664454489855704899988651--4775104
Q gi|254780206|r  213 DGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRF--GDPECQA  290 (424)
Q Consensus       213 ~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~--GDPE~q~  290 (424)
                      |.            +|+|.+++++.+++    .+..++..+.  +.|+|.--++|++.++..|.||.|+|+  --|=|+.
T Consensus       240 EE------------aPap~l~~~~r~~m----~~~A~~la~~--v~Y~~aGTvEFL~d~~~fyFlEmNtRlQVEHpVTE~  301 (449)
T PRK08591        240 EE------------APSPAITEELRRKI----GEAAVKAAKA--IGYRGAGTIEFLYENGEFYFIEMNTRIQVEHPVTEM  301 (449)
T ss_pred             EE------------CCCCCCCHHHHHHH----HHHHHHHHHH--CCCCCCEEEEEEEECCEEEEEEEECCCCCCCCCCHH
T ss_conf             97------------79987899999999----9999999997--496421038999978908999624341245652266


Q ss_pred             EEECCCCCCHHHHHHHHHCCCC---CCCCCCCCCCEEEEEECCCCCCCCC--CCCCCCCCCCCCCCCCEEEEEEEEEECC
Q ss_conf             4332654411566654201333---3212344442067542254466877--5797624876668986899833587788
Q gi|254780206|r  291 MMMRLESDILEILNSCVHGNLH---NTHINWKAEYALTVVVATKGYPEEY--PHGTIISKIPQNTGTTQLFHAGTAIVNN  365 (424)
Q Consensus       291 ilp~L~~dl~~il~~~~~g~L~---~~~~~~~~~~~v~Vvlas~GYP~~~--~kg~~I~~l~~~~~~~~ifhagt~~~~g  365 (424)
                         .-.-||+...+.++.|.--   ..++++ .++++-+=+.+.. |..+  ..|. |+.+....+...-.-+++  ..|
T Consensus       302 ---vtGiDLV~~Qi~iA~G~~L~~~q~~i~~-~GhAIE~Ri~AEd-P~~f~Ps~G~-i~~~~~P~g~gvRvDt~~--~~G  373 (449)
T PRK08591        302 ---ITGVDLVKEQIRIAAGEPLSIKQEDIVF-RGHAIECRINAED-PKNFMPSPGK-ITRYHPPGGPGVRVDSHV--YTG  373 (449)
T ss_pred             ---HHCCCHHHHHHHHHCCCCCCCCCCCCCC-CCCCHHEEECCCC-CCCCCCCCEE-EEEEECCCCCCEEEECCC--CCC
T ss_conf             ---5077199999998679999977100675-7611210101358-4546788727-879974899988995881--568


Q ss_pred             EEEEC--CCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             79981--88079999962898999999999985258999575351789
Q gi|254780206|r  366 NLTAN--GGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       366 ~l~t~--GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                      ..++.  -+=+.-+++.|.|.++|..+..++++.....|.  ++-|.+
T Consensus       374 ~~v~~~YDsmlaKlI~~g~~R~~Ai~rl~~AL~e~~I~Gv--~TN~~~  419 (449)
T PRK08591        374 YTIPPYYDSMIGKLIVHGETREEAIARMKRALSEFVIDGI--KTTIPL  419 (449)
T ss_pred             CEECCCCCCHHCEEEEECCCHHHHHHHHHHHHHCCEEECC--CCCHHH
T ss_conf             9848874553203889789999999999999736699796--686999


No 31 
>PRK07178 acetyl-CoA carboxylase; Validated
Probab=99.95  E-value=2.5e-25  Score=203.01  Aligned_cols=380  Identities=14%  Similarity=0.195  Sum_probs=248.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC---CC-HHHHHCCEEEEC------CCCCHHHHHHHHHHHCCCEEEEC--
Q ss_conf             5899886588999999998589967899954---98-357511705512------87898999999987189799997--
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP---GN-PGIAQHAQCVAI------DIQNHSAIIHFCQEKHIDLVVVG--   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p---gN-~g~~~~~~~~~i------~~~d~~~i~~~a~~~~iDlvivg--   69 (424)
                      ||||---|--.-=+..++++-. +..|-+..   .| +.....++.+.+      +..|.+.|++.|++.+.|.+.||  
T Consensus         4 kvLIANRGEIA~RiiRt~~elg-i~tVavys~~D~~a~hv~~ADea~~ig~~~~~sYln~~~Ii~~A~~~g~dAiHPGYG   82 (471)
T PRK07178          4 KILIANRGEIAVRIVRACAEMG-IRSVAIYSEADRHALHVKRADEAHSIGADPLAGYLNPRKLVNLAVETGCDALHPGYG   82 (471)
T ss_pred             EEEEECCCHHHHHHHHHHHHCC-CCEEEEECHHHCCCHHHHHCCEEEECCCCHHHHHCCHHHHHHHHHHHCCCEEECCCC
T ss_conf             0899778699999999999839-948999083756683688488888718872665449999999999969999977833


Q ss_pred             --CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             --9557874899898605880670106665552010235788876531011112--234401111121012420256304
Q gi|254780206|r   70 --PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        70 --pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                        +|.|   .++.+++++|+..+||+.++.+..+||..+|+++.++|+|+.++.  .+++.+++.++++++|||++|||.
T Consensus        83 FLSEn~---~FA~~~~~~gi~FIGPs~~~i~~~GdK~~ar~~a~~~gvPv~pgs~~~v~~~eea~~~A~~iGyPV~lKAa  159 (471)
T PRK07178         83 FLSENA---ELAEICAERGIKFIGPSADVIRRMGDKTEARRSMIKAGVPVTPGSEGNLADIDEALAEAERIGYPVMLKAT  159 (471)
T ss_pred             HHHCCH---HHHHHHHHCCCEEECCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEC
T ss_conf             311598---99999997899899959999998748398999999869982689688656699999999866981586320


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHC-CCCCEEEECCCC-CCCCCC----CCC-CCCCCCC
Q ss_conf             6534300023235677888788751445-----317778877520-575234421577-631035----200-0111356
Q gi|254780206|r  146 GLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEG-FEVSFFALCDGK-TAIPFT----TAR-DHKRIHD  213 (424)
Q Consensus       146 ~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G-~E~Sv~~i~dG~-~~~~l~----~~~-dyKr~~~  213 (424)
                      ...||||+.++++.+|+.++++.+..++     +..|+||+|+.. .++-++++.||. +++.|.    ..| -|.++-|
T Consensus       160 ~GGGGrGmrvv~~~~el~~~~~~~~~EA~~aFg~~~v~lEk~i~~~RHIEVQilgD~~Gnvihl~eRdCSiQRr~QKvIE  239 (471)
T PRK07178        160 SGGGGRGIRRCNSREELEQNFPRVISEATKAFGSAEVFLEKCIVNPKHIEVQILADSFGNVVHLFERDCSIQRRNQKLIE  239 (471)
T ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCEEEEEEEEEECCCCEEEEEEEECCCCCCCCCEEE
T ss_conf             26876644997660568899999999999844997368766046762899999980789888884123465107873278


Q ss_pred             CCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEE
Q ss_conf             65444443443000012344322201000008999998620462356644544898557048999886514775104433
Q gi|254780206|r  214 GDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM  293 (424)
Q Consensus       214 ~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp  293 (424)
                                  .+|+|.+++++.+++.+    .+++-.+.  +.|.|.--++|++.++..|+||+|+|+- .|--+-=.
T Consensus       240 ------------eaPa~~l~~~~r~~l~~----~A~~la~~--v~Y~gaGTvEFlv~~~~~yFlEvNtRlQ-VEH~VTE~  300 (471)
T PRK07178        240 ------------IAPSPQLTPEQRAYIGD----LAVRAAKA--VGYENAGTVEFLLADGEVYFMEMNTRVQ-VEHTITEE  300 (471)
T ss_pred             ------------ECCCCCCCHHHHHHHHH----HHHHHHHH--CCCCEEEEEEEEEECCCEEEEECCCCCC-CCCCHHHH
T ss_conf             ------------76999888999999988----99999996--4865012699998679479983246665-55421366


Q ss_pred             CCCCCCHHHHHHHHHCCCC---CCCCCCCCCCEEEEEECCCCCCCC---CCCCCCCCCCCCCCCCCEEEEEEEEEECCEE
Q ss_conf             2654411566654201333---321234444206754225446687---7579762487666898689983358778879
Q gi|254780206|r  294 RLESDILEILNSCVHGNLH---NTHINWKAEYALTVVVATKGYPEE---YPHGTIISKIPQNTGTTQLFHAGTAIVNNNL  367 (424)
Q Consensus       294 ~L~~dl~~il~~~~~g~L~---~~~~~~~~~~~v~Vvlas~GYP~~---~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l  367 (424)
                      .-.-||+...+.++.|.--   ..++.+ +++++-.=+.+.. |.+   +..|. |+.+....+...-+.+++  ..|..
T Consensus       301 vtGiDLV~~Qi~iA~G~~L~~~q~~i~~-~GhAIe~Ri~AED-p~~~F~Ps~G~-i~~~~~P~g~gvR~Dt~~--~~G~~  375 (471)
T PRK07178        301 ITGIDIVREQIRIASGLPLSVKQEDIQH-RGFALQFRINAED-PKNNFLPSFGK-ITRYYAPGGPGVRTDTAI--YTGYT  375 (471)
T ss_pred             HHCCCHHHHHHHHHCCCCCCCCCCCCCC-CCCEEEEEEECCC-CCCCCCCCCCE-EEEEECCCCCCEEEECCC--CCCCE
T ss_conf             6167589999998679978831024455-8858999985137-76686568725-778976999988986677--68896


Q ss_pred             EECC--CCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             9818--8079999962898999999999985258999575351789
Q gi|254780206|r  368 TANG--GRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       368 ~t~G--GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                      ++..  +=+.-+++.|.|.++|..+..+.++.....|.  .|.|.+
T Consensus       376 v~~~yDsmlaKli~~g~~R~~Ai~rl~~aL~e~~I~Gv--~Tni~~  419 (471)
T PRK07178        376 IPPYYDSMCLKLIVWALTWEEALDRGLRALDDMRVQGV--KTTAPY  419 (471)
T ss_pred             ECCCCCCHHHHHEEECCCHHHHHHHHHHHHHCCEEECC--CCCHHH
T ss_conf             18874425361048889999999999998626599794--686999


No 32 
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: IPR005905    D-alanine--D-alanine ligase (6.3.2.4 from EC) is a bacterial enzyme involved in cell-wall biosynthesis. It participates in forming UDP-N-acetylmuramoyl pentapeptide, the peptidoglycan precursor. These enzymes are proteins of 300 to 360 amino acids containing many conserved regions. The N-terminal Gly-rich region could be involved in ATP-binding.    This family of enzymes represent chromosomal versions of species not specifically resistant to glycopeptide antibiotics such as vancomycin. The mechanism of glycopeptide antibiotic resistance involves the production of D-alanine-D-lactate (VanA and VanB families) or D-alanine-D-serine (VanC). This model attempts to exclude the VanA/VanB and VanC subfamilies while capturing most other D-Ala-D-Ala ligases above the trusted cut-off. However, changes in small numbers of amino acids, as demonstrated crystallographically, can alter specificity. In chlamydial species, this enzyme is found as a fusion protein with UDP-N-acetylmuramate--alanine ligase. ; GO: 0008716 D-alanine-D-alanine ligase activity, 0009252 peptidoglycan biosynthetic process, 0005737 cytoplasm.
Probab=99.94  E-value=1.9e-26  Score=211.21  Aligned_cols=232  Identities=20%  Similarity=0.315  Sum_probs=173.1

Q ss_pred             HCCCEEEE---CC-CHHHHHH-HHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCC--CCCHHHH---
Q ss_conf             18979999---79-5578748-9989860588067010666555201023578887653101111223--4401111---
Q gi|254780206|r   61 KHIDLVVV---GP-ELPLVNG-ISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHF--SDPMKAK---  130 (424)
Q Consensus        61 ~~iDlviv---gp-E~pL~~g-i~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~--~~~~ea~---  130 (424)
                      ..+|.||+   || -=  -+| |...|+-+|||+.||.-.|+.+..||.+||.++++.|||||+|..+  .+.....   
T Consensus       105 ~~~D~vF~~LHG~~~G--EDGtiQGlLe~~gIPY~Gsgv~aSA~smDK~~tK~~~~~~Glp~~~y~~l~~~~~~~~~~~~  182 (375)
T TIGR01205       105 EEIDVVFPVLHGPPYG--EDGTIQGLLELLGIPYTGSGVLASALSMDKLLTKLLLKSLGLPTPDYAVLRRKERSSEDEAE  182 (375)
T ss_pred             CCCCEEEEEECCCCCC--CCCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH
T ss_conf             4798899812185668--55528999997078703747899998742899999998757974470467504544561346


Q ss_pred             ----HHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHH---HHCCCCCEEEECCCCCCCCC-
Q ss_conf             ----1210124202563046534300023235677888788751445317778877---52057523442157763103-
Q gi|254780206|r  131 ----QYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEY---LEGFEVSFFALCDGKTAIPF-  202 (424)
Q Consensus       131 ----~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEef---l~G~E~Sv~~i~dG~~~~~l-  202 (424)
                          ..++.+|||++|||..+.+|-||.+|.+++|+..+++.+| ..+.+||||+|   |.|+|++|.+|-+++.+..+ 
T Consensus       183 ~~~~~~~~~lg~P~~VKPa~~GSSvG~~~V~~~~eL~~a~~~Af-~~d~~v~vE~~~~~i~grEl~v~~L~~~~~lp~~~  261 (375)
T TIGR01205       183 CENVAVLEKLGFPVFVKPAREGSSVGISKVKSEEELEAALDEAF-KYDERVIVEEFKQRIKGRELEVSILGNEEALPIIS  261 (375)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCEEEEEEECCHHHHHHHHHHHH-CCCCEEEEEECCCCCCCCEEEEEEEECCCCCEEEE
T ss_conf             89999998368978997346777577898467789999999861-55965999811147898526898870797432454


Q ss_pred             --C--C------CCCCCCCCCCCCCCCCCCCCEEECCC-CCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC
Q ss_conf             --5--2------00011135665444443443000012-34432220100000899999862046235664454489855
Q gi|254780206|r  203 --T--T------ARDHKRIHDGDIGPNTGGMGACSPAL-GMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE  271 (424)
Q Consensus       203 --~--~------~~dyKr~~~~d~GpnTGGMGa~~p~~-~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~  271 (424)
                        +  .      --||+..|..+.|-+.     ..|++ .++++..+++    -+-.+++.+..++  +|...+|||+++
T Consensus       262 ~~~~~~~~g~~~FYDY~~KY~~~~g~~~-----~~pa~~~L~~~~~~~i----~~~a~~ay~~~~~--~G~~R~DFf~~~  330 (375)
T TIGR01205       262 IVPEIEPDGGSDFYDYEAKYLDGDGTEY-----VIPAPAGLDEELEEKI----KELALKAYKALGC--RGLARVDFFLDK  330 (375)
T ss_pred             CCCCCCCCCCCEECCHHHCCCCCCCCEE-----EECCCCCCCHHHHHHH----HHHHHHHHHHCCC--CCEEEEEEEEEC
T ss_conf             0675356767600002114277887326-----5156567888999999----9999999984088--744899899872


Q ss_pred             C-E-EEEEEEEEEECCCCCEEEEECCCC----CCHHHHHHHH
Q ss_conf             7-0-489998865147751044332654----4115666542
Q gi|254780206|r  272 Q-G-PYLIEYNVRFGDPECQAMMMRLES----DILEILNSCV  307 (424)
Q Consensus       272 ~-g-p~viE~N~R~GDPE~q~ilp~L~~----dl~~il~~~~  307 (424)
                      + | +|++|+|+=.| ..+-.+.|.+-.    +|-+|+..++
T Consensus       331 ~~G~~yLnEiNT~PG-mT~~Sl~P~~~~~~G~~f~~Lv~~~~  371 (375)
T TIGR01205       331 ETGEIYLNEINTIPG-MTAISLFPKAAAAAGLEFEQLVERIL  371 (375)
T ss_pred             CCCEEEEEEECCCCC-CCCHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             888699998768888-72012699999971888789999999


No 33 
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed
Probab=99.94  E-value=3e-26  Score=209.71  Aligned_cols=233  Identities=21%  Similarity=0.261  Sum_probs=168.2

Q ss_pred             HHHCCCEEEE---C--CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHH---H
Q ss_conf             8718979999---7--955787489989860588067010666555201023578887653101111223440111---1
Q gi|254780206|r   59 QEKHIDLVVV---G--PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKA---K  130 (424)
Q Consensus        59 ~~~~iDlviv---g--pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea---~  130 (424)
                      ...++|++++   |  -|+=-   +...|+..|||..|++..++.|..||..+|.+|+++|||||+|..++..+..   .
T Consensus        87 ~~~~~D~vf~alHG~~GEDG~---iQglLe~l~IPYtGs~~~asal~mDK~~tK~i~~~~gI~tp~~~~~~~~~~~~~~~  163 (344)
T PRK01966         87 LIIEVDVVFPVLHGPPGEDGT---IQGLLELLNIPYVGCGVLASAVSMDKILTKRLLAAAGIPQAPYVVLTRSRREEAIA  163 (344)
T ss_pred             CCCCCCEEEEECCCCCCCCHH---HHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHH
T ss_conf             035678999906899976709---99999975999368848999987669999999998799989839981666234589


Q ss_pred             HHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCC----
Q ss_conf             1210124202563046534300023235677888788751445317778877520575234421577631035200----
Q gi|254780206|r  131 QYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTAR----  206 (424)
Q Consensus       131 ~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~----  206 (424)
                      .....++||++|||....++.||.++++.+|+.++++.+|. .+++|||||||+|.|++|-++-++.....+|+.+    
T Consensus       164 ~~~~~l~~P~iVKP~~~GSSiGvs~v~~~~el~~ai~~a~~-~~~~vlvEefI~GrE~tv~vl~~~~~~~~l~~~Ei~~~  242 (344)
T PRK01966        164 EVEEKLGLPVFVKPANLGSSVGISKVKNEEELEAALDLAFE-YDRKVLVEQGIKGREIECAVLGYNDEPVASVPGEIVKD  242 (344)
T ss_pred             HHHHHCCCCEEEECCCCCCCCCEEEECCHHHHHHHHHHHHH-CCCCCEEECCCCCEEEEEEEECCCCCEEEECCEEECCC
T ss_conf             99986189879932899634325996899999999999986-39750575124448999999748994677311587179


Q ss_pred             ----CCCCCCCCCCCCCCCCCCE-EECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEE
Q ss_conf             ----0111356654444434430-000123443222010000089999986204623566445448985570-4899988
Q gi|254780206|r  207 ----DHKRIHDGDIGPNTGGMGA-CSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYN  280 (424)
Q Consensus       207 ----dyKr~~~~d~GpnTGGMGa-~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N  280 (424)
                          ||+..|.      ++|... ++|++ +++++.++    +-+-+.++.+..|+  +|+..+|||++++| ||+||+|
T Consensus       243 ~~fydy~~KY~------~~~~~~~~~Pa~-l~~~~~~~----i~~~a~~~~~~lg~--rg~~RiDf~~d~~g~~y~lEvN  309 (344)
T PRK01966        243 NDFYDYEAKYI------DDSGATLVIPAD-LSEELTEQ----IRELAIKAFKALGC--SGLARVDFFLTEDGEIYLNEIN  309 (344)
T ss_pred             CCCCCHHHCCC------CCCCCEEECCCC-CCHHHHHH----HHHHHHHHHHHHCC--CCEEEEEEEEECCCCEEEEEEE
T ss_conf             87514888104------689716966788-99999999----99999999998199--7279898999089988999820


Q ss_pred             EEECCCCCEEEEECC----CCCCHHHHHHHHHC
Q ss_conf             651477510443326----54411566654201
Q gi|254780206|r  281 VRFGDPECQAMMMRL----ESDILEILNSCVHG  309 (424)
Q Consensus       281 ~R~GDPE~q~ilp~L----~~dl~~il~~~~~g  309 (424)
                      +=.|= ....++|.+    .-++-+++..+++.
T Consensus       310 t~PGm-T~~Sl~p~~a~~~G~s~~~li~~ii~~  341 (344)
T PRK01966        310 TLPGF-TPISMYPKLWEASGLSYPELIDRLIEL  341 (344)
T ss_pred             CCCCC-CCCCHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             89998-754789999998099999999999999


No 34 
>PRK08463 acetyl-CoA carboxylase; Validated
Probab=99.94  E-value=2.4e-24  Score=195.99  Aligned_cols=380  Identities=15%  Similarity=0.215  Sum_probs=246.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC---CCH-HHHHCCEEEEC------CCCCHHHHHHHHHHHCCCEEEEC--
Q ss_conf             5899886588999999998589967899954---983-57511705512------87898999999987189799997--
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP---GNP-GIAQHAQCVAI------DIQNHSAIIHFCQEKHIDLVVVG--   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p---gN~-g~~~~~~~~~i------~~~d~~~i~~~a~~~~iDlvivg--   69 (424)
                      ||||---|--.-=+..++.+- .+..|-+..   .+. ......+.+.+      +..|.+.|++.|++.+.|.+.||  
T Consensus         4 kvLIANRGEIA~Riirt~rel-gi~tVavys~~D~~s~hv~~Adea~~lg~~~~~sYLn~~~Ii~~A~~~gadAiHPGYG   82 (478)
T PRK08463          4 KILIANRGEIAVRIIRACRDL-HIKSVAIYTEPDRECLHVKIADEAYRIGTDPIKGYLDVKRIVEIAKACGADAIHPGYG   82 (478)
T ss_pred             EEEEECCCHHHHHHHHHHHHC-CCCEEEEECHHHCCCCHHHHCCEEEECCCCHHHHHCCHHHHHHHHHHHCCCEEECCCC
T ss_conf             178966869999999999983-9978999785765783477578766528873453069999999999849999936876


Q ss_pred             --CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC-C--CCCCHHHHHHHHCCCCEEEEEE
Q ss_conf             --9557874899898605880670106665552010235788876531011112-2--3440111112101242025630
Q gi|254780206|r   70 --PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ-H--FSDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus        70 --pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~-~--~~~~~ea~~~~~~~g~PvVVKp  144 (424)
                        +|.|   .++..++++|+..+||+.++.+..+||.-+|++|.++|+|+.++. .  .++.+++.++++++|||+++|+
T Consensus        83 FLSEna---~FA~~~~~~Gi~FIGPs~~~i~~~GdK~~Ar~~a~~~gVPvvpg~~~~~~~~~~~~~~~a~~iGyPv~lKA  159 (478)
T PRK08463         83 FLSENY---EFAKAVEDAGLIFIGPKSEVIRKMGNKNIARKLMAKNGIPIVPGTEKLNSESMEEIKIFARKIGYPVILKA  159 (478)
T ss_pred             CCCCCH---HHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             234699---99999997899899949999999864899999999839984667677887679999999986598047840


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCCC----C-CCCCCCC
Q ss_conf             46534300023235677888788751445-----3177788775205-75234421577-6310352----0-0011135
Q gi|254780206|r  145 DGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFTT----A-RDHKRIH  212 (424)
Q Consensus       145 ~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~~----~-~dyKr~~  212 (424)
                      ....||||+.++++.+|+.++++.+..++     ++.|++|+|++.+ .+-++++.|+. +++.|..    . +-|.++-
T Consensus       160 ~~GGGGrGmrvv~~~~el~~~~~~a~~ea~~~Fg~~~v~iEk~i~~~RHiEVQvlgD~~Gnvi~l~eRdCSiQRr~QKvi  239 (478)
T PRK08463        160 SGGGGGRGIRVVWKEEDLENAFESCKREAKAYFNNDEVFMEKYVVNPRHIEFQILGDNYGNIIHLCERDCSIQRRHQKVI  239 (478)
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCEEEEEEEEEECCCCEEEEEEEECCCCCCCCEEE
T ss_conf             35999871178557899999999999999984699854788750245178999986179978896305134334675168


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEEE
Q ss_conf             6654444434430000123443222010000089999986204623566445448985570-489998865147751044
Q gi|254780206|r  213 DGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAM  291 (424)
Q Consensus       213 ~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~i  291 (424)
                      |            .+|+|.+++++.+++    .+.+++..+.  +.|.|.--++|+++++| .|+||.|+|+= .|--+-
T Consensus       240 E------------eaPap~l~~~~r~~m----~~~A~~la~~--v~Y~~aGTvEFL~d~~~~fyFlEmNtRlQ-VEHpVT  300 (478)
T PRK08463        240 E------------IAPCPGISDNLRKTM----GVTAVAAAKA--VGYTNAGTIEFLLDDYNNFYFMEMNTRIQ-VEHGVT  300 (478)
T ss_pred             E------------ECCCCCCCHHHHHHH----HHHHHHHHHH--CCCCCCCEEEEEECCCCCEEEEEEECCCC-CCCCCC
T ss_conf             9------------669998788999999----8899876663--05166533898883899789996075545-566541


Q ss_pred             EECCCCCCHHHHHHHHHCCC---CCCCCCCCCCCEEEEEECCCCCCC---CCCCCCCCCCCCCCCCCCEEEEEEEEEECC
Q ss_conf             33265441156665420133---332123444420675422544668---775797624876668986899833587788
Q gi|254780206|r  292 MMRLESDILEILNSCVHGNL---HNTHINWKAEYALTVVVATKGYPE---EYPHGTIISKIPQNTGTTQLFHAGTAIVNN  365 (424)
Q Consensus       292 lp~L~~dl~~il~~~~~g~L---~~~~~~~~~~~~v~Vvlas~GYP~---~~~kg~~I~~l~~~~~~~~ifhagt~~~~g  365 (424)
                      =..-.-||+..-+.++.|..   ...++.+ .++++-+=+.+.. |.   .+..|. |+.+....+...-+.+++  ..|
T Consensus       301 E~vTGvDLV~~Qi~iA~G~~L~~~q~~i~~-~GhAIE~RI~AEd-p~~~F~Ps~G~-i~~~~~p~g~gvRvDs~~--~~G  375 (478)
T PRK08463        301 EEITGIDLIVRQIRIAAGEILDLEQSDIKP-RGFAIEARITAEN-VWKNFIPSPGK-ITGYYPALGPSVRVDSHI--YKD  375 (478)
T ss_pred             CEECCCCHHHHHHHHHCCCCCCCCCCCCCC-CCEEEEEEEECCC-CCCCCCCCCEE-EEEEECCCCCCEEEECCC--CCC
T ss_conf             100388689999998679988854003466-7459999985147-76674658748-878972899998980886--786


Q ss_pred             EEEECC--CCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             799818--8079999962898999999999985258999575351789
Q gi|254780206|r  366 NLTANG--GRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       366 ~l~t~G--GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                      ..++.-  +=+.-+++.|.|.++|..+..+.++.....|.  +|.|.+
T Consensus       376 ~~v~~~yDsmiaKlI~~g~~R~~Ai~rl~~AL~e~~I~Gv--~Tni~~  421 (478)
T PRK08463        376 YTIPPFYDSMLAKLIVKATSYDLAVNKLERALKEFTIEGV--RTTIPF  421 (478)
T ss_pred             CCCCCCCCHHHCEEEEECCCHHHHHHHHHHHHHCCEEECC--CCCHHH
T ss_conf             9808975704534889889999999999999726699895--585999


No 35 
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism]
Probab=99.94  E-value=1.5e-24  Score=197.52  Aligned_cols=363  Identities=19%  Similarity=0.256  Sum_probs=235.4

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCH
Q ss_conf             958998865--88999999998589967899954983575----117055128789899999998718979999--7955
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPEL   72 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~   72 (424)
                      |+|..-+-|  .+-.| |.+|+++..  .|.....||.+.    ..++.+++.+...+.+.++++++++|.+++  |.+.
T Consensus         6 i~Igqa~efdysG~qa-c~aLkeeg~--~vvlvnsnpAti~td~e~AD~~y~eP~~~E~v~~Ii~~E~~Dailp~~ggqt   82 (400)
T COG0458           6 IVIGQAAEFDYSGTQA-CKALKEEGY--GVVLVNSNPATIMTDPELADKVYIEPITKEPVEKIIEKERPDAILPTLGGQT   82 (400)
T ss_pred             EEEEEEEEECHHHHHH-HHHHHHCCC--EEEEECCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCEEECCCCCCC
T ss_conf             0667641114367899-999986697--5999728872124780005302662473788999997537662632468741


Q ss_pred             HHHHH--HHH--HHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCC
Q ss_conf             78748--998--98605880670106665552010235788876531011112234401111121012420256304653
Q gi|254780206|r   73 PLVNG--ISD--ALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLC  148 (424)
Q Consensus        73 pL~~g--i~d--~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~a  148 (424)
                      +|-..  +.+  .|++.|++++|.+.++.++..||..+|++|++.|+|+| ....++.+++.++.+++|||+||||....
T Consensus        83 ~Ln~~~~l~e~g~l~~~gV~vvgs~~eaI~iaeDr~~fke~m~eigi~~P-~~~~~~~~e~~~~~~~ig~PvIVrP~~~l  161 (400)
T COG0458          83 ALNAALELKEKGVLEKYGVEVVGSDPEAIEIAEDKKLFKEAMREIGIPVP-SRIAHSVEEADEIADEIGYPVIVKPSFGL  161 (400)
T ss_pred             HHHHHHHHHHHCCHHHCCCEEEECCHHHHHHHHHHHHHHHHHHHCCCCCC-CCCCCCHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             34688998772645644977994587895564209999999998399988-41235677776557636997798068578


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHCC-CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             4300023235677888788751445-3177788775205-7523442157763103520001113566544444344300
Q gi|254780206|r  149 AGKGVVVAATVDEATSAIDRCFQQI-NSTVIIEEYLEGF-EVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGAC  226 (424)
Q Consensus       149 gGkGV~i~~~~~e~~~~~~~~~~~~-~~~VliEefl~G~-E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~  226 (424)
                      ||.|+.+++|.+|+.+.....+..+ .++||+||++.|. |+...+..|++.-.+......  +.  ...|..||--...
T Consensus       162 GG~G~~i~~n~eel~~~~~~~l~~s~~~~vl~eesi~G~ke~e~ev~rd~~~n~ivvc~me--n~--dp~gvhtgdsi~v  237 (400)
T COG0458         162 GGSGGGIAYNEEELEEIIEEGLRASPVEEVLIEESIIGWKEFEYEVVRDGKDNCIVVCNME--NL--DPMGVHTGDSITV  237 (400)
T ss_pred             CCCCEEEEECHHHHHHHHHHCCCCCCCCCCEEEEEECCCEEEEEEEEEECCCCEEEEEECC--CC--CCCCCCCCCEEEE
T ss_conf             8875168718999999987322447642001244216856999999983799879998678--65--6566444323652


Q ss_pred             ECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE--EEEEEEEEEECCCCCEEEEECCCCCCHHHHH
Q ss_conf             00123443222010000089999986204623566445448985570--4899988651477510443326544115666
Q gi|254780206|r  227 SPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMMMRLESDILEILN  304 (424)
Q Consensus       227 ~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g--p~viE~N~R~GDPE~q~ilp~L~~dl~~il~  304 (424)
                      +|+..+++...+-. +.   -.++.++..++.  |-..+|+.+.+++  .+|||+|+|++--   .-|+.--+. +++..
T Consensus       238 apaqtl~d~eyq~~-r~---~~~~iir~igi~--G~~niQ~av~~~~~~~~viEvNpRvSrs---saLaskAtg-ypia~  307 (400)
T COG0458         238 APAQTLTDKEYQML-RD---AAIKVIREIGIE--GGCNIQFAVDPGGGELYVIEINPRVSRS---SALASKATG-YPIAK  307 (400)
T ss_pred             CCCCCCCCHHHHHH-HH---HHHHHHHHHCCC--CCCCEEEEECCCCCEEEEEEECCCCCCC---CHHHHHCCC-CHHHH
T ss_conf             14556543788998-88---777788874114--7873148986998559999956876764---031554468-76999


Q ss_pred             H---HHHC-CCCCCCCCCCCCCEEEEEECCCCCC-CCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEE
Q ss_conf             5---4201-3333212344442067542254466-877579762487666898689983358778879981880799999
Q gi|254780206|r  305 S---CVHG-NLHNTHINWKAEYALTVVVATKGYP-EEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATA  379 (424)
Q Consensus       305 ~---~~~g-~L~~~~~~~~~~~~v~Vvlas~GYP-~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~  379 (424)
                      -   .+-| .|+++.    +.-  +.    .+++ ..+..+.+...++.- ...+.+++ -........+ .|+|   .+
T Consensus       308 vaakla~g~~l~Ei~----n~i--t~----~t~a~fePsldyvv~k~pr~-~f~kf~~~-~~~l~~~mks-~gev---m~  371 (400)
T COG0458         308 VAAKLAVGYTLDEIR----NDI--TG----RTPASFEPSLDYVVTKIPRF-DFEKFPGA-DRRLGTQMKS-VGEV---MA  371 (400)
T ss_pred             HHHHHHCCCCCHHHC----CCC--CC----CCCCCCCCCCCEEEEECCCC-CCCCCCCC-CCCEEEEEEC-CCEE---EE
T ss_conf             999750356706544----766--44----43444577666036634778-73213455-6331002300-1028---99


Q ss_pred             ECCCHHHHHHHHHHHHHC
Q ss_conf             628989999999999852
Q gi|254780206|r  380 LGKTITESRELAYHMVEN  397 (424)
Q Consensus       380 ~g~~l~eA~~~ay~~i~~  397 (424)
                      .|.|+++|..+|.+.++.
T Consensus       372 igr~f~eal~ka~~~l~~  389 (400)
T COG0458         372 IGRTFEEALQKALRSLEI  389 (400)
T ss_pred             ECCHHHHHHHHHHHHHCC
T ss_conf             631299999999986114


No 36 
>PRK12999 pyruvate carboxylase; Reviewed
Probab=99.93  E-value=1.5e-23  Score=190.15  Aligned_cols=374  Identities=20%  Similarity=0.296  Sum_probs=249.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC---CCH-HHHHCCEEEEC--------CCCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             5899886588999999998589967899954---983-57511705512--------87898999999987189799997
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP---GNP-GIAQHAQCVAI--------DIQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p---gN~-g~~~~~~~~~i--------~~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      ||||---|--.--+..++.+- .+..|-+..   .+. .....++.+.+        ...|.+.|++.|++.+.|.+.||
T Consensus         7 kvLiANRGEIA~Ri~Ra~~el-gi~tVavys~~D~~s~h~~~ADea~~ig~~~~p~~sYL~~~~ii~~A~~~~~dAiHPG   85 (1147)
T PRK12999          7 KVLVANRGEIAIRIFRAATEL-GIRTVAIYSEEDKLSLHRFKADEAYLIGEGKGPIEAYLDIDEIIRVAKQAGVDAIHPG   85 (1147)
T ss_pred             EEEEECCCHHHHHHHHHHHHC-CCCEEEEECHHHCCCHHHHHCCEEEEECCCCCHHHHHCCHHHHHHHHHHHCCCEEECC
T ss_conf             899966819999999999983-9958999784645782588588567728999713111299999999999498999779


Q ss_pred             ----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             ----9557874899898605880670106665552010235788876531011112--2344011111210124202563
Q gi|254780206|r   70 ----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus        70 ----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVK  143 (424)
                          +|.+   .++.+++++||..+||+.++.++.+||..+|+++.++|+|+.++.  .+++.+++.++++++|||++||
T Consensus        86 YGFLSEn~---~Fa~~~~~~gi~fIGP~~~~i~~~GdK~~ar~~a~~~gvPvvpgs~~~~~~~~~~~~~a~~iGyPv~iK  162 (1147)
T PRK12999         86 YGFLSENP---EFARACAEAGITFIGPTAEVLRLLGDKVAARNAAIKAGVPVIPGTEGPIDDLEEALEFAEEIGYPLMLK  162 (1147)
T ss_pred             CCHHHCCH---HHHHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             62200799---999999987899989499999985599999999998398988898998899999999998719978999


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCCC----C-CCCCCC
Q ss_conf             046534300023235677888788751445-----3177788775205-75234421577-6310352----0-001113
Q gi|254780206|r  144 ADGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFTT----A-RDHKRI  211 (424)
Q Consensus       144 p~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~~----~-~dyKr~  211 (424)
                      ++...||||++++++.+|+.++++.+..++     +..|.+|+|++.+ -+-|+++.|+. +++.|..    . |-|.++
T Consensus       163 A~~GGGGrGmrvv~~~~~l~~~~~~a~~EA~~aFG~~~v~~Ek~i~~~rHiEvQilgD~~Gnvvhl~eRdCSiQRR~QKv  242 (1147)
T PRK12999        163 ASAGGGGRGMRIVRSEEELEEAFERAKREAKAAFGNDEVYLEKYVENPRHIEVQILGDKHGNVVHLYERDCSVQRRHQKV  242 (1147)
T ss_pred             ECCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEECCCCCEEEECCCCCCHHHCCCEE
T ss_conf             77789805148958989999999999999998369975688550367864799999628898887147656432235135


Q ss_pred             CCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEE
Q ss_conf             56654444434430000123443222010000089999986204623566445448985570-48999886514775104
Q gi|254780206|r  212 HDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQA  290 (424)
Q Consensus       212 ~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~  290 (424)
                      -|            .+|+|.+++++.+++    .+..++..+..|  |+|.=-++|+++.+| .|.||.|+|+- .|--+
T Consensus       243 iE------------eaPap~l~~~~r~~l----~~~A~~~a~~v~--Y~~aGTvEFL~d~~~~fyFiE~N~RlQ-VEH~V  303 (1147)
T PRK12999        243 VE------------IAPAPGLSPELREEI----CEAAVKLARAVG--YVNAGTVEFLVDADGNFYFIEVNPRIQ-VEHTV  303 (1147)
T ss_pred             EE------------ECCCCCCCHHHHHHH----HHHHHHHHHHCC--CCCCCEEEEEECCCCCEEEEEEECCCC-CCCCC
T ss_conf             78------------668999999999999----999999999769--764322789983888789998665656-45653


Q ss_pred             EEECCCCCCHHHHHHHHHCC-CCCCC--------CCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEE---
Q ss_conf             43326544115666542013-33321--------2344442067542254466877579762487666898689983---
Q gi|254780206|r  291 MMMRLESDILEILNSCVHGN-LHNTH--------INWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHA---  358 (424)
Q Consensus       291 ilp~L~~dl~~il~~~~~g~-L~~~~--------~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifha---  358 (424)
                      -=..-.-||+..-+.++.|. |....        +.. .++++-+=+.++. |   ..+.    .| ..+.+..|+.   
T Consensus       304 TE~vtGiDlV~~Qi~iA~G~~L~~~~~~~~~Q~~i~~-~G~Aie~Ri~aEd-p---~~~F----~P-~~G~i~~~~~p~G  373 (1147)
T PRK12999        304 TEMVTGIDIVQSQILIAEGATLGDLEVGIPSQEDIRL-RGHAIQCRITTED-P---ANNF----MP-DTGRITAYRSPGG  373 (1147)
T ss_pred             HHHEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-CEEEEEEEEEECC-C---CCCC----CC-CCCEEEEEECCCC
T ss_conf             0210155089999998579975667678775446776-6489999986117-7---5256----78-8774037846999


Q ss_pred             -EEEEECCEEEECCC--------CEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             -35877887998188--------079999962898999999999985258999575351789
Q gi|254780206|r  359 -GTAIVNNNLTANGG--------RVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       359 -gt~~~~g~l~t~GG--------RVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                       |+..+.|..+ .|.        =+.-+++.|.|.++|..+..+++...+..|.  .+-|.+
T Consensus       374 ~gvR~D~g~~~-~G~~v~p~yDsllaK~i~~g~~r~~ai~r~~raL~e~~i~Gv--~Tni~f  432 (1147)
T PRK12999        374 FGVRLDGGNAY-AGAVITPYYDSLLVKLTTWGRTFEEAIARMDRALREFRIRGV--KTNIPF  432 (1147)
T ss_pred             CCEEECCCCCC-CCCCCCCCCCCHHHHHEEECCCHHHHHHHHHHHHHHCEEECC--CCCHHH
T ss_conf             99896778676-789668875704252226669899999999998642399797--679999


No 37 
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549   This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase. Acetyl-CoA carboxylase (6.4.1.2 from EC) is a heterohexamer of biotin carboxyl carrier protein, biotin carboxylase (6.3.4.14 from EC), and two subunits of carboxyl transferase in a 2:2 complex. In the first step of long-chain fatty acid synthesis, biotin carboxylase catalyses the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-coA. Homologous domains are found in eukaryotic forms of acetyl-CoA carboxylase and in a number of other carboxylases (e.g. pyruvate carboxylase). In some systems, the biotin carboxyl carrier protein and this protein (biotin carboxylase) may be shared by different carboxyltransferases. However, this model is not intended to identify the biotin carboxylase domain of propionyl-coA carboxylase. The model should hit the full length of proteins, except for chloroplast transit peptides in plants. If it hits a domain only of a longer protein, there may be a problem with the identification.; GO: 0016874 ligase activity.
Probab=99.93  E-value=3.3e-24  Score=194.92  Aligned_cols=331  Identities=18%  Similarity=0.272  Sum_probs=242.4

Q ss_pred             CCCCCHHHHHHHHHHHCCCEEEEC----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCC-
Q ss_conf             287898999999987189799997----955787489989860588067010666555201023578887653101111-
Q gi|254780206|r   46 IDIQNHSAIIHFCQEKHIDLVVVG----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY-  120 (424)
Q Consensus        46 i~~~d~~~i~~~a~~~~iDlvivg----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~-  120 (424)
                      -+.+++..|+..|+-.+.|.+.||    +|.   |.+++.++..|+..+||++++.++.+||.-+|+.|+++|+||-+. 
T Consensus        58 kSYL~IpnI~aAA~~tG~~AiHPGYGFLSEN---A~FAe~c~~~g~~FIGP~pe~Ir~MGDK~~A~~~mKkaGVP~VPGS  134 (451)
T TIGR00514        58 KSYLNIPNIIAAAEITGADAIHPGYGFLSEN---ADFAEICEDHGITFIGPSPEAIRLMGDKVTAKETMKKAGVPVVPGS  134 (451)
T ss_pred             CCCCHHHHHHHHHHHCCCCEECCCCCHHHHH---HHHHHHHHHCCCEEECCCCCCCCCCCCHHHHHHHHHHCCCCEECCC
T ss_conf             2441158899988774880762887734431---2478898738826667871201126886899999974887662388


Q ss_pred             -C-CCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEE
Q ss_conf             -2-2344011111210124202563046534300023235677888788751445-----3177788775205-752344
Q gi|254780206|r  121 -Q-HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFA  192 (424)
Q Consensus       121 -~-~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~  192 (424)
                       - .+.|.+++.+.++++||||+||++...||||++++++.+|+.+.+..+-.++     +..|-+|+||+-| -+-+++
T Consensus       135 ~GP~~~~~~e~~~~A~~IGyPv~IKA~AGGGGRGmR~vR~~~El~~~~~~a~~EA~AAF~N~~VYiEKfienPRH~E~QV  214 (451)
T TIGR00514       135 DGPLVEDEEEAVRIAKEIGYPVIIKATAGGGGRGMRVVREEDELVKLIKAARAEAAAAFNNDGVYIEKFIENPRHVEIQV  214 (451)
T ss_pred             CCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCEEEEEE
T ss_conf             88631027889999974789689996258997225886286899999999999997402879627863336994079998


Q ss_pred             ECCC-CCCCCCCC----CC-CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEE
Q ss_conf             2157-76310352----00-011135665444443443000012344322201000008999998620462356644544
Q gi|254780206|r  193 LCDG-KTAIPFTT----AR-DHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAG  266 (424)
Q Consensus       193 i~dG-~~~~~l~~----~~-dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~  266 (424)
                      |-|+ .+++.|.-    .| -+.++-|.            +|+|-+++++.+++=+    ..+++-+.  +.|+|+==++
T Consensus       215 LAD~~GN~vyLgERDCSiQRR~QKllEE------------aPsP~Lt~ElR~~~G~----~Av~aA~~--iGY~GaGTvE  276 (451)
T TIGR00514       215 LADKYGNVVYLGERDCSIQRRNQKLLEE------------APSPALTSELREKMGD----AAVKAAKS--IGYTGAGTVE  276 (451)
T ss_pred             EECCCCCEEEECCCCCCHHCCCCCEEEE------------CCCCCCCHHHHHHHHH----HHHHHHHH--CCCEECCEEE
T ss_conf             7517888789712146200046544654------------6888778899999989----99999986--4980035168


Q ss_pred             EEEECCE--EEEEEEEEEECCCCCEEEEECC-CCCCHHHHHHHHHCCCCCCCCCCCCC------CEEEEEECCCCCCCCC
Q ss_conf             8985570--4899988651477510443326-54411566654201333321234444------2067542254466877
Q gi|254780206|r  267 LMITEQG--PYLIEYNVRFGDPECQAMMMRL-ESDILEILNSCVHGNLHNTHINWKAE------YALTVVVATKGYPEEY  337 (424)
Q Consensus       267 ~m~t~~g--p~viE~N~R~GDPE~q~ilp~L-~~dl~~il~~~~~g~L~~~~~~~~~~------~~v~Vvlas~GYP~~~  337 (424)
                      |++..+|  =|.+|.|+|.= -|=- +-.++ ..||+.-=++++.|.    ++.||.+      +++--=.=++      
T Consensus       277 FLld~~~~rFYFmEMNTRIQ-VEHP-VTEmvtGvDL~keQirvA~G~----~L~~kQe~v~~~GHaieCRINAE------  344 (451)
T TIGR00514       277 FLLDKNGQRFYFMEMNTRIQ-VEHP-VTEMVTGVDLIKEQIRVAAGE----KLSLKQEDVKLRGHAIECRINAE------  344 (451)
T ss_pred             EEEECCCCEEEEEEECCEEE-EEEC-CEEEEECHHHHHHHHHHHCCC----CCCCCCCEEEEEEEEEEEEECCC------
T ss_conf             88625887357765176021-1103-201460025788899873789----56643114799988998651455------


Q ss_pred             CCCCCCCCCCCCCCCCEEEEE--EE-EEECCEEEEC-------CCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEECC
Q ss_conf             579762487666898689983--35-8778879981-------8807999996289899999999998525899957535
Q gi|254780206|r  338 PHGTIISKIPQNTGTTQLFHA--GT-AIVNNNLTAN-------GGRVLSATALGKTITESRELAYHMVENIDWKHGYWRE  407 (424)
Q Consensus       338 ~kg~~I~~l~~~~~~~~ifha--gt-~~~~g~l~t~-------GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~~yR~  407 (424)
                         +|+.++-=.++.+.-||+  |- .+-|+..|+.       -|=+-=++..|+|-++|..+..++++...-+|.  .|
T Consensus       345 ---DP~~~F~PsPG~i~~ylpPGG~gVR~DSh~Y~gY~iPPyYDSmIaKlI~~G~~R~~AI~rMKrAL~E~~I~G~--~T  419 (451)
T TIGR00514       345 ---DPIKNFLPSPGRITSYLPPGGPGVRVDSHVYSGYTIPPYYDSMIAKLITYGKTREEAIARMKRALSEFIITGI--KT  419 (451)
T ss_pred             ---CCCCCCCCCCCCCCCCCCCCCCCEECCCEECCCCCCCCCCHHCCEEEEECCCCHHHHHHHHHHHHHHHEECCC--CC
T ss_conf             ---8787786888501554687975220100344878769840202012464058988999999887542220771--05


Q ss_pred             HHHHHHH
Q ss_conf             1789887
Q gi|254780206|r  408 DIGLQKK  414 (424)
Q Consensus       408 DIG~~~~  414 (424)
                      .|.++.+
T Consensus       420 tI~fH~~  426 (451)
T TIGR00514       420 TIPFHQR  426 (451)
T ss_pred             CHHHHHH
T ss_conf             8468988


No 38 
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930    In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis. During prolonged fasting, when hepatic glycogen is exhausted, gluconeogenesis becomes the only source of plasma glucose. Gluconeogenesis (the production of new glucose molecules) occurs mainly in liver and, to a small extent, in kidneys.    Pyruvate carboxylase (6.4.1.1 from EC), a member of the biotin-dependent enzyme family, catalyses the ATP-dependent carboxylation of pyruvate to oxaloacetate, thus playing a crucial role in gluconeogenesis.  ATP + pyruvate + HCO3- = ADP + phosphate + oxaloacetate  Most well characterised forms of active enzyme consist of four identical subunits arranged in a tetrahedron-like structure. Each subunit contains three functional domains: the biotin carboxylation domain, the transcarboxylation domain and the biotin carboxyl carrier domain.; GO: 0004736 pyruvate carboxylase activity, 0006094 gluconeogenesis, 0005737 cytoplasm.
Probab=99.93  E-value=4.6e-24  Score=193.89  Aligned_cols=333  Identities=17%  Similarity=0.298  Sum_probs=239.3

Q ss_pred             EEEEC-CCCCHHHHHHHHHHHCCCEEEEC----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             05512-87898999999987189799997----95578748998986058806701066655520102357888765310
Q gi|254780206|r   42 QCVAI-DIQNHSAIIHFCQEKHIDLVVVG----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        42 ~~~~i-~~~d~~~i~~~a~~~~iDlvivg----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP  116 (424)
                      +.-|| ..+++++|+++||++++|.|.||    +|.+   -++|++.++||..+||+++..+.-+||.-+|++..++|||
T Consensus        57 d~~Pv~AYL~I~eiI~vAk~~~vDaiHPGYGfLSE~~---~Fa~~v~~aGi~FIGP~a~~~~~~GdKV~AR~~A~~aGvP  133 (1169)
T TIGR01235        57 DLKPVEAYLSIDEIIRVAKKNKVDAIHPGYGFLSENS---EFADAVVKAGIVFIGPKAEVLDQLGDKVAARNLAIKAGVP  133 (1169)
T ss_pred             CCCCCCCCCCHHHHHHHHHCCCCCEEECCCCCCCCCH---HHHHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCC
T ss_conf             2687213047156989960078977708856224887---8999998689567379747775405768999888877887


Q ss_pred             CCCC--CCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CC
Q ss_conf             1111--22344011111210124202563046534300023235677888788751445-----3177788775205-75
Q gi|254780206|r  117 TATY--QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EV  188 (424)
Q Consensus       117 t~~~--~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~  188 (424)
                      +-+.  -.+++.|++.+|.++.||||++|++...|||||+|+++.+|+.++++++-.++     ++.|.||+||+=+ -+
T Consensus       134 vvPgt~Gp~~t~eev~~f~~~~GYPvi~KAs~GGGGRGMRvvR~~~dv~~~~~rA~sEA~AAFGnd~~yvEklie~pkHi  213 (1169)
T TIGR01235       134 VVPGTDGPVETLEEVLDFAKAIGYPVIIKASYGGGGRGMRVVRSEEDVADAFQRAKSEAKAAFGNDEVYVEKLIERPKHI  213 (1169)
T ss_pred             EECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCEE
T ss_conf             63688687525999999997569958987216889720168607567999988876887310489806985102488207


Q ss_pred             CEEEECCC-CCCCCCC----CCC-CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEE
Q ss_conf             23442157-7631035----200-01113566544444344300001234432220100000899999862046235664
Q gi|254780206|r  189 SFFALCDG-KTAIPFT----TAR-DHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGV  262 (424)
Q Consensus       189 Sv~~i~dG-~~~~~l~----~~~-dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~  262 (424)
                      -++.|.|. .++++|=    .+| -|.++-|            ++|++.++++..+++.+.    .++ |.+ .+.|.+-
T Consensus       214 EvQ~LGD~~GNVVHLFERDCSVQRRhQKVvE------------~APA~~Ls~e~Rd~~~~~----Avk-LAk-~~nY~nA  275 (1169)
T TIGR01235       214 EVQLLGDKHGNVVHLFERDCSVQRRHQKVVE------------VAPAPSLSREVRDEIAEY----AVK-LAK-EVNYINA  275 (1169)
T ss_pred             EEEEEECCCCCEEEEEECCCCCEEECCEEEE------------ECCCCCCCHHHHHHHHHH----HHH-HHH-HCCCCCC
T ss_conf             8987634889878887507762000550788------------678877888899999999----999-987-4289888


Q ss_pred             EEEEEEEECCE--EEEEEEEEEECCCCCEEEEECCCC-CCHHHHHHHHHCC-CCCCCCCCCCCCEEEEEECCCCCCC--C
Q ss_conf             45448985570--489998865147751044332654-4115666542013-3332123444420675422544668--7
Q gi|254780206|r  263 LFAGLMITEQG--PYLIEYNVRFGDPECQAMMMRLES-DILEILNSCVHGN-LHNTHINWKAEYALTVVVATKGYPE--E  336 (424)
Q Consensus       263 l~~~~m~t~~g--p~viE~N~R~GDPE~q~ilp~L~~-dl~~il~~~~~g~-L~~~~~~~~~~~~v~Vvlas~GYP~--~  336 (424)
                      ==++|.+.+++  =|.||+|+|+= -| -+|-..++. |++.-=..++.|. |....+-..+.--    +-..||--  .
T Consensus       276 GTvEFL~d~~~G~FYFIEvNpRiQ-VE-HTvTE~iTGiDiV~aQI~va~G~sL~~~~~g~~~Q~~----I~t~GyAiQcR  349 (1169)
T TIGR01235       276 GTVEFLVDNDTGKFYFIEVNPRIQ-VE-HTVTEEITGIDIVQAQIRVAEGASLPSKQLGVPEQED----IKTRGYAIQCR  349 (1169)
T ss_pred             CCEEEEEECCCCCEEEEEECCCEE-EE-EEEEEEECCCHHHHHHHHHHCCCCCCCCCCCCCCCCC----EEEEEEEEEEC
T ss_conf             724885554889377899888000-11-5586467340377789999655746877577886544----03501488722


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEEE----EEEECCEEEECC--------CCEEEEEEECCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             75797624876668986899833----587788799818--------8079999962898999999999985258999
Q gi|254780206|r  337 YPHGTIISKIPQNTGTTQLFHAG----TAIVNNNLTANG--------GRVLSATALGKTITESRELAYHMVENIDWKH  402 (424)
Q Consensus       337 ~~kg~~I~~l~~~~~~~~ifhag----t~~~~g~l~t~G--------GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g  402 (424)
                      -.+-+|-.++.=+.+.+.+|-||    +.++.|+=|+ |        +=..=|++.|.|+++|+.+..|++..=+--|
T Consensus       350 vTTEDP~~dF~PdtGri~~YRSa~G~GvRLD~G~sY~-GAiItpYYDsLLVK~~~~A~~~~~a~~kM~RaL~EFRIRG  426 (1169)
T TIGR01235       350 VTTEDPANDFQPDTGRIEVYRSAGGFGVRLDGGNSYA-GAIITPYYDSLLVKVSAWASTFEEAAAKMVRALREFRIRG  426 (1169)
T ss_pred             CCCCCCCCCCCCCCCCEEEEEECCCCEEEECCCCCCC-CCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             5445864266889672789981784317616766414-6301675233101001037898999999754201110022


No 39 
>pfam02843 GARS_C Phosphoribosylglycinamide synthetase, C domain. Phosphoribosylglycinamide synthetase catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by Phosphoribosylglycinamide synthetase is the ATP- dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide. This domain is related to the C-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (see pfam02787).
Probab=99.92  E-value=4.1e-25  Score=201.50  Aligned_cols=92  Identities=45%  Similarity=0.740  Sum_probs=87.0

Q ss_pred             CEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCC
Q ss_conf             20675422544668775797624876668986899833587788799818807999996289899999999998525899
Q gi|254780206|r  322 YALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWK  401 (424)
Q Consensus       322 ~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~  401 (424)
                      +++||||||+|||++|+||.+|.+++ ..++..||||||+.++++|+|+|||||++++.|+|+++|++++|+.+++|+|+
T Consensus         1 aav~Vvlas~GYP~~~~kg~~I~~~~-~~~~~~if~Agv~~~~~~l~t~GGRvl~v~~~~~~l~~A~~~aY~~i~~I~~~   79 (92)
T pfam02843         1 AAVGVVLASKGYPESYEKGIEITGLE-EDEGVLVFHAGTALEDGKLVTNGGRVLAVVALGDTLEEAREKAYAALEKIDFP   79 (92)
T ss_pred             CEEEEEECCCCCCCCCCCCCEEECCC-CCCCCEEEECCCCCCCCCEECCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             90899990799898877998932554-58999999785545668366379978888874686999999999999606799


Q ss_pred             CCEECCHHHHHHH
Q ss_conf             9575351789887
Q gi|254780206|r  402 HGYWREDIGLQKK  414 (424)
Q Consensus       402 g~~yR~DIG~~~~  414 (424)
                      |+|||+|||+|++
T Consensus        80 g~~yR~DIG~k~l   92 (92)
T pfam02843        80 GLFYRKDIGTKAL   92 (92)
T ss_pred             CCEECCCCCCCCC
T ss_conf             9990384540119


No 40 
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084   Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast). The allophanate hydrolase domain of the yeast enzyme is not included in this entry and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from O. sagaranensis was shown to be highly active on acetamide and formamide as well as urea..
Probab=99.90  E-value=8.3e-22  Score=177.58  Aligned_cols=367  Identities=16%  Similarity=0.232  Sum_probs=255.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEE--EEECCC--HHHHHCCEEEE-------CCCCCHHHHHHHHHHHCCCEEEEC-
Q ss_conf             589988658899999999858996789--995498--35751170551-------287898999999987189799997-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSEL--WSIPGN--PGIAQHAQCVA-------IDIQNHSAIIHFCQEKHIDLVVVG-   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v--~~~pgN--~g~~~~~~~~~-------i~~~d~~~i~~~a~~~~iDlvivg-   69 (424)
                      ||||===|--.-=|.+.|++- .+..|  |.-|+-  .+....++-+.       -.+++.+.|++.|++...+-|+|| 
T Consensus         3 ~vLiANRGEIA~RiirTL~~l-gi~sVAvYS~aD~~s~HV~~AD~A~~Lg~~~A~esYL~~dkil~~Ak~tGA~AI~PGY   81 (1226)
T TIGR02712         3 TVLIANRGEIAVRIIRTLRKL-GIRSVAVYSDADRASQHVLDADEAVCLGGATAAESYLDIDKILAIAKKTGAQAIHPGY   81 (1226)
T ss_pred             EEEEECCHHHHHHHHHHHHHC-CCCEEEEECCCCCCCCCHHHCCCEECCCCCCHHHHHCCHHHHHHHHHHCCCCEEECCC
T ss_conf             567764437999999998771-8637986321002157823605026058954132221478999999755893874588


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             ---95578748998986058806701066655520102357888765310-11112234401111121012420256304
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP-TATYQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP-t~~~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                         +|+   +.++++++++||..+||+.+..+--+=|..+|++.+++|+| +|-.-..+|.+||++.++++||||.||..
T Consensus        82 GFLSEN---A~FA~~C~~aGI~FvGPtpe~ir~fGLKHtAR~lA~~aGVPL~PGTgLL~sl~eA~~~A~~IGYPVMlKST  158 (1226)
T TIGR02712        82 GFLSEN---AAFAEACEAAGIVFVGPTPEQIRKFGLKHTARELAEAAGVPLLPGTGLLESLDEALEAAKEIGYPVMLKST  158 (1226)
T ss_pred             CCCCCC---HHHHHHHHHCCCEEECCCHHHHHHCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             723578---77998998479578778706674438325689999966889888515587799999998646995479870


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHC--C---CCHHHHHHHHHH-CCCCCEEEECCCC-CCCCCCC------CCCCCCCC
Q ss_conf             65343000232356778887887514--4---531777887752-0575234421577-6310352------00011135
Q gi|254780206|r  146 GLCAGKGVVVAATVDEATSAIDRCFQ--Q---INSTVIIEEYLE-GFEVSFFALCDGK-TAIPFTT------ARDHKRIH  212 (424)
Q Consensus       146 ~~agGkGV~i~~~~~e~~~~~~~~~~--~---~~~~VliEefl~-G~E~Sv~~i~dG~-~~~~l~~------~~dyKr~~  212 (424)
                      ...||-|+..|++.+|+.++++..-+  +   ++..|.+|.||+ -.-+-|++|-||+ +++.|.-      -|.-|=+.
T Consensus       159 AGGGGIGl~~c~~~~eL~~aFe~Vkrlg~~~F~daGVFlErfv~~ARHvEVQifGDG~G~v~aLGeRDCSLQRRNQKVvE  238 (1226)
T TIGR02712       159 AGGGGIGLQKCDNAAELAEAFETVKRLGESFFGDAGVFLERFVENARHVEVQIFGDGKGKVVALGERDCSLQRRNQKVVE  238 (1226)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEHHHHHCCCCEEEEEEEECCCCCEEEEECCCCCCCCCCCCEEE
T ss_conf             78765245111898999999999899886323635143403203784289987526973369971167544445665587


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECC--EEEEEEEEEEE--CCCCC
Q ss_conf             665444443443000012344322201000008999998620462356644544898557--04899988651--47751
Q gi|254780206|r  213 DGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ--GPYLIEYNVRF--GDPEC  288 (424)
Q Consensus       213 ~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~--gp~viE~N~R~--GDPE~  288 (424)
                      |             ||+|.++++..+++.+     +...|.+ ...|++-==++||-+..  .=|.||+|+||  =-|=|
T Consensus       239 E-------------TPAP~LP~~~R~~L~~-----AA~~Lg~-~V~YrSAGTVEFiYD~~~d~FYFLEVNTRLQVEHPvT  299 (1226)
T TIGR02712       239 E-------------TPAPNLPEETRAALLA-----AAEKLGE-AVNYRSAGTVEFIYDEARDEFYFLEVNTRLQVEHPVT  299 (1226)
T ss_pred             E-------------CCCCCCCHHHHHHHHH-----HHHHHHH-HHCCCCCCEEEEEECCCCCCEEEEEECCCCCCCCCCE
T ss_conf             2-------------7746864899999999-----9999999-7187637604774022108712113234111335730


Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCC-CCCC---C----CCCEEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCEEEEEE
Q ss_conf             04433265441156665420133332-1234---4----442067542254466877579762-4876668986899833
Q gi|254780206|r  289 QAMMMRLESDILEILNSCVHGNLHNT-HINW---K----AEYALTVVVATKGYPEEYPHGTII-SKIPQNTGTTQLFHAG  359 (424)
Q Consensus       289 q~ilp~L~~dl~~il~~~~~g~L~~~-~~~~---~----~~~~v~Vvlas~GYP~~~~kg~~I-~~l~~~~~~~~ifhag  359 (424)
                      +.+   -.=||++.|...+.+++... ....   .    .++|+=+    -=|=+.+.|++.- +|+=.   + .-|-..
T Consensus       300 E~V---tGlDLVEWM~r~AAg~~p~~~~~~~~~~~~l~p~G~aiEa----RvYAEnP~k~F~PSpG~Lt---~-V~FP~~  368 (1226)
T TIGR02712       300 EMV---TGLDLVEWMVRIAAGELPDFDSLNIEIFDNLTPRGAAIEA----RVYAENPAKNFQPSPGLLT---E-VQFPDD  368 (1226)
T ss_pred             EEE---ECCHHHHHHHHHHCCCCCCHHHCCCCCCCCCCCCEEEEEE----EEEEECCCCCCCCCCCEEE---E-EECCCC
T ss_conf             178---4640898999971688888524430003578875038999----9844077677726986068---8-772788


Q ss_pred             --E-EEECCEEEECCCCE--------EEEEEECCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             --5-87788799818807--------99999628989999999999852589995
Q gi|254780206|r  360 --T-AIVNNNLTANGGRV--------LSATALGKTITESRELAYHMVENIDWKHG  403 (424)
Q Consensus       360 --t-~~~~g~l~t~GGRV--------L~vv~~g~~l~eA~~~ay~~i~~I~~~g~  403 (424)
                        - .+. +.|+.+|=+|        -=|+..|+|-++|+++...++++=+..|.
T Consensus       369 ~G~~~Rv-DTWV~~Gtevsp~YDPmlAKiIv~g~~R~~A~~kL~~AL~~T~v~Gi  422 (1226)
T TIGR02712       369 GGKAVRV-DTWVETGTEVSPEYDPMLAKIIVHGKDREDAIAKLSQALDETRVYGI  422 (1226)
T ss_pred             CCCEEEE-ECEECCCCEECCCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEE
T ss_conf             8953787-02112783567765874244664367978999999988730101235


No 41 
>pfam02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain. Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. This important enzyme initiates both the urea cycle and the biosynthesis of arginine and/or pyrimidines. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain. The small chain promotes the hydrolysis of glutamine to ammonia, which is used by the large chain to synthesize carbamoyl phosphate. See pfam00988. The small chain has a GATase domain in the carboxyl terminus. See pfam00117. The ATP binding domain (this one) has an ATP-grasp fold.
Probab=99.90  E-value=4.1e-24  Score=194.22  Aligned_cols=195  Identities=16%  Similarity=0.175  Sum_probs=141.6

Q ss_pred             CCHHHHHHHHHHHHHCCCCC--CCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----C
Q ss_conf             10235788876531011112--2344011111210124202563046534300023235677888788751445-----3
Q gi|254780206|r  102 SKSFAKKFCTKYGIPTATYQ--HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-----N  174 (424)
Q Consensus       102 sK~~~K~~l~~~gIPt~~~~--~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~  174 (424)
                      ||..+|++|+++|||||+|.  .+++.+++.++++++|||+||||....||+|+.++++.+|+.++++.++..+     +
T Consensus         1 Dk~~~k~~l~~~GvP~~~~~~~~~~s~ee~~~~a~~iG~PvvvKp~~~g~g~G~~~v~~~~eL~~a~~~a~~~a~~~~~~   80 (211)
T pfam02786         1 DKVLFKAAMKEAGVPTVPGTAGPVETEEEALAAAKEIGYPVIIKAAFGGGGLGMGIARNEEELAELFALALAEAPAAFGN   80 (211)
T ss_pred             CHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             98999999998698919987888799999999999859978997377789987512412778999999998751431699


Q ss_pred             HHHHHHHHHHC-CCCCEEEECCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHH
Q ss_conf             17778877520-57523442157763-10352000111356654444434430000123443222010000089999986
Q gi|254780206|r  175 STVIIEEYLEG-FEVSFFALCDGKTA-IPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGM  252 (424)
Q Consensus       175 ~~VliEefl~G-~E~Sv~~i~dG~~~-~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l  252 (424)
                      ++|++||||+| .|+|+.++.|+... +.++....+-       ..++|..-..+|++.++++..+++    .+-+.+.+
T Consensus        81 ~~vlvEe~i~g~~ei~v~v~~d~~~~~~~~~~~~~~~-------~~~~~~~~~~~Pa~~l~~~~~e~i----~~~a~~~~  149 (211)
T pfam02786        81 PQVLVEKSLKGPKHIEYQVLRDAHGNCITVCNRECSD-------QRRTQKSIEVAPSQTLTDEERQML----REAAVKIA  149 (211)
T ss_pred             CCEEEEECCCCCEEEEEEEEEECCCCEEEEEEEEEEE-------ECCCCCEEEEECCCCCCHHHHHHH----HHHHHHHH
T ss_conf             8389974047765899999982799899999633225-------033584446817999999999999----99999987


Q ss_pred             HHCCCEEEEEEEEEEEEEC--CEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCC
Q ss_conf             2046235664454489855--704899988651477510443326544115666542013
Q gi|254780206|r  253 QKEQNPFQGVLFAGLMITE--QGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGN  310 (424)
Q Consensus       253 ~~~~~~y~G~l~~~~m~t~--~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~  310 (424)
                      +..|  ++|+..++|+++.  +.||+||+|+|+.+- ..+..-...-||++.-..++-|.
T Consensus       150 ~~lg--~~G~~~vef~~~~~~~~~~~iEvNpR~~~~-~~~t~~~tg~~l~~~~~~~a~G~  206 (211)
T pfam02786       150 RHLG--YVGAGTVEFALDPFSGEYYFIEMNTRLQVS-HALAEKATGYDLAKEAAKIALGY  206 (211)
T ss_pred             HHCC--EECCCEEEEEEECCCCEEEEEECCCCCCCH-HHHHHHHHCCCHHHHHHHHHCCC
T ss_conf             5264--423324789996799959999670896834-77889987948999999997799


No 42 
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism]
Probab=99.89  E-value=6.3e-22  Score=178.48  Aligned_cols=365  Identities=18%  Similarity=0.292  Sum_probs=242.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEE--EEECC-CHHHHHC-CEEEE-------CCCCCHHHHHHHHHHHCCCEEEEC-
Q ss_conf             589988658899999999858996789--99549-8357511-70551-------287898999999987189799997-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSEL--WSIPG-NPGIAQH-AQCVA-------IDIQNHSAIIHFCQEKHIDLVVVG-   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v--~~~pg-N~g~~~~-~~~~~-------i~~~d~~~i~~~a~~~~iDlvivg-   69 (424)
                      ||||---|-..--+.....+ -.+.+|  |.-++ |...... ++-+.       -++.|.+.|++.|++..-|-|.|| 
T Consensus         4 KiLIANRGEIAcRVIRtar~-lGi~tVAVYSdaDa~A~hV~~ADEAv~iGpapaaeSYL~~dkIi~Aa~~tGA~AIHPGY   82 (645)
T COG4770           4 KILIANRGEIACRVIRTARD-LGIRTVAVYSDADADALHVRMADEAVHIGPAPAAESYLDIDKIIDAARRTGAQAIHPGY   82 (645)
T ss_pred             EEEEECCCHHHHHHHHHHHH-CCCCEEEEEECCCCCCHHHHHCCHHHHCCCCCHHHHHCCHHHHHHHHHHHCCCCCCCCC
T ss_conf             48872464346899999998-09956999725777852666412244317996012122688999999973832136884


Q ss_pred             ---CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCC--CCCCCCHHHHHHHHCCCCEEEEEE
Q ss_conf             ---955787489989860588067010666555201023578887653101111--223440111112101242025630
Q gi|254780206|r   70 ---PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY--QHFSDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus        70 ---pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~--~~~~~~~ea~~~~~~~g~PvVVKp  144 (424)
                         +|.   +.++++++++|+-.+||+..+.+-.+||.-+|.+|.+.|+|+.+.  ....|.+++.++++++|||+.||+
T Consensus        83 GFLSEN---a~FA~a~~~aGlvfIGP~~~aI~aMGdK~~AK~l~~~AgVp~VPG~~g~~qd~~~~~~~A~eiGyPVlIKA  159 (645)
T COG4770          83 GFLSEN---ADFAQAVEDAGLVFIGPSAGAIRAMGDKIAAKKLAAEAGVPTVPGYHGPIQDAAELVAIAEEIGYPVLIKA  159 (645)
T ss_pred             CCCCCC---HHHHHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             212359---89999999779189788979999844679999999974998068978744589999999986398589996


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEECCCC-CCCCCCC-----CCCCCCCC
Q ss_conf             46534300023235677888788751445-----3177788775205-75234421577-6310352-----00011135
Q gi|254780206|r  145 DGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALCDGK-TAIPFTT-----ARDHKRIH  212 (424)
Q Consensus       145 ~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~dG~-~~~~l~~-----~~dyKr~~  212 (424)
                      +...||||++++.+.+|+.++++.+-.++     +.+++||+|++-| -+.+++|-|.. +++.|..     -|-|.++-
T Consensus       160 saGGGGKGMRvv~~~~e~~e~l~sarrEA~asFGddrv~iEkyl~~PRHIEiQV~aD~HGNvv~LgERdCSlQRRhQKVI  239 (645)
T COG4770         160 SAGGGGKGMRVVETPEEFAEALESARREAKASFGDDRVFIEKYLDKPRHIEIQVFADQHGNVVHLGERDCSLQRRHQKVI  239 (645)
T ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHCCCCEEEHHHHCCCCCEEEEEEEECCCCCEEEEECCCCCHHHHCCHHH
T ss_conf             36899775376268899999999999998850488647624551787448999986277878886325332423112232


Q ss_pred             CCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEE--CCCCCE
Q ss_conf             6654444434430000123443222010000089999986204623566445448985570-4899988651--477510
Q gi|254780206|r  213 DGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRF--GDPECQ  289 (424)
Q Consensus       213 ~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~--GDPE~q  289 (424)
                      |.            .|+|++++++.+.+-+.    .+++-+.-|  |.|-=-++|++..++ -|.+|.|+||  --|=|+
T Consensus       240 EE------------APaP~l~~~~R~amg~a----Av~~a~avg--Y~gAGTVEFivd~~~~f~FlEMNTRLQVEHPVTE  301 (645)
T COG4770         240 EE------------APAPFLTEETREAMGEA----AVAAAKAVG--YVGAGTVEFIVDADGNFYFLEMNTRLQVEHPVTE  301 (645)
T ss_pred             HC------------CCCCCCCHHHHHHHHHH----HHHHHHHCC--CCCCCEEEEEECCCCCEEEEEEECCEECCCCCHH
T ss_conf             00------------89999999999999999----999998629--7757558999838986899986220202564122


Q ss_pred             EEEECCCCCCHHHHHHHHHCCCCCCCCCCCC----CCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEE--EE-EEE
Q ss_conf             4433265441156665420133332123444----4206754225446687757976248766689868998--33-587
Q gi|254780206|r  290 AMMMRLESDILEILNSCVHGNLHNTHINWKA----EYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFH--AG-TAI  362 (424)
Q Consensus       290 ~ilp~L~~dl~~il~~~~~g~L~~~~~~~~~----~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifh--ag-t~~  362 (424)
                      .+   -.-||++-.+.+++|+  ...+.+++    ++++-.=+    |-+.+..++    ||. .+....|+  +| +.+
T Consensus       302 ~i---TGiDLVewqiRVA~Ge--kL~~~Q~di~l~GhAiE~Ri----yAEDp~r~F----LPs-~G~l~~~~~P~~~~vR  367 (645)
T COG4770         302 LI---TGIDLVEWQIRVASGE--KLPFTQDDIPLNGHAIEARI----YAEDPARGF----LPS-TGRLTRYRPPAGPGVR  367 (645)
T ss_pred             HH---HHHHHHHHHHHHHCCC--CCCCCCCCCCCCCEEEEEEE----ECCCCCCCC----CCC-CCEEEEECCCCCCCEE
T ss_conf             42---0138999999974388--57766566544650578887----334755576----678-8505766288888431


Q ss_pred             ECCEEEECCC--------CEEEEEEECCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             7887998188--------0799999628989999999999852589995
Q gi|254780206|r  363 VNNNLTANGG--------RVLSATALGKTITESRELAYHMVENIDWKHG  403 (424)
Q Consensus       363 ~~g~l~t~GG--------RVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~  403 (424)
                      .|..+.+ |+        =+--++.-|.|-++|.++.-+++..-.-+|.
T Consensus       368 vDsGV~~-G~~Is~~YDpMiAKLi~~G~dR~eAl~rl~~AL~~~~v~Gi  415 (645)
T COG4770         368 VDSGVRE-GDEISPFYDPMIAKLIVHGADREEALDRLRRALAEFEVEGI  415 (645)
T ss_pred             CCCCCCC-CCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHEECCC
T ss_conf             2367433-87235553558888864388899999999999986084474


No 43 
>KOG0238 consensus
Probab=99.86  E-value=1.2e-19  Score=161.92  Aligned_cols=327  Identities=16%  Similarity=0.231  Sum_probs=221.3

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEC----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCC--
Q ss_conf             87898999999987189799997----955787489989860588067010666555201023578887653101111--
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVG----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY--  120 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivg----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~--  120 (424)
                      +..+.+.|++.|++..-..+.||    +|.   +.+++.++.+|+..+||+..+.|-.++|.-+|++|+++|+|+.+.  
T Consensus        55 SYL~~~~I~~aa~~tgaqaihPGYGFLSEn---~~Fae~c~~~Gi~FiGP~~~aIrdMG~K~~sk~im~~AgVp~vpG~~  131 (670)
T KOG0238          55 SYLRMDKIIDAAKRTGAQAIHPGYGFLSEN---AEFAELCEDAGITFIGPPPSAIRDMGDKSTSKQIMKAAGVPLVPGYH  131 (670)
T ss_pred             HHHHHHHHHHHHHHCCCCEECCCCCCCCCC---HHHHHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCC
T ss_conf             341378999999862884621785532355---38999998769868798879988731257789999864996136856


Q ss_pred             CCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEEC
Q ss_conf             22344011111210124202563046534300023235677888788751445-----3177788775205-75234421
Q gi|254780206|r  121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALC  194 (424)
Q Consensus       121 ~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~  194 (424)
                      -...|.+++.+.+.++|||+.||+....||||++++.+.+|..+.++.+-.++     ++.+++|+|++-+ -+.+++|.
T Consensus       132 g~~qs~e~~~~~a~eIgyPvMiKa~~GGGGkGMria~~~~ef~~~~~~ak~Ea~~sFGdd~~llEkfi~npRHiEvQv~g  211 (670)
T KOG0238         132 GEDQSDEEAKKVAREIGYPVMIKATAGGGGKGMRIAWSEEEFEEGLESAKQEAAKSFGDDGMLLEKFIDNPRHIEVQVFG  211 (670)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCEEEEEEEE
T ss_conf             43266799999998619857999515788763175148688999999888888763186411077763687548999973


Q ss_pred             CCC-CCCCCCC-----CCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEE
Q ss_conf             577-6310352-----0001113566544444344300001234432220100000899999862046235664454489
Q gi|254780206|r  195 DGK-TAIPFTT-----ARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLM  268 (424)
Q Consensus       195 dG~-~~~~l~~-----~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m  268 (424)
                      |.. +++.|.-     -|-|.++-|.            +|+|.++++...++-+.    .+++-++.|  |.|.=-++|+
T Consensus       212 D~hGnav~l~ERdCSvQRRnQKiiEE------------aPap~l~~e~R~~lgea----Av~aa~avg--Y~~aGTVEFi  273 (670)
T KOG0238         212 DKHGNAVHLGERDCSVQRRNQKIIEE------------APAPNLPEETRRALGEA----AVRAAKAVG--YVGAGTVEFI  273 (670)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHC------------CCCCCCCHHHHHHHHHH----HHHHHHHHC--CCCCCEEEEE
T ss_conf             47776888504544242321156630------------89999998999999999----999988638--7644449999


Q ss_pred             EECCE-EEEEEEEEEE--CCCCCEEEEECCCCCCHHHHHHHHHCCC---CCCCCCCCCCCEE-EEEECCCCCCCCCCCCC
Q ss_conf             85570-4899988651--4775104433265441156665420133---3321234444206-75422544668775797
Q gi|254780206|r  269 ITEQG-PYLIEYNVRF--GDPECQAMMMRLESDILEILNSCVHGNL---HNTHINWKAEYAL-TVVVATKGYPEEYPHGT  341 (424)
Q Consensus       269 ~t~~g-p~viE~N~R~--GDPE~q~ilp~L~~dl~~il~~~~~g~L---~~~~~~~~~~~~v-~Vvlas~GYP~~~~kg~  341 (424)
                      ++..+ -|.+|.|+||  --|-|+.|-   ..||++-.+.++.|.-   ...++..+ +++. |-+     |-+.+.++.
T Consensus       274 ~D~~~~FyFmEmNTRLQVEHPvTEmIt---g~DLVewqiRvA~ge~lp~~q~ei~l~-GhafE~Ri-----yAEdp~~~f  344 (670)
T KOG0238         274 VDSKDNFYFMEMNTRLQVEHPVTEMIT---GTDLVEWQIRVAAGEPLPLKQEEIPLN-GHAFEARI-----YAEDPYKGF  344 (670)
T ss_pred             ECCCCCEEEEEEECEEEECCCCHHHCC---CHHHHHHHHHHHCCCCCCCCCCEEEEC-CEEEEEEE-----EECCCCCCC
T ss_conf             837885799984022530364163212---227899999986499999770201364-54789998-----500775467


Q ss_pred             -CCCC-CC---CCC-CCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             -6248-76---668-98689983358778879981880799999628989999999999852589995
Q gi|254780206|r  342 -IISK-IP---QNT-GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHG  403 (424)
Q Consensus       342 -~I~~-l~---~~~-~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~  403 (424)
                       +-.+ |.   ... .+..-...|+...+.--..----+.-++.-|+|.++|..+.-++++.-.--|.
T Consensus       345 ~P~~G~L~~~~~p~~~~~vRvdtgV~~g~~vs~~YDpmiaKlvvwg~dR~~Al~kl~~aL~~~~I~Gv  412 (670)
T KOG0238         345 LPSAGRLVYYSFPGHSPGVRVDTGVRSGDEVSIHYDPMIAKLVVWGKDREEALNKLKDALDNYVIRGV  412 (670)
T ss_pred             CCCCCCCEEECCCCCCCCEEEECCCCCCCCCCCCCCCHHEEEEEECCCHHHHHHHHHHHHHHCEEECC
T ss_conf             77874111202678899725555730287446113650015667648789999999999860688467


No 44 
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion]
Probab=99.86  E-value=7.8e-20  Score=163.34  Aligned_cols=331  Identities=19%  Similarity=0.300  Sum_probs=223.4

Q ss_pred             EC-CCCCHHHHHHHHHHHCCCEEEEC----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCC
Q ss_conf             12-87898999999987189799997----95578748998986058806701066655520102357888765310111
Q gi|254780206|r   45 AI-DIQNHSAIIHFCQEKHIDLVVVG----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT  119 (424)
Q Consensus        45 ~i-~~~d~~~i~~~a~~~~iDlvivg----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~  119 (424)
                      ++ ...++++|++.|++.+.|.+.||    +|.|   -++..+.++||..+||+.+...+.+||..+|+...++|+|+.+
T Consensus        62 Pi~aYL~IdeII~iAk~~gaDaIhPGYGfLSEn~---efA~~c~eaGI~FIGP~~e~ld~~GdKv~Ar~~A~~agvPvip  138 (1149)
T COG1038          62 PVEAYLSIDEIIRIAKRSGADAIHPGYGFLSENP---EFARACAEAGITFIGPKPEVLDMLGDKVKARNAAIKAGVPVIP  138 (1149)
T ss_pred             CHHHHCCHHHHHHHHHHCCCCEECCCCCCCCCCH---HHHHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCC
T ss_conf             2687432999999999708873137843244798---9999999759789688879998844288899999975998556


Q ss_pred             C--CCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEE
Q ss_conf             1--22344011111210124202563046534300023235677888788751445-----3177788775205-75234
Q gi|254780206|r  120 Y--QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFF  191 (424)
Q Consensus       120 ~--~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~  191 (424)
                      .  -..++.+++++|+++.|||++||++-..||||++++.+.+++.++++++-.++     +..|.||+|++.+ .+.++
T Consensus       139 gt~~~~~~~ee~~~fa~~~gyPvmiKA~~GGGGRGMR~vr~~~~l~~~~~~AksEAkaAFG~~eVyvEk~ve~pkHIEVQ  218 (1149)
T COG1038         139 GTDGPIETIEEALEFAEEYGYPVMIKAAAGGGGRGMRVVRSEADLAEAFERAKSEAKAAFGNDEVYVEKLVENPKHIEVQ  218 (1149)
T ss_pred             CCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECCHHHHHHHHHHHHHHHHHHCCCCCEEHHHHHCCCCEEEEE
T ss_conf             99998212999999998669858999714798665266258889999999988999974189806656552486526899


Q ss_pred             EECCCC-CCCCCC----CC-CCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEE
Q ss_conf             421577-631035----20-001113566544444344300001234432220100000899999862046235664454
Q gi|254780206|r  192 ALCDGK-TAIPFT----TA-RDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFA  265 (424)
Q Consensus       192 ~i~dG~-~~~~l~----~~-~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~  265 (424)
                      .+-|.. +++.|-    .+ |-|.+.-|            ++|++.+++++.+++++.    .++-.+  .+.|++-=-+
T Consensus       219 iLgD~~GnvvHLfERDCSvQRRhQKVVE------------~APa~~L~~~~R~~ic~~----Avkla~--~~~Y~~AGTv  280 (1149)
T COG1038         219 ILGDTHGNVVHLFERDCSVQRRHQKVVE------------VAPAPYLSPELRDEICDD----AVKLAR--NIGYINAGTV  280 (1149)
T ss_pred             EEECCCCCEEEEEECCCCHHHCCCEEEE------------ECCCCCCCHHHHHHHHHH----HHHHHH--HCCCCCCCEE
T ss_conf             8605778788886235533101440378------------568888999999999999----999999--7397656647


Q ss_pred             EEEEECCE-EEEEEEEEEECCCCCEEEEECCCC-CCHHHHHHHHHCC-CCCCCCCCCCCCEEEEEECCCCCCC--CCCCC
Q ss_conf             48985570-489998865147751044332654-4115666542013-3332123444420675422544668--77579
Q gi|254780206|r  266 GLMITEQG-PYLIEYNVRFGDPECQAMMMRLES-DILEILNSCVHGN-LHNTHINWKAEYALTVVVATKGYPE--EYPHG  340 (424)
Q Consensus       266 ~~m~t~~g-p~viE~N~R~GDPE~q~ilp~L~~-dl~~il~~~~~g~-L~~~~~~~~~~~~v~Vvlas~GYP~--~~~kg  340 (424)
                      +|.+.++| -|.||+|.|.- .|- +|-..+.. |++.--+.++.|. |...++-...+.-+    ...||--  .-.+.
T Consensus       281 EFLvd~~~~fyFIEvNPRiQ-VEH-TiTE~vTgiDIV~aQi~ia~G~~l~~~e~glp~q~dI----~~~G~AiQcRITTE  354 (1149)
T COG1038         281 EFLVDEDGKFYFIEVNPRIQ-VEH-TITEEITGIDIVKAQIHIAAGATLHTPELGLPQQKDI----RTHGYAIQCRITTE  354 (1149)
T ss_pred             EEEECCCCCEEEEEECCCEE-EEE-EEEEEEECHHHHHHHHHHHCCCCCCCCCCCCCCCCCC----CCCCEEEEEEEECC
T ss_conf             88873888689999547345-677-6455441216788789885356568744599744440----33643788774133


Q ss_pred             CCCCCCCCCCCCCEEEEE----EEEEECCEEEECC-------CCEEEEEEECCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             762487666898689983----3587788799818-------8079999962898999999999985258999
Q gi|254780206|r  341 TIISKIPQNTGTTQLFHA----GTAIVNNNLTANG-------GRVLSATALGKTITESRELAYHMVENIDWKH  402 (424)
Q Consensus       341 ~~I~~l~~~~~~~~ifha----gt~~~~g~l~t~G-------GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g  402 (424)
                      ++-.++--+.+.+..|.+    |+..+.|+-++-.       +=..-+++.|.|+++|+.++.+++..-+--|
T Consensus       355 DP~n~F~PDtGrI~aYRs~gGfGVRLD~Gn~~~GavItpyyDslLVK~t~~~~t~e~a~~km~RaL~EfrIrG  427 (1149)
T COG1038         355 DPENGFIPDTGRITAYRSAGGFGVRLDGGNAYAGAVITPYYDSLLVKVTCWGSTFEEAIRKMIRALREFRIRG  427 (1149)
T ss_pred             CCCCCCCCCCCEEEEEECCCCCEEEECCCCCCCCCEECCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHEECC
T ss_conf             7454778887527888627874387457766566463144554144563248998999999999888845112


No 45 
>KOG0369 consensus
Probab=99.85  E-value=5.2e-19  Score=157.36  Aligned_cols=326  Identities=17%  Similarity=0.298  Sum_probs=223.3

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEC----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCC--
Q ss_conf             87898999999987189799997----955787489989860588067010666555201023578887653101111--
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVG----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY--  120 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivg----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~--  120 (424)
                      ....+++|++.|+++++|+|.+|    +|.   +.++++...+|+..+||+.+..+-.+||.-+|.+.-++|+|+.+.  
T Consensus        91 AYL~ideii~iak~~~vdavHPGYGFLSEr---sdFA~av~~AGi~fiGPspeVi~~mGDKv~AR~~Ai~agVpvVPGTp  167 (1176)
T KOG0369          91 AYLAIDEIISIAKKHNVDAVHPGYGFLSER---SDFAQAVQDAGIRFIGPSPEVIDSMGDKVAARAIAIEAGVPVVPGTP  167 (1176)
T ss_pred             HHHCHHHHHHHHHHCCCCEECCCCCCCCCC---HHHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             651479999999872887325774212212---48999998659669688979998842088888999971997158999


Q ss_pred             CCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-----CHHHHHHHHHHCC-CCCEEEEC
Q ss_conf             22344011111210124202563046534300023235677888788751445-----3177788775205-75234421
Q gi|254780206|r  121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEGF-EVSFFALC  194 (424)
Q Consensus       121 ~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-----~~~VliEefl~G~-E~Sv~~i~  194 (424)
                      ..+++.+||.+|.++.|+|+++|+....||||++++++.+++.+++.++..++     +..+.||.|++-+ .+.++.+.
T Consensus       168 gPitt~~EA~eF~k~yG~PvI~KAAyGGGGRGmRvVr~~e~vee~f~Ra~SEA~aaFGnG~~FvEkF~ekPrHIEvQllg  247 (1176)
T KOG0369         168 GPITTVEEALEFVKEYGLPVIIKAAYGGGGRGMRVVRSGEDVEEAFQRAYSEALAAFGNGTLFVEKFLEKPRHIEVQLLG  247 (1176)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEHHHHHCCCCEEEEEEEC
T ss_conf             97542999999998619838996101689764377502556999999888999986178615378662586526898721


Q ss_pred             CC-CCCCCCC-----CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEE
Q ss_conf             57-7631035-----20001113566544444344300001234432220100000899999862046235664454489
Q gi|254780206|r  195 DG-KTAIPFT-----TARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLM  268 (424)
Q Consensus       195 dG-~~~~~l~-----~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m  268 (424)
                      |. .+++.|-     .-|-|.+.-|            ++|++.++++..+.+    ....++--+..|  |.--=-++|.
T Consensus       248 D~~GNvvHLyERDCSvQRRHQKVVE------------iAPA~~Lp~~vR~~~----~~davklAk~vg--Y~NAGTvEFL  309 (1176)
T KOG0369         248 DKHGNVVHLYERDCSVQRRHQKVVE------------IAPAKTLPPEVRDAI----LTDAVKLAKHVG--YENAGTVEFL  309 (1176)
T ss_pred             CCCCCEEEEEECCCCHHHHHCCEEE------------ECCCCCCCHHHHHHH----HHHHHHHHHHHC--CCCCCEEEEE
T ss_conf             3568789876145516432010367------------345565998999999----999999999847--5657707887


Q ss_pred             EECCE-EEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCC-CCCCCCCCC----CCCEEEEEECCCCCCCCCCCCCC
Q ss_conf             85570-4899988651477510443326544115666542013-333212344----44206754225446687757976
Q gi|254780206|r  269 ITEQG-PYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGN-LHNTHINWK----AEYALTVVVATKGYPEEYPHGTI  342 (424)
Q Consensus       269 ~t~~g-p~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~-L~~~~~~~~----~~~~v~Vvlas~GYP~~~~kg~~  342 (424)
                      ++..| -|.||+|+|+- .|-.+-=..-.-||+..-..++.|. |.+.-+.-.    .++++-.-+.         +.++
T Consensus       310 vD~~g~hYFIEvN~RlQ-VEHTvTEEITgvDlV~aQi~vAeG~tLp~lgl~QdkI~trG~aIQCRvT---------TEDP  379 (1176)
T KOG0369         310 VDQKGRHYFIEVNPRLQ-VEHTVTEEITGVDLVQAQIHVAEGASLPDLGLTQDKITTRGFAIQCRVT---------TEDP  379 (1176)
T ss_pred             ECCCCCEEEEEECCCEE-EEEEEEEEECCCCHHHHHHHHHCCCCCCCCCCCCCCEEECCEEEEEEEE---------CCCC
T ss_conf             71679789999546435-6655231004520101111343178753235430203204337998872---------3585


Q ss_pred             CCCCCCCCCCCEEEEEEE----EEECCE-----EEECC--CCEEEEEEECCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             248766689868998335----877887-----99818--80799999628989999999999852589995
Q gi|254780206|r  343 ISKIPQNTGTTQLFHAGT----AIVNNN-----LTANG--GRVLSATALGKTITESRELAYHMVENIDWKHG  403 (424)
Q Consensus       343 I~~l~~~~~~~~ifhagt----~~~~g~-----l~t~G--GRVL~vv~~g~~l~eA~~~ay~~i~~I~~~g~  403 (424)
                      -.++.-+.+.+-+|.+|-    ..++.+     ++|--  +-..-|++.|.|.+.++.+..+++..-+..|.
T Consensus       380 a~~FqPdtGriEVfRSgeGmGiRLD~asafaGavIsPhYDSllVK~i~h~~~~~~~a~KMiRaL~eFRiRGV  451 (1176)
T KOG0369         380 AKGFQPDTGRIEVFRSGEGMGIRLDGASAFAGAVISPHYDSLLVKVICHGSTYEIAARKMIRALIEFRIRGV  451 (1176)
T ss_pred             CCCCCCCCCEEEEEECCCCCEEEECCCCCCCCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCE
T ss_conf             546899875079997078744762475435664116555532788985388656789999999998722032


No 46 
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism]
Probab=99.84  E-value=2.2e-18  Score=152.88  Aligned_cols=360  Identities=19%  Similarity=0.210  Sum_probs=224.5

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEEC-C-CHHHHHCC-EEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             958998865--88999999998589967899954-9-83575117-0551287898999999987189799997955787
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIP-G-NPGIAQHA-QCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~p-g-N~g~~~~~-~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      |.|.|||+|  ||.-|  ++-.+-  -.++++.. . |+-..+.+ .++..+..|.+++.+++.+  -|.+----|.--.
T Consensus         2 ~tvgIlGGGQLgrMm~--~aa~~l--G~~v~vLdp~~~~PA~~va~~~i~~~~dD~~al~ela~~--~DViT~EfE~V~~   75 (375)
T COG0026           2 KTVGILGGGQLGRMMA--LAAARL--GIKVIVLDPDADAPAAQVADRVIVAAYDDPEALRELAAK--CDVITYEFENVPA   75 (375)
T ss_pred             CEEEEECCCHHHHHHH--HHHHHC--CCEEEEECCCCCCCHHHCCCCEEECCCCCHHHHHHHHHH--CCEEEEEECCCCH
T ss_conf             7699976869999999--999864--977999569999963341431541577888999999862--9889985146988


Q ss_pred             HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC-CCCCCCCCC
Q ss_conf             4899898605880670106665552010235788876531011112234401111121012420256304-653430002
Q gi|254780206|r   76 NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD-GLCAGKGVV  154 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~-~~agGkGV~  154 (424)
                      . ..+.|... .+++ |+.++.++-.||...|+|++++|||||+|+.+++.+++.++++++|+|.|+|.. +..-|||.+
T Consensus        76 ~-aL~~l~~~-~~v~-p~~~~l~~~qdR~~eK~~l~~~Gi~va~~~~v~~~~el~~~~~~~g~p~VlKtr~gGYDGkGQ~  152 (375)
T COG0026          76 E-ALEKLAAS-VKVF-PSPDALRIAQDRLVEKQFLDKAGLPVAPFQVVDSAEELDAAAADLGFPAVLKTRRGGYDGKGQW  152 (375)
T ss_pred             H-HHHHHHHH-CCCC-CCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCCEE
T ss_conf             9-99999961-6769-9989988776689999999976999998278579889999999759956998322656688708


Q ss_pred             CHHHHHHHHHHHHHHHCCCCHHHHHHHHHH-CCCCCEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             323567788878875144531777887752-0575234421-57763103520001113566544444344300001234
Q gi|254780206|r  155 VAATVDEATSAIDRCFQQINSTVIIEEYLE-GFEVSFFALC-DGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM  232 (424)
Q Consensus       155 i~~~~~e~~~~~~~~~~~~~~~VliEefl~-G~E~Sv~~i~-dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~  232 (424)
                      ++.+.+++.......- ..... ++|+|+. -.|+|+.+.- .+.++..+|++..+-+-+=-.        =++.|+ -+
T Consensus       153 ~i~~~~~~~~~~~~~~-~~~~~-vlE~fV~F~~EiSvi~aR~~~G~~~~yP~~eN~h~~gIl~--------~siaPa-~i  221 (375)
T COG0026         153 RIRSDADLELRAAGLA-EGGVP-VLEEFVPFEREISVIVARSNDGEVAFYPVAENVHRNGILR--------TSIAPA-RI  221 (375)
T ss_pred             EEECCCCCHHHHHHHH-CCCCE-EEEEECCCCEEEEEEEEECCCCCEEEECCCCEEEECCEEE--------EEEECC-CC
T ss_conf             9407010235676651-36863-6886035664899999985899789806621013367899--------997237-68


Q ss_pred             CCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCC
Q ss_conf             43222010000089999986204623566445448985570-48999886514775104433265441156665420133
Q gi|254780206|r  233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNL  311 (424)
Q Consensus       233 ~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L  311 (424)
                      ++++.++. +++..+.+++     ++|.|+|-++|-+|.+| ..|=|+..|.-+----++--.-.|-|-..+-+++.--|
T Consensus       222 ~~~~~~~A-~~~a~~i~~~-----L~yvGVl~vE~Fv~~dg~llvNEiAPRvHNSGH~T~~gc~~SQFEqHlRAv~glPL  295 (375)
T COG0026         222 PDDLQAQA-EEMAKKIAEE-----LDYVGVLAVEFFVTPDGELLVNEIAPRVHNSGHWTIDGCETSQFEQHLRAVLGLPL  295 (375)
T ss_pred             CHHHHHHH-HHHHHHHHHH-----CCCEEEEEEEEEEECCCCEEEEECCCCCCCCCCCCHHHCCCCHHHHHHHHHHCCCC
T ss_conf             98999999-9999999997-----59457899999997898489861368987866512331212489999999829999


Q ss_pred             CCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCC-EEEEEEECCCHHHHHHH
Q ss_conf             33212344442067542254466877579762487666898689983358778879981880-79999962898999999
Q gi|254780206|r  312 HNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGR-VLSATALGKTITESREL  390 (424)
Q Consensus       312 ~~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGR-VL~vv~~g~~l~eA~~~  390 (424)
                      .+.  .....++|.=+|=.. .|  ...-..+  +  ..++.++++=|-.      -+--|| +-.|+-.+.+.++..+.
T Consensus       296 g~~--~~~~p~vMvNlLG~~-~~--~~~~~~~--l--~~p~~~lH~YGK~------e~R~gRKmGHvn~~~~~~~~~~~~  360 (375)
T COG0026         296 GST--TLLSPSVMVNLLGDD-VP--PDDVKAV--L--ALPGAHLHWYGKA------EARPGRKMGHVNVLGSDSDELEQL  360 (375)
T ss_pred             CCC--CCCCCEEEEEECCCC-CC--HHHHHHH--H--HCCCCEEEEECCC------CCCCCCEEEEEEEECCCHHHHHHH
T ss_conf             975--424760799951777-76--1346889--7--4999789970576------577997335688615978999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             99998525899
Q gi|254780206|r  391 AYHMVENIDWK  401 (424)
Q Consensus       391 ay~~i~~I~~~  401 (424)
                      +-........+
T Consensus       361 ~~~l~~~~~~~  371 (375)
T COG0026         361 AALLPAKQLSG  371 (375)
T ss_pred             HHHHHHHHCCC
T ss_conf             87643333024


No 47 
>pfam02655 ATP-grasp_3 ATP-grasp domain. No functional information or experimental verification of function is known in this family. This family appears to be an ATP-grasp domain (Pers. obs. A Bateman).
Probab=99.83  E-value=5.4e-21  Score=171.72  Aligned_cols=157  Identities=27%  Similarity=0.399  Sum_probs=114.4

Q ss_pred             HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHH
Q ss_conf             01023578887653101111223440111112101242025630465343000232356778887887514453177788
Q gi|254780206|r  101 SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE  180 (424)
Q Consensus       101 ~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliE  180 (424)
                      +||..++++|+++|||||++..+.+.++       +.+|+||||...+||+||+++++.+++.++.        ..+|+|
T Consensus         2 ~DK~~t~~~l~~~gip~P~~~~~~~~~~-------~~~P~VvKP~~g~gs~Gv~~v~~~~~l~~~~--------~~~liq   66 (160)
T pfam02655         2 SDKLKTYKALKNAGVPTPETLSAEEPTE-------EEKKYIVKPRDGCGGEGVRFVENGREDEEFI--------ENVIIQ   66 (160)
T ss_pred             CCHHHHHHHHHHCCCCCCCEEECCCHHH-------CCCCEEEECCCCCCCCCEEEEECHHHHHHHC--------CCEEEE
T ss_conf             8989999999987959999986578235-------5998999808989873189994899986532--------565887


Q ss_pred             HHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEE
Q ss_conf             77520575234421577631035200011135665444443443000012344322201000008999998620462356
Q gi|254780206|r  181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQ  260 (424)
Q Consensus       181 efl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~  260 (424)
                      ||++|.|+|+.++++++.+.++...+.+.  . ..... ..-.|+.+|.+..   ..+++ .+++..+++++.  +  ++
T Consensus        67 e~i~G~e~sv~~l~~~~~~~~~~~~~~~~--~-~~~~~-~~~~g~~~~~~~~---~~~~~-~~~~~~~~~~l~--~--~~  134 (160)
T pfam02655        67 EFIEGEPLSVSLLSDGEKALPLSVNRQLI--D-NAGSG-FVYAGNLTPSRTE---LKEEL-EELAEEVVEALP--G--LR  134 (160)
T ss_pred             EEEECCEEEEEEEEECCEEEEEEEEEEEE--C-CCCCC-CCCCCCCEECCCC---CHHHH-HHHHHHHHHHHC--C--CC
T ss_conf             47944423899999899999999857885--1-47864-2103763013758---88999-999999999843--8--75


Q ss_pred             EEEEEEEEEECCEEEEEEEEEEEC
Q ss_conf             644544898557048999886514
Q gi|254780206|r  261 GVLFAGLMITEQGPYLIEYNVRFG  284 (424)
Q Consensus       261 G~l~~~~m~t~~gp~viE~N~R~G  284 (424)
                      |++++|+|+++++|||||+|+||-
T Consensus       135 G~~~vd~~~~~~~~~viEiNpR~s  158 (160)
T pfam02655       135 GYVGVDLVLTDNGPYVIEVNPRIT  158 (160)
T ss_pred             CEEEEEEEEECCEEEEEEEECCCC
T ss_conf             648889999999089999968877


No 48 
>pfam07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This family represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme EC:6.3.2.4. D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine:D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF).
Probab=99.82  E-value=8.8e-21  Score=170.17  Aligned_cols=161  Identities=23%  Similarity=0.290  Sum_probs=117.2

Q ss_pred             HHHHHHHHCCCCCCCCCCH----HHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             8876531011112234401----111121012420256304653430002323567788878875144531777887752
Q gi|254780206|r  109 FCTKYGIPTATYQHFSDPM----KAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLE  184 (424)
Q Consensus       109 ~l~~~gIPt~~~~~~~~~~----ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~  184 (424)
                      +|+++|||||+|..+++.+    ++.++.+++|||+||||....+|+||.+++|.+|+.++++.++. .++.+|||||++
T Consensus         1 ll~~~Giptp~~~~v~~~~~~~~~~~~i~~~lg~P~vvKP~~~gss~Gv~~v~~~~el~~~i~~~~~-~~~~vlVEefi~   79 (201)
T pfam07478         1 LLKAAGIPVAPFIVLTREDWVLATIEKVEEKLGYPVFVKPANLGSSVGISKVTSREELQSAIEEAFQ-YDNKVLIEEAIE   79 (201)
T ss_pred             CHHHCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEEECCHHHHHHHHHHHHH-CCCCEEEEECCC
T ss_conf             9556599999908982532343579999986599889998999986687999584687999999874-598079998566


Q ss_pred             CCCCCEEEECCCCCCCCCCCCC--------CCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCC
Q ss_conf             0575234421577631035200--------01113566544444344300001234432220100000899999862046
Q gi|254780206|r  185 GFEVSFFALCDGKTAIPFTTAR--------DHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQ  256 (424)
Q Consensus       185 G~E~Sv~~i~dG~~~~~l~~~~--------dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~  256 (424)
                      |.|++|.++.+++. ..+|+.+        ||...+..+.+     + ...|.+ ++++.    .+++.+-..++.+..|
T Consensus        80 G~E~~v~vl~~~~~-~~~~~~e~~~~~~~~~~~~k~~~~~~-----~-~~~Pa~-l~~~~----~~~i~~~A~~~~~aLg  147 (201)
T pfam07478        80 GREIECAVLGNEDL-EVSPVGEIRLSGGFYDYEAKYILSSA-----Q-IIVPAD-LPEEV----EEQIQELALKAYKALG  147 (201)
T ss_pred             CCEEEEEEEECCCE-EEEEEEEEECCCCEEEHHHEECCCCC-----E-EEECCC-CCHHH----HHHHHHHHHHHHHHHC
T ss_conf             96799999708980-89875899437750267680136872-----3-761566-85999----9999999999999848


Q ss_pred             CEEEEEEEEEEEEECCE-EEEEEEEEEEC
Q ss_conf             23566445448985570-48999886514
Q gi|254780206|r  257 NPFQGVLFAGLMITEQG-PYLIEYNVRFG  284 (424)
Q Consensus       257 ~~y~G~l~~~~m~t~~g-p~viE~N~R~G  284 (424)
                      +  +|+..++|+++++| ||++|+|++.|
T Consensus       148 ~--~g~~rvD~~~d~~g~~~vlEvN~~Pg  174 (201)
T pfam07478       148 C--RGLARIDFFLTEDGEIYLNEVNTMPG  174 (201)
T ss_pred             C--CCCEEEEEEECCCCCEEEEEECCCCC
T ss_conf             8--76057999996899499999549799


No 49 
>pfam08443 RimK RimK-like ATP-grasp domain. This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK.
Probab=99.82  E-value=3.6e-20  Score=165.79  Aligned_cols=167  Identities=17%  Similarity=0.293  Sum_probs=118.5

Q ss_pred             HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCC-CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             010235788876531011112234401111121012-4202563046534300023235677888788751445317778
Q gi|254780206|r  101 SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNK-SMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII  179 (424)
Q Consensus       101 ~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~-g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~Vli  179 (424)
                      +||..+|++|+++|||||++..+.+.+++.++++++ +||+||||...++|+||.++++.+++.++++... ..+.++++
T Consensus         2 ~DK~~tk~ll~~~Gip~P~~~~~~~~~~~~~~~~~~~g~PvVvKP~~g~~g~gV~~v~~~~el~~~~~~~~-~~~~~vlv   80 (190)
T pfam08443         2 RDKAKSHQLLAKHGIPVPNTGLAWSPEDAEKFIEQIKGFPVVVKSVFGSQGIGVFLAEDEQSLEQLLEAFK-WLKNQILV   80 (190)
T ss_pred             CCHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHCCCCEEEECCCCCCCCCEEEEECHHHHHHHHHHHH-HCCCCEEE
T ss_conf             78899999999879797998998899999999998089838996788999845588606377778888886-34873775


Q ss_pred             HHHHH---CCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCC
Q ss_conf             87752---057523442157763103520001113566544444344300001234432220100000899999862046
Q gi|254780206|r  180 EEYLE---GFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQ  256 (424)
Q Consensus       180 Eefl~---G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~  256 (424)
                      ||||+   |.|+.+.++ +|+ ++.  ..+.+..-.+......+||.  ..|.     ++.+++ .++..   ++.+..|
T Consensus        81 qefI~~~~~~dirv~vi-~~~-~~~--~~~~~~~~~~~~~n~~~g~~--~~~~-----~l~~e~-~e~a~---~a~~alg  145 (190)
T pfam08443        81 QEFIAEAGNRDIRCLVV-GGE-VVG--AIHRQSNEGDFRTNLHRGGV--AEPY-----QLSQEE-EEIAI---KAAQAMG  145 (190)
T ss_pred             EEEEECCCCCEEEEEEE-CCC-EEE--EEEEECCCCCCCCCCCCCCE--ECCC-----CCCHHH-HHHHH---HHHHHHC
T ss_conf             55660478854899996-063-367--89997466762143246862--4587-----668899-99999---9999738


Q ss_pred             CEEEEEEEEEEEEECCEEEEEEEEEEECCC
Q ss_conf             235664454489855704899988651477
Q gi|254780206|r  257 NPFQGVLFAGLMITEQGPYLIEYNVRFGDP  286 (424)
Q Consensus       257 ~~y~G~l~~~~m~t~~gp~viE~N~R~GDP  286 (424)
                      +.|.|   ++|+.+++||+|||+|++.|=.
T Consensus       146 l~~~g---VD~~~~~~g~~vlEvN~~Pg~~  172 (190)
T pfam08443       146 LDVLG---VDIFRSKRGLLVCEVNSSPGLK  172 (190)
T ss_pred             CCEEE---EEEEEECCCEEEEEECCCCCCH
T ss_conf             99799---9999979967999966984604


No 50 
>pfam02222 ATP-grasp ATP-grasp domain. This family does not contain all known ATP-grasp domain members. This family includes a diverse set of enzymes that possess ATP-dependent carboxylate-amine ligase activity.
Probab=99.82  E-value=7.7e-21  Score=170.60  Aligned_cols=158  Identities=20%  Similarity=0.238  Sum_probs=118.5

Q ss_pred             HHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC-CCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHH-CCC
Q ss_conf             876531011112234401111121012420256304-653430002323567788878875144531777887752-057
Q gi|254780206|r  110 CTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD-GLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLE-GFE  187 (424)
Q Consensus       110 l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~-~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~-G~E  187 (424)
                      |+++|||||+|..+++.+|+.++++++|||+||||. +.++|+|+.++++.+|+.++++...   +.++++|||++ +.|
T Consensus         1 l~~~Giptp~~~~i~~~~d~~~~~~~iGyP~vvKp~~~G~~g~G~~~v~~~~el~~a~~~~~---~~~~liE~~I~~~~E   77 (171)
T pfam02222         1 LQKLGLPTPRFMAAESLEELIEAGQELGYPCVLKARRGGYDGKGQYVVRSEADIPQAWEELG---GGPVIVEEFVPFDKE   77 (171)
T ss_pred             CHHCCCCCCCCEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEECCHHHHHHHHHHCC---CCCEEEEEECCCCEE
T ss_conf             90209899995498999999999997099789996110258985289889999999998558---995799860467579


Q ss_pred             CCEEEECCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEE
Q ss_conf             5234421577-631035200011135665444443443000012344322201000008999998620462356644544
Q gi|254780206|r  188 VSFFALCDGK-TAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAG  266 (424)
Q Consensus       188 ~Sv~~i~dG~-~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~  266 (424)
                      +|+.+..+.. .+..+|+.+.+.+  +++..      -++.|.+ +++++.+++ +++.++++++   .+  |+|++.++
T Consensus        78 i~~~~~r~~~g~~~~~~~~e~~~~--~g~~~------~~~~Pa~-~~~~~~~~i-~~~a~ki~~a---Lg--~~G~~~ve  142 (171)
T pfam02222        78 LSVLVVRSVDGETAFYPPVETIQE--DGICH------ESVAPAR-VPDSQQAKA-QEIAKKIVDE---LG--GVGIFGVE  142 (171)
T ss_pred             EEEEEEECCCCCEEECCCEEEEEE--CCEEE------EEECCCC-CCHHHHHHH-HHHHHHHHHH---CC--CCCEEEEE
T ss_conf             998743449998998035466886--78189------8742888-898999999-9999999998---39--70459999


Q ss_pred             EEEECCE-EEEEEEEEEECC
Q ss_conf             8985570-489998865147
Q gi|254780206|r  267 LMITEQG-PYLIEYNVRFGD  285 (424)
Q Consensus       267 ~m~t~~g-p~viE~N~R~GD  285 (424)
                      |+++++| .||+|+|+|.-+
T Consensus       143 ff~~~dG~~~v~EvnpR~h~  162 (171)
T pfam02222       143 LFVLPDGDLLVNELAPRPHN  162 (171)
T ss_pred             EEECCCCCEEEEEECCCCCC
T ss_conf             99939997999996499677


No 51 
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, ATPase subunit; InterPro: IPR005875    Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE. This family represents PurK, N5-carboxyaminoimidazole ribonucleotide (N5_CAIR) synthetase, which catalyzes the conversion of 5-aminoimidazole ribonucleotide (AIR), ATP, and bicarbonate to N5-CAIR, ADP, and Pi. PurE converts N5-CAIR to CAIR. In the presence of high concentrations of bicarbonate, PurE is reported able to convert AIR to CAIR directly and without ATP.    PurK belongs to the ATP grasp superfamily of C-N ligase enzymes. Each subunit of PurK is composed of three domains (A, B, and C). The B domain contains a flexible, glycine-rich loop (B loop, T123-G130) that is disordered in the sulphate-PurK structure and becomes ordered in the MgADP-PurK structure. MgADP is wedged between the B and C domains, as with all members of the ATP grasp superfamily. Other enzymes in this superfamily contain a conserved Omega loop proposed to interact with the B loop, define the specificity of their nonnucleotide substrate, and protect the acyl phosphate intermediate formed from this substrate. PurK contains a minimal Omega loop without conserved residues. In the reaction catalyzed by PurK, carboxyphosphate is the putative acyl phosphate intermediate. The sulphate of the sulphate ion-liganded PurK interacts electrostatically with Arg 242 and the backbone amide group of Asn 245, components of the J loop of the C domain. This sulphate may reveal the location of the carboxyphosphate binding site. Conserved residues within the C-terminus of the C domain define a pocket that is proposed to bind AIR in collaboration with an N-terminal strand loop helix motif in the A domain (P loop, G8-L1). The P loop is proposed to bind the phosphate of AIR on the basis of similar binding sites observed in PurN and PurE and proposed in PurD and PurT, four other enzymes in the purine pathway .; GO: 0004638 phosphoribosylaminoimidazole carboxylase activity, 0006189 'de novo' IMP biosynthetic process, 0009320 phosphoribosylaminoimidazole carboxylase complex.
Probab=99.81  E-value=9.8e-19  Score=155.40  Aligned_cols=351  Identities=21%  Similarity=0.268  Sum_probs=237.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHC--CCCCEEEEE-CC-CHHHHHCCE---EEECCCCCHHHHHHHHHHHCCCEEEEC----C
Q ss_conf             589988658899999999858--996789995-49-835751170---551287898999999987189799997----9
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQS--PLLSELWSI-PG-NPGIAQHAQ---CVAIDIQNHSAIIHFCQEKHIDLVVVG----P   70 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s--~~~~~v~~~-pg-N~g~~~~~~---~~~i~~~d~~~i~~~a~~~~iDlvivg----p   70 (424)
                      +|.|||+|    =|+|.+.++  +.--++++. |. |+-..++++   .+.....|.+++.++|+.-  |.+=.-    +
T Consensus         1 ~vGilGGG----QLG~M~~~aA~~LG~~~~VL~~~~~~PA~q~Ad~~~~v~a~~~d~~~i~~La~~c--DviT~E~Ehv~   74 (386)
T TIGR01161         1 TVGILGGG----QLGRMLALAAKKLGIKVAVLDPDANSPAKQVADSREHVLASFTDPEAIRELAEAC--DVITFEFEHVD   74 (386)
T ss_pred             CEEEEECC----HHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHC--CEEEEEECCCC
T ss_conf             96897188----4899999987127958998548989731112898557998514878999999765--65543101378


Q ss_pred             CHHHHHHHHHHHHHCC--CCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCC--CCHHHHHHHHCCCCEEEEEEC-
Q ss_conf             5578748998986058--80670106665552010235788876531011112234--401111121012420256304-
Q gi|254780206|r   71 ELPLVNGISDALNAAG--FKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFS--DPMKAKQYVQNKSMPIVVKAD-  145 (424)
Q Consensus        71 E~pL~~gi~d~l~~~g--i~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~--~~~ea~~~~~~~g~PvVVKp~-  145 (424)
                      +..|     |.|...|  ++++ |+..+-.+-.||...|++|+++|+|||+|..+.  +.++.....+++|+|+|||.. 
T Consensus        75 ~~~L-----~~L~~~g~~~~~~-P~~~~l~~~~dk~~qK~~L~~~g~~vp~f~~~~~~~~~~~~~~~~~~g~p~VlK~~~  148 (386)
T TIGR01161        75 VEAL-----EKLEARGDKVKVR-PSPEALAIIQDKLTQKQFLQKLGLPVPPFVVIEIKDEEELDSALQELGFPVVLKARR  148 (386)
T ss_pred             CHHH-----HHHHHCCCEEEEE-CCHHHHHHHHCHHHHHHHHHHCCCCCCCCCEEECCCHHHHHHHHHHCCCCEEEEEEE
T ss_conf             5678-----9998359847760-388999988365899999996689988412022368425789998739847998420


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC-CCCCEEEEC--CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             6534300023235677888788751445317778877520-575234421--5776310352000111356654444434
Q gi|254780206|r  146 GLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEG-FEVSFFALC--DGKTAIPFTTARDHKRIHDGDIGPNTGG  222 (424)
Q Consensus       146 ~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G-~E~Sv~~i~--dG~~~~~l~~~~dyKr~~~~d~GpnTGG  222 (424)
                      +..-|||++++++.+++..+++.. ++...+++||||+.= .|+||.+.-  +|+ +.+.|.++.+-   .+|.|-=   
T Consensus       149 gGYDGrGq~~i~~~~~~~~~~~~~-~~~~~~~~~E~fV~F~~Elsv~vaR~~~G~-~~~YP~ven~~---~ddagIl---  220 (386)
T TIGR01161       149 GGYDGRGQFVIKSEADLPQALKEL-GDKEEELIVEEFVPFERELSVIVARSADGE-IAFYPVVENIH---QDDAGIL---  220 (386)
T ss_pred             CCCCCCCCEEECCHHHHHHHHHHC-CCCCEEEEEEECCCCCEEEEEEEEECCCCC-EEECCCEEEEE---ECCCCEE---
T ss_conf             652773108974743288999852-888405898523562006999999778974-88828612356---5277877---


Q ss_pred             CCEEECCCCCCCCC---CEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEE--CCE-----EEEEEEEEEECCCCCEEEE
Q ss_conf             43000012344322---2010000089999986204623566445448985--570-----4899988651477510443
Q gi|254780206|r  223 MGACSPALGMSQEL---YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT--EQG-----PYLIEYNVRFGDPECQAMM  292 (424)
Q Consensus       223 MGa~~p~~~~~~~~---~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t--~~g-----p~viE~N~R~GDPE~q~il  292 (424)
                      -=+|.|+|-+++.+   ..++ +++....++     .++|.|++-++|=+|  .+|     .=|=|+-.|-=+--==+|-
T Consensus       221 ~~~~aPAPa~p~~~~Q~~~~A-~~~A~~~~~-----~L~~VG~~avE~F~~Pa~dGP~P~~LLvNElAPR~HNSGHyTlD  294 (386)
T TIGR01161       221 RLVVAPAPAVPDALVQQQKKA-QELARRLAE-----ELDYVGVLAVEMFLLPAKDGPEPDELLVNELAPRPHNSGHYTLD  294 (386)
T ss_pred             EEEEECCCCCCHHHHHHHHHH-HHHHHHHHH-----HCCCEEEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCHHHHHH
T ss_conf             898633777834578999999-999999998-----61961788899983068878951205661025788984126566


Q ss_pred             ECCCCCCHHHHHHHHHCCCCC--CCCCCCC-CCEEEEEECCCCCCCCCCCCC-CCCCCCCCCCCCEEEEEEEEEECCEEE
Q ss_conf             326544115666542013333--2123444-420675422544668775797-624876668986899833587788799
Q gi|254780206|r  293 MRLESDILEILNSCVHGNLHN--THINWKA-EYALTVVVATKGYPEEYPHGT-IISKIPQNTGTTQLFHAGTAIVNNNLT  368 (424)
Q Consensus       293 p~L~~dl~~il~~~~~g~L~~--~~~~~~~-~~~v~Vvlas~GYP~~~~kg~-~I~~l~~~~~~~~ifhagt~~~~g~l~  368 (424)
                      ---.|-|=..|-++++--|.+  ..+.+-. .+.|.=+|=..+| ..+.... .+..++.  ...++|+-.=.       
T Consensus       295 gc~tSQFE~hLRAi~~LPLg~~~t~~~~PTT~~~MVNlLG~~~~-~~~~~~~~~~~~~P~--a~lhwYGK~E~-------  364 (386)
T TIGR01161       295 GCSTSQFEQHLRAILGLPLGSIFTELLLPTTQAVMVNLLGTEGP-DEVAPLWEELLALPG--AKLHWYGKAEV-------  364 (386)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEECCCCC-CHHHHHHHHHHHCCC--CEEEEECCEEE-------
T ss_conf             54331799999997088987444100278430578988335676-266788999973898--47887546003-------


Q ss_pred             ECCCC-EEEEEEECCCHHHHHH
Q ss_conf             81880-7999996289899999
Q gi|254780206|r  369 ANGGR-VLSATALGKTITESRE  389 (424)
Q Consensus       369 t~GGR-VL~vv~~g~~l~eA~~  389 (424)
                       --|| +-.||-.+.|.+++.+
T Consensus       365 -RpgRK~GH~n~~~~~~~~~~~  385 (386)
T TIGR01161       365 -RPGRKVGHVNLVGSDLEELEQ  385 (386)
T ss_pred             -CCCCCEEEEEECCCCHHHHCC
T ss_conf             -789610168633868355304


No 52 
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane]
Probab=99.78  E-value=3.1e-18  Score=151.80  Aligned_cols=225  Identities=19%  Similarity=0.247  Sum_probs=157.0

Q ss_pred             HHCCCEEEE---CCCHHHHHH-HHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCC----HHHHH
Q ss_conf             718979999---795578748-9989860588067010666555201023578887653101111223440----11111
Q gi|254780206|r   60 EKHIDLVVV---GPELPLVNG-ISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDP----MKAKQ  131 (424)
Q Consensus        60 ~~~iDlviv---gpE~pL~~g-i~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~----~ea~~  131 (424)
                      -.++|.+|+   |+.-  .+| +...|+..|+|+.|+...++.+.+||.++|.+++..++|++.|..++..    ....+
T Consensus        59 ~~~~~vvfp~lhG~~g--EDg~iqg~le~~giPyvg~gv~~Sa~~mdk~~~K~~~~~~g~~~a~~~~~~~~~~~~~~~e~  136 (317)
T COG1181          59 LQKADVVFPVLHGPYG--EDGTIQGLLELLGIPYVGKGVLASAGAMDKIVTKRLFKAEGLPVAPYVALTRDEYSSVIVEE  136 (317)
T ss_pred             HCCCCEEEEECCCCCC--CCCHHHHHHHHHCCCEEECCHHHHHHCCCHHHHHHHHHHCCCCCCHHHHHHCCCCHHHHHHH
T ss_conf             0269877871558888--87069999997099876076445332350999988998678651235675334520478887


Q ss_pred             HHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCC--CCCC-
Q ss_conf             2101242025630465343000232356778887887514453177788775205752344215776310352--0001-
Q gi|254780206|r  132 YVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTT--ARDH-  208 (424)
Q Consensus       132 ~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~--~~dy-  208 (424)
                      +....+||++|||+.+-++-|+..+++.+|...+++.+| ..+.++++|+|+.|.|+.|.++.+......+++  ...- 
T Consensus       137 ~~~~l~~p~~Vkp~~~gSSvg~~~v~~~~d~~~~~e~a~-~~d~~vl~e~~~~~rei~v~vl~~~~~~~~l~~~eI~~~~  215 (317)
T COG1181         137 VEEGLGFPLFVKPAREGSSVGRSPVNVEGDLQSALELAF-KYDRDVLREQGITGREIEVGVLGNDYEEQALPLGEIPPKG  215 (317)
T ss_pred             HHCCCCCCEEEECCCCEEEEEEEECCEECCHHHHHHHHH-HHCCCCEECCCCCCCEEEEEECCCCCCCEECCCCEEECCC
T ss_conf             741468878998587311367998835043699999999-8478512003776655898635886552444761681699


Q ss_pred             CCCCCCCCC-CCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC--CEEEEEEEEEEECC
Q ss_conf             113566544-444344300001234432220100000899999862046235664454489855--70489998865147
Q gi|254780206|r  209 KRIHDGDIG-PNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE--QGPYLIEYNVRFGD  285 (424)
Q Consensus       209 Kr~~~~d~G-pnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~--~gp~viE~N~R~GD  285 (424)
                      .+.|+.+.- -.|||-=-.+|. .+++++.+    ++.+-.+++.+..++  .|+..+|||+++  +.++++|+|+..| 
T Consensus       216 ~~fydye~Ky~~~gg~~~~~pa-~lt~~~~~----~i~~lA~~a~~alg~--~g~~rvDf~~~~~~g~~~l~EvNt~PG-  287 (317)
T COG1181         216 EEFYDYEAKYLSTGGAQYDIPA-GLTDEIHE----EIKELALRAYKALGC--LGLARVDFFVDDDEGEFVLLEVNTNPG-  287 (317)
T ss_pred             CEEEEEECCCCCCCCCEEECCC-CCCHHHHH----HHHHHHHHHHHHCCC--CCEEEEEEEEECCCCCEEEEEEECCCC-
T ss_conf             8698600014578984353788-99988999----999999999986088--875888799987899899998708998-


Q ss_pred             CCCEEEEECC
Q ss_conf             7510443326
Q gi|254780206|r  286 PECQAMMMRL  295 (424)
Q Consensus       286 PE~q~ilp~L  295 (424)
                      .-...+.|.+
T Consensus       288 ~t~~sl~P~~  297 (317)
T COG1181         288 MTAMSLFPKA  297 (317)
T ss_pred             CCCCCCCHHH
T ss_conf             7653537677


No 53 
>PRK06849 hypothetical protein; Provisional
Probab=99.78  E-value=3.5e-17  Score=144.19  Aligned_cols=258  Identities=17%  Similarity=0.163  Sum_probs=173.1

Q ss_pred             CEEEEECCCHH-HHHHHHHHHHCCCCCEEEEECCCH----HHHH-CCEEEECC-CC-C----HHHHHHHHHHHCCCEEEE
Q ss_conf             95899886588-999999998589967899954983----5751-17055128-78-9----899999998718979999
Q gi|254780206|r    1 MRVLLIGSGGR-EHALAWKIAQSPLLSELWSIPGNP----GIAQ-HAQCVAID-IQ-N----HSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         1 MkILviGsGgr-EhAl~~~l~~s~~~~~v~~~pgN~----g~~~-~~~~~~i~-~~-d----~~~i~~~a~~~~iDlviv   68 (424)
                      ++|||-|.-.. .-.||..|.+.+.  .|+++.-++    ..+. ....+.+. +. |    .+++++++++++||++||
T Consensus         5 ~tvLiTg~r~~~aL~laR~l~~~Gh--~V~~aD~~~~~l~r~Sr~v~~~~~vP~P~~d~~~y~~~Ll~Iv~~e~idl~IP   82 (387)
T PRK06849          5 KTVLITGARAPAALQLARSFHNAGH--TVILADSLKYPLSRFSRAVDGFYTIPSPKWDPNAYIQALLSIVKRHNIDLLIP   82 (387)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCC--EEEEECCCCCCCCCHHHCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             7799958860789999999987899--79998489877542000011279869997898999999999999838999997


Q ss_pred             CCCHH-HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHC-CCCEEEEEECC
Q ss_conf             79557-87489989860588067010666555201023578887653101111223440111112101-24202563046
Q gi|254780206|r   69 GPELP-LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQN-KSMPIVVKADG  146 (424)
Q Consensus        69 gpE~p-L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~-~g~PvVVKp~~  146 (424)
                      -.|+- ..+-..+.|. ....+|.|..+..+.--||.-.-+++.+.|+|+|+...++|.+++..+... .+.|+|+||.+
T Consensus        83 ~~eev~~~a~~~~~l~-~~~~~~~~d~~~l~~LhdK~~F~~~a~~lGl~vP~T~~i~s~edv~~~~~~~~~~~~ilKPv~  161 (387)
T PRK06849         83 TCEEVFYLSLAKEELS-AYCHVFHFDFDLLLMLHNKFEFIQQARSLGLSAPKTYLITDPEAIINFDFKTPHTPYVLKPIY  161 (387)
T ss_pred             CCCHHHHHHHHHHHCC-CCCCEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHCCCCCCEEECCCC
T ss_conf             7768999986576447-676376589999998644899999999749999988981899999865533668978982376


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEE
Q ss_conf             53430002323567788878875144531777887752057523442157763103520001113566544444344300
Q gi|254780206|r  147 LCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGAC  226 (424)
Q Consensus       147 ~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~  226 (424)
                      ..+|++|....+.++    ++..--....+.+++|||.|.|++..++++..+++....   |++.+..+.       |+ 
T Consensus       162 ~~~~~~v~~~~~~~~----l~~l~~s~~~p~v~Qe~I~G~~~ct~al~~~Gkv~A~~~---y~~~~~~~~-------g~-  226 (387)
T PRK06849        162 SRFVRRVDLTKTKAA----VLKLPISHKSPWIMQEFIPGQEYCSYSIVRSGELRAHSC---YKPEFTAGL-------GA-  226 (387)
T ss_pred             CCCCCEEEECCCHHH----HHCCCCCCCCCEEEEEECCCCEEEEEEEEECCEEEEEEE---EECCEECCC-------CE-
T ss_conf             665333652159778----615887667982899871696758999978999999998---204220588-------40-


Q ss_pred             ECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE-EEEEEEEEEEC
Q ss_conf             00123443222010000089999986204623566445448985570-48999886514
Q gi|254780206|r  227 SPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFG  284 (424)
Q Consensus       227 ~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g-p~viE~N~R~G  284 (424)
                      +-.  + +...+.-+.+.++..++.     +.|+|++-++||.+++| +|+||.|.|.-
T Consensus       227 ~v~--f-e~v~~p~i~e~v~~f~~~-----~~~tG~isFDFI~~~dG~~~~IECNPR~t  277 (387)
T PRK06849        227 QIA--F-QPINNPRIEEFVTHFVKE-----LNYTGQISFDFIQTENGDAYPIECNPRTT  277 (387)
T ss_pred             EEE--E-EECCCHHHHHHHHHHHHH-----CCCEEEEEEEEEECCCCCEEEEEECCCCC
T ss_conf             578--8-975888999999999984-----78515899999998999889998459866


No 54 
>PRK10446 ribosomal protein S6 modification protein; Provisional
Probab=99.77  E-value=1e-17  Score=148.05  Aligned_cols=274  Identities=19%  Similarity=0.272  Sum_probs=179.0

Q ss_pred             CEEEEECCCHHHH---HHHHHHHHCCCCCEEEEE-CCCHHHHHC--CEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCH
Q ss_conf             9589988658899---999999858996789995-498357511--7055128789899999998718979999--7955
Q gi|254780206|r    1 MRVLLIGSGGREH---ALAWKIAQSPLLSELWSI-PGNPGIAQH--AQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPEL   72 (424)
Q Consensus         1 MkILviGsGgrEh---Al~~~l~~s~~~~~v~~~-pgN~g~~~~--~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~   72 (424)
                      |||.|++..++-+   .|..+..+-..  ++.+. |-.-.+...  ...+...-.+         -...|.+++  ||..
T Consensus         1 mki~iLs~~~~~yst~RL~eaa~~rGh--~v~vidp~~~~~~i~~~~~~v~~~g~~---------L~~~DavipR~g~~~   69 (300)
T PRK10446          1 MKIAILSRDGTLYSCKRLREAAIQRGH--LVEILDPLSCYMNINPAASSIHYKGRK---------LPHFDAVIPRIGTAI   69 (300)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCC--EEEEEEHHHCEEEECCCCCEEEECCEE---------CCCCCEEEECCCCCC
T ss_conf             979999369976079999999998799--599961489189824898649989808---------687888998267774


Q ss_pred             H-HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCC-CCEEEEEECCCCCC
Q ss_conf             7-874899898605880670106665552010235788876531011112234401111121012-42025630465343
Q gi|254780206|r   73 P-LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNK-SMPIVVKADGLCAG  150 (424)
Q Consensus        73 p-L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~-g~PvVVKp~~~agG  150 (424)
                      - ....+...|+..|++|+ -+.++.....||.++-.+|.++|||+|+...+.+.+++.++++.+ ++|+|+||-..+.|
T Consensus        70 t~~~~~vLr~lE~~Gv~vi-N~~~aI~~~~DKl~t~qlL~~~gip~P~T~~~~~~~~~~~~i~~~gg~PvViKpl~Gs~G  148 (300)
T PRK10446         70 TFYGTAALRQFEMLGSYPL-NESVAIARARDKLRSMQLLARQGIDLPVTGIAHSPDDTSDLIDMVGGAPLVVKLVEGTQG  148 (300)
T ss_pred             CHHHHHHHHHHHHCCCCEE-CCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             5589999999998899186-489999985769999999987597999889836999999999980899789996789886


Q ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHH---CCCCCEEEECCCCCCCCCCCCCCCCCC-CCCCCCCC--CCCCC
Q ss_conf             0002323567788878875144531777887752---057523442157763103520001113-56654444--43443
Q gi|254780206|r  151 KGVVVAATVDEATSAIDRCFQQINSTVIIEEYLE---GFEVSFFALCDGKTAIPFTTARDHKRI-HDGDIGPN--TGGMG  224 (424)
Q Consensus       151 kGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~---G~E~Sv~~i~dG~~~~~l~~~~dyKr~-~~~d~Gpn--TGGMG  224 (424)
                      +||.++++.+.+...++... ..+..++++||+.   |..+-++++ +| +++.  ..   +|. .++|-=-|  .||  
T Consensus       149 ~GV~l~e~~~~~~~i~~~~~-~~~~~~~iQeyI~~~~g~D~Rv~vv-gg-~vva--am---~R~~~~g~~rtN~~~Gg--  218 (300)
T PRK10446        149 IGVVLAETRQAAESVIDAFR-GLNAHILVQEYIKEAQGCDIRCLVV-GD-EVVA--AI---ERRAKEGDFRSNLHRGG--  218 (300)
T ss_pred             CCEEEEECHHHHHHHHHHHH-HCCCCEEEEEECCCCCCCCEEEEEE-CC-EEHH--HE---EEECCCCCEEEEEECCC--
T ss_conf             03699737899999999886-2287377522025557986799999-98-6244--38---99737883477770397--


Q ss_pred             EEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHH
Q ss_conf             00001234432220100000899999862046235664454489855704899988651477510443326544115666
Q gi|254780206|r  225 ACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILN  304 (424)
Q Consensus       225 a~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~  304 (424)
                      ...|.+ ++    ++. .++...+.+++   |..|.|   +|++.+++||+|+|+|.   -|+++-+-..-..|....+.
T Consensus       219 ~~~~~~-l~----~e~-~~la~~a~~~l---gl~~~G---VDii~~~~g~~v~EVN~---~Pg~~gi~~~tgvdiA~~Ii  283 (300)
T PRK10446        219 AASVAS-IT----PQE-REIAIKAARTM---ALDVAG---VDILRANRGPLVMEVNA---SPGLEGIEKTTGIDIAGKMI  283 (300)
T ss_pred             EEEECC-CC----HHH-HHHHHHHHHHH---CCCEEE---EEEEEECCCCEEEEECC---CHHHHHHHHHHCCCHHHHHH
T ss_conf             765328-99----999-99999999986---996899---99988289988999938---74278898875989899999


Q ss_pred             HHHHCCC
Q ss_conf             5420133
Q gi|254780206|r  305 SCVHGNL  311 (424)
Q Consensus       305 ~~~~g~L  311 (424)
                      ..++.+-
T Consensus       284 ~~ie~~~  290 (300)
T PRK10446        284 RWIERHA  290 (300)
T ss_pred             HHHHHHC
T ss_conf             9999767


No 55 
>KOG0370 consensus
Probab=99.77  E-value=2.8e-17  Score=144.82  Aligned_cols=289  Identities=18%  Similarity=0.325  Sum_probs=206.8

Q ss_pred             EEEECCC------HHHH---H--HHHHHHHCCCCCEEEEECCCHHHHH----CCEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             8998865------8899---9--9999985899678999549835751----1705512878989999999871897999
Q gi|254780206|r    3 VLLIGSG------GREH---A--LAWKIAQSPLLSELWSIPGNPGIAQ----HAQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         3 ILviGsG------grEh---A--l~~~l~~s~~~~~v~~~pgN~g~~~----~~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      ++|+|||      .-|.   |  -++.|++-..  +.+..+=||.|..    .++..+++...+|.+.++-..++...+|
T Consensus       921 ~mVlGsGvYrIGSSVEFDwcaV~~~rtLr~~g~--kTimvNyNPETVSTDyDecdrLYFeeis~E~vmDiYe~E~~~G~i  998 (1435)
T KOG0370         921 VMVLGSGVYRIGSSVEFDWCAVGCARTLRKLGK--KTIMVNYNPETVSTDYDECDRLYFEEISYERVMDIYELENSEGII  998 (1435)
T ss_pred             EEEECCCCEECCCCEEECHHHHHHHHHHHHCCC--CEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             599724325635620551335547999997098--469995686543575677766767542366534355430677269


Q ss_pred             E--CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             9--79557874899898605880670106665552010235788876531011112234401111121012420256304
Q gi|254780206|r   68 V--GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        68 v--gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                      +  |-..|-  .++=.|...|.+++|.+.+...-.-++...-..+.+.||-.|+|+..++.++|++|+++.||||+|+|+
T Consensus       999 is~GGQ~pn--NiA~~L~r~~~kilGTsP~~ID~AEnR~kFS~~Ld~i~v~Qp~Wkelt~~~eA~~F~~~VgYP~lvRPS 1076 (1435)
T KOG0370         999 ISVGGQLPN--NIALKLHRNGVKILGTSPEMIDSAENRFKFSRMLDSIGVDQPAWKELTSLEEAKKFAEKVGYPVLVRPS 1076 (1435)
T ss_pred             EEECCCCCC--HHHHHHHHCCCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCHHHHHHHHHHCCCCEEECCC
T ss_conf             983684862--021375862886754885761114567789998877278861023322688999999865996685110


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHC-CCCHHHHHHHHHHC-CCCCEEEEC-CCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             65343000232356778887887514-45317778877520-575234421-5776310352000111356654444434
Q gi|254780206|r  146 GLCAGKGVVVAATVDEATSAIDRCFQ-QINSTVIIEEYLEG-FEVSFFALC-DGKTAIPFTTARDHKRIHDGDIGPNTGG  222 (424)
Q Consensus       146 ~~agGkGV~i~~~~~e~~~~~~~~~~-~~~~~VliEefl~G-~E~Sv~~i~-dG~~~~~l~~~~dyKr~~~~d~GpnTGG  222 (424)
                      +..+|-.+-++++.+|++.+++.+-. +.+++|+|-+|++| .|+.++++- ||+-+. +.+. +|  +  .+-|...|-
T Consensus      1077 YVLSGaAMnv~~~~~dl~~~L~~A~~vs~dhPVVisKfie~AkEidvDAVa~~G~~~~-haiS-EH--v--EnAGVHSGD 1150 (1435)
T KOG0370        1077 YVLSGAAMNVVYSESDLKSYLEQASAVSPDHPVVISKFIEGAKEIDVDAVASDGKVLV-HAIS-EH--V--ENAGVHSGD 1150 (1435)
T ss_pred             CEECCHHHHHHHCHHHHHHHHHHHHHCCCCCCEEHHHHHCCCCEECHHHHCCCCEEEE-EEHH-HH--H--HCCCCCCCC
T ss_conf             1331015552104788999999776408779777277544450103123104781899-8623-34--1--124655786


Q ss_pred             CCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEEC--CCCCEEEEECCCCCCH
Q ss_conf             43000012344322201000008999998620462356644544898557048999886514--7751044332654411
Q gi|254780206|r  223 MGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFG--DPECQAMMMRLESDIL  300 (424)
Q Consensus       223 MGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~G--DPE~q~ilp~L~~dl~  300 (424)
                      ---+.|+-.+++...+++ ..|..++.++++.     .|....|+|..+|..+|||-|.|-.  -|   -+--.|.-||+
T Consensus      1151 Atlv~Ppq~l~~~t~~ri-k~i~~ki~~a~~i-----tGPfN~Q~i~k~n~lkVIECN~RaSRSFP---FvSKtlgvdfi 1221 (1435)
T KOG0370        1151 ATLVLPPQDLSADTLERI-KDIAAKVAKALKI-----TGPFNMQIIAKDNELKVIECNVRASRSFP---FVSKTLGVDFI 1221 (1435)
T ss_pred             EEEECCCHHCCHHHHHHH-HHHHHHHHHHHCC-----CCCCEEEEEECCCEEEEEEEEEEEECCCC---CEEHHCCCHHH
T ss_conf             037578112498899999-9999999888616-----68743799954980789996403433666---30010583199


Q ss_pred             HHHHHHHHCC
Q ss_conf             5666542013
Q gi|254780206|r  301 EILNSCVHGN  310 (424)
Q Consensus       301 ~il~~~~~g~  310 (424)
                      ++--+++-|.
T Consensus      1222 ~~At~~i~g~ 1231 (1435)
T KOG0370        1222 ALATRAIMGV 1231 (1435)
T ss_pred             HHHHHHHHCC
T ss_conf             9988997389


No 56 
>KOG0368 consensus
Probab=99.66  E-value=3.8e-14  Score=122.20  Aligned_cols=338  Identities=14%  Similarity=0.241  Sum_probs=215.1

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEC----CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC-
Q ss_conf             87898999999987189799997----9557874899898605880670106665552010235788876531011112-
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVG----PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ-  121 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivg----pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~-  121 (424)
                      +.-|.+.|++.|++..+|.|+.|    +|.|.   +.+.|.+.||-.+||+..+-+--+||+-.--+.+.+++||-+|. 
T Consensus       122 NyANVdlIvdiAe~~~VdAVWaGWGHASENP~---LPe~L~~~~IiFiGPP~~aM~sLGDKI~STIvAQsa~vPtlpWSG  198 (2196)
T KOG0368         122 NYANVDLIVDIAERTDVDAVWAGWGHASENPE---LPERLSANGIIFIGPPASAMRALGDKIASTIIAQSAGVPTLPWSG  198 (2196)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEECCCCCCCCCC---HHHHHHHCCCEEECCCHHHHHHHCCHHHHHHHHHHCCCCCCCCCC
T ss_conf             73018999988874355357615554456842---578897679289889467777632168778988754997214468


Q ss_pred             -------------------------CCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCC-CCH
Q ss_conf             -------------------------234401111121012420256304653430002323567788878875144-531
Q gi|254780206|r  122 -------------------------HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ-INS  175 (424)
Q Consensus       122 -------------------------~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~-~~~  175 (424)
                                               .+.|.+|+++.++.+|||+.||++-..||||++-|.+.||....+..+-.+ .++
T Consensus       199 S~v~~~~~~~~~~~v~Vpedly~Kacv~~~eegLeaae~IGfPvMIKASEGGGGKGIRkv~n~ddF~~lf~qv~~EvPGS  278 (2196)
T KOG0368         199 SGVKVEHIEDKTNLVSVPEDLYEKACVRNVEEGLEAAEKIGFPVMIKASEGGGGKGIRKVENEDDFKALFKQVQNEVPGS  278 (2196)
T ss_pred             CCCEEEEEECCCCEEECCHHHHHHHHCCCHHHHHHHHHHCCCCEEEEECCCCCCCCEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             86314455056762735789865343088889999998629836999545789766130456678999999998558999


Q ss_pred             HHHHHHHHHCC-CCCEEEECC--CCCCCCCC----CCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHH
Q ss_conf             77788775205-752344215--77631035----200011135665444443443000012344322201000008999
Q gi|254780206|r  176 TVIIEEYLEGF-EVSFFALCD--GKTAIPFT----TARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPT  248 (424)
Q Consensus       176 ~VliEefl~G~-E~Sv~~i~d--G~~~~~l~----~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~  248 (424)
                      ++.+=+...+- -+.++.++|  |+.+-.+.    +-|-|.++-|.            +|+...+++..++.     +..
T Consensus       279 PIFlMK~a~~ARHlEVQlLaDqYGn~IsLfgRDCSiQRRhQKIIEE------------APatIap~etf~~M-----e~~  341 (2196)
T KOG0368         279 PIFLMKLADQARHLEVQLLADQYGNVISLFGRDCSIQRRHQKIIEE------------APATIAPPETFKKM-----EQA  341 (2196)
T ss_pred             CEEHHHHCCCCCEEEEEHHHHHHCCEEEEECCCCHHHHHHHHHHHH------------CCCCCCCHHHHHHH-----HHH
T ss_conf             5552003367540210022453087877743662377877788761------------88541788999999-----999


Q ss_pred             HHHHHHCCCEEEEEEEEEEE--EECCEEEEEEEEEEE--CCCCCEEE----EECC------CCCC------HHHHHHHHH
Q ss_conf             99862046235664454489--855704899988651--47751044----3326------5441------156665420
Q gi|254780206|r  249 IEGMQKEQNPFQGVLFAGLM--ITEQGPYLIEYNVRF--GDPECQAM----MMRL------ESDI------LEILNSCVH  308 (424)
Q Consensus       249 ~~~l~~~~~~y~G~l~~~~m--~t~~gp~viE~N~R~--GDPE~q~i----lp~L------~~dl------~~il~~~~~  308 (424)
                      .-.|.+. ..|.+---++..  -+++.-|.||.|+||  --|-|+-|    ||-.      .-+|      -.+.-.-..
T Consensus       342 AvrLak~-VGYvSAGTVEYLYsp~d~~fyFLELNPRLQVEHP~TEmis~VNlPAaQlQIAMGiPL~~I~dIR~lYg~~~~  420 (2196)
T KOG0368         342 AVRLAKL-VGYVSAGTVEYLYSPDDGEYYFLELNPRLQVEHPTTEMISDVNLPAAQLQIAMGIPLHRIPDIRRLYGLEPT  420 (2196)
T ss_pred             HHHHHHH-HCCEECCEEEEEEECCCCCEEEEECCCCCCCCCCCHHHHHCCCCCHHHHHHHHCCCCCCCHHHHHHCCCCCC
T ss_conf             9999876-361113368999725898179996276302467752555157860899999859851005488997089999


Q ss_pred             CCCCCCCCCC-----CCCCEEEEEECCCCCCC---CCCCCCCCCCCC-CCCCCCEEEEEEEEEECCEE-EECCCCEEEEE
Q ss_conf             1333321234-----44420675422544668---775797624876-66898689983358778879-98188079999
Q gi|254780206|r  309 GNLHNTHINW-----KAEYALTVVVATKGYPE---EYPHGTIISKIP-QNTGTTQLFHAGTAIVNNNL-TANGGRVLSAT  378 (424)
Q Consensus       309 g~L~~~~~~~-----~~~~~v~Vvlas~GYP~---~~~kg~~I~~l~-~~~~~~~ifhagt~~~~g~l-~t~GGRVL~vv  378 (424)
                      |. +.++++.     -++.|+..=+.|+. |+   ++.+|.. ..++ ....+.|=|++ + ..+|.+ -=..+---.+-
T Consensus       421 Gd-S~idfe~~~~p~pkgHciA~RITsEd-PddgFkPSsG~v-~eLnFrSssnvWgYFS-V-~~~g~iHeFadSQFGHiF  495 (2196)
T KOG0368         421 GD-SPIDFENAKLPCPKGHCIAARITSED-PDDGFKPSSGTV-QELNFRSSSNVWGYFS-V-GNGGGIHEFADSQFGHIF  495 (2196)
T ss_pred             CC-CCCCHHHCCCCCCCCEEEEEEEECCC-CCCCCCCCCCEE-EEECCCCCCCCEEEEE-E-CCCCCCEECCCCCCCEEE
T ss_conf             99-98771111378998418999863158-887758898706-8841477777148999-4-379850242433340146


Q ss_pred             EECCCHHHHHHHHHHHHHCCCCCCCEECCHHHH
Q ss_conf             962898999999999985258999575351789
Q gi|254780206|r  379 ALGKTITESRELAYHMVENIDWKHGYWREDIGL  411 (424)
Q Consensus       379 ~~g~~l~eA~~~ay~~i~~I~~~g~~yR~DIG~  411 (424)
                      +.|++.++|+.+.--+++.+...|. ||+-+-+
T Consensus       496 a~Ge~R~eAi~nMv~aLKelsIRgd-FrT~VeY  527 (2196)
T KOG0368         496 AFGESRQEAIANMVVALKELSIRGD-FRTTVEY  527 (2196)
T ss_pred             EECCCHHHHHHHHHHHHHHCEECCC-CCCHHHH
T ss_conf             6257689999999998876151466-7762899


No 57 
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810    Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria. The polymer has a backbone of L-aspartic acid, with most Asp side chain carboxyl groups attached to L-arginine. The polymer is made by this enzyme, cyanophycin synthetase, and degraded by cyanophycinase. Heterologously expressed cyanophycin synthetase in Escherichia coli produces a closely related, water-soluble polymer with some Arg replaced by Lys. It is unclear whether enzymes that produce soluble cyanophycin-like polymers in vivo in non-Cyanobacterial species should be designated as cyanophycin synthetase itself or as a related enzyme. Cyanophycin synthesis is analogous to polyhydroxyalkanoic acid (PHA) biosynthesis, except that PHA polymers lack nitrogen and may be made under nitrogen-limiting conditions .; GO: 0005524 ATP binding, 0016874 ligase activity, 0009059 macromolecule biosynthetic process.
Probab=99.61  E-value=5e-16  Score=135.79  Aligned_cols=123  Identities=24%  Similarity=0.371  Sum_probs=104.3

Q ss_pred             ECCCHHHHHHHHHHHHHCCCCEE-------------------------ECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             97955787489989860588067-------------------------01066655520102357888765310111122
Q gi|254780206|r   68 VGPELPLVNGISDALNAAGFKVF-------------------------GPSQRAAKLESSKSFAKKFCTKYGIPTATYQH  122 (424)
Q Consensus        68 vgpE~pL~~gi~d~l~~~gi~v~-------------------------Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~  122 (424)
                      -||..   ..|+++-.+++||+.                         -.|.-+..|..||..+|++|+.+|+|.|+...
T Consensus       162 LGPST---~~Iv~eA~~R~IP~~rL~~g~~vqlGYG~~qkri~at~td~Ts~iav~iA~DK~lTK~iL~~~GvPVP~G~~  238 (876)
T TIGR02068       162 LGPST---AAIVKEAEKRGIPYMRLSAGSLVQLGYGSKQKRIQATETDRTSAIAVEIACDKDLTKKILKAAGVPVPEGTV  238 (876)
T ss_pred             CCCCH---HHHHHHHHHCCCCEEEECCCCEEECCCCCCCEEEEEECCCCCCEEEHHHHCCHHHHHHHHHHCCCCCCCCCH
T ss_conf             79877---899999973789868733764456057754303432002576501012223637899999847898888736


Q ss_pred             CCCCHHHHHHHHCCC-CEEEEEECCCCCCCCCCC-HHHHHHHHHHHHHHHCCC-CHHHHHHHHHHCCCCCEEEE
Q ss_conf             344011111210124-202563046534300023-235677888788751445-31777887752057523442
Q gi|254780206|r  123 FSDPMKAKQYVQNKS-MPIVVKADGLCAGKGVVV-AATVDEATSAIDRCFQQI-NSTVIIEEYLEGFEVSFFAL  193 (424)
Q Consensus       123 ~~~~~ea~~~~~~~g-~PvVVKp~~~agGkGV~i-~~~~~e~~~~~~~~~~~~-~~~VliEefl~G~E~Sv~~i  193 (424)
                      +.+.++|.++++.+| ||+||||-+...||||.+ ..+++|+..|++.+.+.+ .+.|+||.|+.|.++-+.++
T Consensus       239 ~~~~~~a~~aa~~~GG~PvViKP~DGn~GrGv~~ni~~r~e~e~AY~~A~~~Sk~~~ViVEr~i~G~dhRlLVV  312 (876)
T TIGR02068       239 VQSAEEAWEAAEDLGGYPVVIKPYDGNHGRGVTINIETRDEIESAYEAAKEESKTSEVIVERYIKGRDHRLLVV  312 (876)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCEEEEEE
T ss_conf             67789999999971899689951779987437840777488999999998607866068987642762389999


No 58 
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. Members of this protein family belong to the GNAT family of acetyltransferases. Each is part of a conserved three-gene cassette sparsely distributed across at least twenty different species known so far, including alpha, beta, and gamma Proteobacteria, Mycobacterium, and Prosthecochloris, which is a member of the Chlorobi. The other two members of the cassette are a probable protease and an asparagine synthetase family protein.
Probab=99.58  E-value=6.6e-15  Score=127.71  Aligned_cols=196  Identities=22%  Similarity=0.351  Sum_probs=132.6

Q ss_pred             HHHHHHHHHHHHCCCCEE-------------------E-------CCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             787489989860588067-------------------0-------10666555201023578887653101111223440
Q gi|254780206|r   73 PLVNGISDALNAAGFKVF-------------------G-------PSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDP  126 (424)
Q Consensus        73 pL~~gi~d~l~~~gi~v~-------------------G-------p~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~  126 (424)
                      |.+.=|+|+-...||.|=                   +       .|+-|--++.||..+|.+++++|+|.|....+.+.
T Consensus       242 pya~ii~~ea~rrgi~vev~d~~~g~f~l~~ggr~i~creslSelTSAvAms~c~DK~lT~rll~~AG~~VP~~~~~~~~  321 (547)
T TIGR03103       242 PYARIIVDEARRRGIEVEVLDAEGGLFRLSLGGRSIRCRESLSELTSAVAMSLCDDKRLTRRLVSEAGLQVPEQQLAGNG  321 (547)
T ss_pred             CHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCEEEEEECHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCH
T ss_conf             14688776898668648986388885897128906886120257888999887404999999999739989997456998


Q ss_pred             HHHHHHHHCCCCEEEEEECCCCCCCCCCC-HHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCC------
Q ss_conf             11111210124202563046534300023-23567788878875144531777887752057523442157763------
Q gi|254780206|r  127 MKAKQYVQNKSMPIVVKADGLCAGKGVVV-AATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTA------  199 (424)
Q Consensus       127 ~ea~~~~~~~g~PvVVKp~~~agGkGV~i-~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~------  199 (424)
                      +++.+|++++| |+||||...-.||||.+ +.+.+++..|+..+.. .+..||||+|+.|.++-+.++ ||+-+      
T Consensus       322 ~~~~~fl~~~G-~VVVKP~dGnqGrGVtvnl~t~eev~~A~~~A~~-~~~~VIVE~fi~G~D~RlLVI-ggkVVAAA~R~  398 (547)
T TIGR03103       322 EAVEAFLAEHG-AVVVKPVRGEQGKGISVDVRTPDDLEAAIAKARQ-FCDRVLLERYVPGEDLRLVVI-DFEVVAAAVRR  398 (547)
T ss_pred             HHHHHHHHHCC-CEEECCCCCCCCCCEEECCCCHHHHHHHHHHHHH-HCCCEEEEEEECCCCEEEEEE-CCEEEEEECCC
T ss_conf             99999998739-9997768788886158725999999999999997-599579998406971699999-99999998147


Q ss_pred             -----------C-CCCCCCCCCCC--CCC-------C---------C--------------------CCCCCCCCEEECC
Q ss_conf             -----------1-03520001113--566-------5---------4--------------------4444344300001
Q gi|254780206|r  200 -----------I-PFTTARDHKRI--HDG-------D---------I--------------------GPNTGGMGACSPA  229 (424)
Q Consensus       200 -----------~-~l~~~~dyKr~--~~~-------d---------~--------------------GpnTGGMGa~~p~  229 (424)
                                 + -|.-.| -+|-  ..+       |         .                    ...|||-     .
T Consensus       399 Pa~VvGDG~sTI~eLIe~q-nrrr~~~~g~esrI~lD~~t~~~L~~qG~tldSVp~~Ge~V~LR~nANLSTGGt-----a  472 (547)
T TIGR03103       399 PPEVIGDGRSSIRDLIEKQ-SRRRAAATGGESRIPLDAETERCLAEAGLDLDDVLPEGQRLRVRRTANLHTGGT-----I  472 (547)
T ss_pred             CCEEEECCHHHHHHHHHHH-CCCCCCCCCCCCEECCCHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCC-----E
T ss_conf             9679848662099998430-577556789975334699999999984998122588899999942660268985-----1


Q ss_pred             CCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC-CEE--EEEEEEEEEC
Q ss_conf             234432220100000899999862046235664454489855-704--8999886514
Q gi|254780206|r  230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE-QGP--YLIEYNVRFG  284 (424)
Q Consensus       230 ~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~-~gp--~viE~N~R~G  284 (424)
                          -+..+++.-+..+-.+++-+..|++..|   ++||+.+ ..|  -+||.|.|.|
T Consensus       473 ----iDVTD~VHPe~~~~A~~AAraIGLdIaG---IDliv~DIs~P~~vIIEvNa~PG  523 (547)
T TIGR03103       473 ----HDVTEQLHPDLREAAERAARALDIPVVG---IDFLVPDVTGPDYVIIEANERPG  523 (547)
T ss_pred             ----EECCCCCCHHHHHHHHHHHHHHCCCEEE---EEEEECCCCCCCEEEEEECCCCC
T ss_conf             ----6145676989999999999973998556---89984268999818999778965


No 59 
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis]
Probab=99.55  E-value=8.9e-14  Score=119.55  Aligned_cols=229  Identities=18%  Similarity=0.323  Sum_probs=148.3

Q ss_pred             HHHCCCEEEECCCHHH--HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHC-
Q ss_conf             8718979999795578--7489989860588067010666555201023578887653101111223440111112101-
Q gi|254780206|r   59 QEKHIDLVVVGPELPL--VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQN-  135 (424)
Q Consensus        59 ~~~~iDlvivgpE~pL--~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~-  135 (424)
                      .....|.+++=...+.  ..-+...++..|.+|+ .+..+.+..++|.++-.++.++++|+|+.....+.+++..++++ 
T Consensus        75 ~~~~~D~i~~R~~~~~~~~~~~~~~~E~~G~~vi-N~p~~i~~~~nK~~~~~~l~~~~ipvP~T~i~~~~~~~~~~~~~~  153 (318)
T COG0189          75 LLDELDVIIMRKDPPFDFATRFLRLAERKGVPVI-NDPQSIRRCRNKLYTTQLLAKAGIPVPPTLITRDPDEAAEFVAEH  153 (318)
T ss_pred             HCCCCCEEEECCCCHHHHHHHHHHHHHHCCCEEE-CCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCHHHHHHHHHHH
T ss_conf             2036728997378604568999999987498687-887998763557999999996599999868965847889999974


Q ss_pred             CCCEEEEEECCCCCCCCCCCHHHHH-HHHHHHHHHHCCCCHHHHHHHHHHCC--CCCEEEECCCCCCCCC-CCCCCCCC-
Q ss_conf             2420256304653430002323567-78887887514453177788775205--7523442157763103-52000111-
Q gi|254780206|r  136 KSMPIVVKADGLCAGKGVVVAATVD-EATSAIDRCFQQINSTVIIEEYLEGF--EVSFFALCDGKTAIPF-TTARDHKR-  210 (424)
Q Consensus       136 ~g~PvVVKp~~~agGkGV~i~~~~~-e~~~~~~~~~~~~~~~VliEefl~G~--E~Sv~~i~dG~~~~~l-~~~~dyKr-  210 (424)
                      +|||+|+||-..++|+||+.+.+.+ ++.+.++...+.....++++|||.=.  ..-...+.| ..+... ..    .| 
T Consensus       154 ~g~pvVlKp~~Gs~G~gV~~v~~~d~~l~~~~e~~~~~~~~~~ivQeyi~~~~~~~rrivv~~-~~~~~~y~~----~R~  228 (318)
T COG0189         154 LGFPVVLKPLDGSGGRGVFLVEDADPELLSLLETLTQEGRKLIIVQEYIPKAKRDDRRVLVGG-GEVVAIYAL----ARI  228 (318)
T ss_pred             CCCCEEEEECCCCCCCCEEEECCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCEEEEEEEC-CEEEEEEEE----ECC
T ss_conf             689889964788886655994377656999999863455642986203476778739999989-999898712----004


Q ss_pred             CCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEE
Q ss_conf             35665444443443000012344322201000008999998620462356644544898557048999886514775104
Q gi|254780206|r  211 IHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQA  290 (424)
Q Consensus       211 ~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~  290 (424)
                      ...+|-=.|++.=|...|.. +++    ++ +++..++..+|   |..|.|   +|++-+++|.+|+|+|..   |++..
T Consensus       229 ~~~~~~R~N~a~Gg~~e~~~-l~~----e~-~elA~kaa~~l---Gl~~~G---VDiie~~~g~~V~EVN~s---P~~~~  293 (318)
T COG0189         229 PASGDFRSNLARGGRAEPCE-LTE----EE-EELAVKAAPAL---GLGLVG---VDIIEDKDGLYVTEVNVS---PTGKG  293 (318)
T ss_pred             CCCCCCEEECCCCCEECCCC-CCH----HH-HHHHHHHHHHH---CCCEEE---EEEEEECCCEEEEEEECC---CCCCC
T ss_conf             77775201011575204536-999----99-99999999974---894799---999970896299998689---65235


Q ss_pred             EEECCC-CCCHHHHHHHHH
Q ss_conf             433265-441156665420
Q gi|254780206|r  291 MMMRLE-SDILEILNSCVH  308 (424)
Q Consensus       291 ilp~L~-~dl~~il~~~~~  308 (424)
                      -+.+.. .+...++...+.
T Consensus       294 ~i~~~~g~~~~~~~~~~ie  312 (318)
T COG0189         294 EIERVTGVNIAGLIIDAIE  312 (318)
T ss_pred             CHHHCCCCCHHHHHHHHHH
T ss_conf             2143069767999999999


No 60 
>KOG0370 consensus
Probab=99.55  E-value=8e-15  Score=127.11  Aligned_cols=366  Identities=17%  Similarity=0.198  Sum_probs=217.9

Q ss_pred             EEEEECCCHHH------------HHHHHHHHHCCCCCEEEEECCCHHHHH----CCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             58998865889------------999999985899678999549835751----17055128789899999998718979
Q gi|254780206|r    2 RVLLIGSGGRE------------HALAWKIAQSPLLSELWSIPGNPGIAQ----HAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsGgrE------------hAl~~~l~~s~~~~~v~~~pgN~g~~~----~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||||+||||--            +| .++|+++ .+..+.+-| |-.|.+    +++.+.+-+...+.+-...+.+.+|.
T Consensus       379 kVlvlGSGGLsIGQAGEFDYSGsQA-iKAlkEe-~i~TiLiNP-NIAtvQts~~lAD~vyflpvT~~~vt~vi~~erPd~  455 (1435)
T KOG0370         379 KVLVLGSGGLSIGQAGEFDYSGSQA-IKALKEE-NIFTILINP-NIATVQTSKGLADKVYFLPVTPEYVTKVIKAERPDG  455 (1435)
T ss_pred             EEEEECCCCCCCCCCCEEEEEHHHH-HHHHHHC-CCEEEEECC-CCCCCCCCCCCCEEEEEEECCHHHHHHHHHHHCCCE
T ss_conf             7999815873321240355407889-8765532-617999789-601000255521289995058799999988618773


Q ss_pred             EEECCC--HHHHHHH----HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             999795--5787489----9898605880670106665552010235788876531011112234401111121012420
Q gi|254780206|r   66 VVVGPE--LPLVNGI----SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus        66 vivgpE--~pL~~gi----~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P  139 (424)
                      +.+..+  ..|..|+    ...|...|+++.|.+........|+.+.-.-|.+-+.+.+++...++.++|++++++++||
T Consensus       456 il~tfggqtaLncgvel~k~gvf~~~~vkvLgt~i~ti~ttedr~lfa~am~ei~e~ia~s~a~~sie~al~aae~l~yp  535 (1435)
T KOG0370         456 ILLTFGGQTALNCGVELDKAGVFAQYGVKVLGTPIQTIITTEDRDLFARALNEINEKIAPSEAVSTIEEALEAAERLGYP  535 (1435)
T ss_pred             EEEECCCCCCCCCCEEEEECCCCCCCCHHHHCCCCCCCEEECCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCH
T ss_conf             78842776544564353002100003415437875521231427889999876315056256676799999888862828


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC-CCCEEEECCCCCCCCCCC-CCCCCCCCCCCCC
Q ss_conf             25630465343000232356778887887514453177788775205-752344215776310352-0001113566544
Q gi|254780206|r  140 IVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGF-EVSFFALCDGKTAIPFTT-ARDHKRIHDGDIG  217 (424)
Q Consensus       140 vVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~-E~Sv~~i~dG~~~~~l~~-~~dyKr~~~~d~G  217 (424)
                      ++|++....||-|-..+.|++|+.+....+|.. ..+|++|+-+.|. |+..++.-|--...+-.. ...+     ...|
T Consensus       536 vivRaayalgglgSgfa~n~eeL~~l~~~a~a~-s~QilvekSlkGwkevEyevvrDa~~nciTvcnmen~-----Dplg  609 (1435)
T KOG0370         536 VIVRAAYALGGLGSGFANNEEELQDLAAQALAL-SPQILVEKSLKGWKEVEYEVVRDAYDNCITVCNMENF-----DPLG  609 (1435)
T ss_pred             HHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCC-CCEEEEHHHHCCCCCEEEEEEECCCCCHHHHCCCCCC-----CCCE
T ss_conf             999999985376643344489999997643125-8615422332443434899980200040533577345-----7620


Q ss_pred             CCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCE--EEEEEEEEEECCCCCEEEEECC
Q ss_conf             44434430000123443222010000089999986204623566445448985570--4899988651477510443326
Q gi|254780206|r  218 PNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMMMRL  295 (424)
Q Consensus       218 pnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~g--p~viE~N~R~GDPE~q~ilp~L  295 (424)
                      -.||--=.++|+-.++++..+-+...-    ++-++..|+  .|=..+|.-+....  -+|||+|+||.---   .|..=
T Consensus       610 ihtGdSiVvapsqtlsd~ey~mlrtta----ikVirhlgv--vGEcniQyaL~p~s~~y~IiEVNarLSrss---aLASk  680 (1435)
T KOG0370         610 IHTGDSIVVAPSQTLSDEEYQMLRTTA----IKVIRHLGV--VGECNIQYALNPYSLEYRIIEVNARLSRSS---ALASK  680 (1435)
T ss_pred             EECCCEEEEEECCCCCHHHHHHHHHCC----HHHEECCCC--CCCCCCEEEECCCCEEEEEEEEEEEEEEHH---HHHCC
T ss_conf             101650799614225768899987502----021102687--665653044166630479999875774013---44326


Q ss_pred             CCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEE-ECCEEEECCCCE
Q ss_conf             5441156665420133332123444420675422544668775797624876668986899833587-788799818807
Q gi|254780206|r  296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAI-VNNNLTANGGRV  374 (424)
Q Consensus       296 ~~dl~~il~~~~~g~L~~~~~~~~~~~~v~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~-~~g~l~t~GGRV  374 (424)
                      . -=+++-.-+++=.|..+-.+.++....+-..+=     .+..+.-...++.=  |..-|+- +.. .+....    -|
T Consensus       681 a-TgypLAy~aAKlalg~~lpe~~n~Vt~~T~AcF-----EpslDY~v~KiprW--Dl~kf~~-vs~~igssmK----Sv  747 (1435)
T KOG0370         681 A-TGYPLAYTAAKLALGIPLPELKNSVTKTTTACF-----EPSLDYCVVKIPRW--DLSKFQR-VSTEIGSSMK----SV  747 (1435)
T ss_pred             C-CCCCHHHHHHHHHCCCCCCCCCCCCCCCEECCC-----CCCHHHEEEECCCC--CHHHHHH-HHHHHCHHHH----HH
T ss_conf             7-667589999987048603467761125200145-----75320134405653--3787878-8876252565----24


Q ss_pred             EEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             999996289899999999998525
Q gi|254780206|r  375 LSATALGKTITESRELAYHMVENI  398 (424)
Q Consensus       375 L~vv~~g~~l~eA~~~ay~~i~~I  398 (424)
                      -.|-+.|.+++||.++|.+.++.=
T Consensus       748 gEvm~iGR~feea~QKalr~vd~~  771 (1435)
T KOG0370         748 GEVMAIGRTFEEAFQKALRMVDPS  771 (1435)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             666622130799998877514923


No 61 
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2; InterPro: IPR005862    The formation of isosinate, a precursor of adenylate and guanylate, from 5-phosphoribosyl 1-pyrophosphate in the de novo purine biosynthesis pathway is basically composed of 10 steps of reactions . Phosphoribosylglycinamide formyltransferase 2 (2.1.2 from EC) is an alternative enzyme to phosphoribosylglycinamide formyltransferase that catalyzes the third step in the de novo purine biosynthesis pathway. ; GO: 0016742 hydroxymethyl- formyl- and related transferase activity, 0009113 purine base biosynthetic process.
Probab=99.54  E-value=4.1e-13  Score=114.75  Aligned_cols=370  Identities=21%  Similarity=0.310  Sum_probs=232.1

Q ss_pred             EEEEECCC--HHHHHHHHHHHHCCCCCEEEEEC---CCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             58998865--88999999998589967899954---98357511705512878989999999871897999979557874
Q gi|254780206|r    2 RVLLIGSG--GREHALAWKIAQSPLLSELWSIP---GNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         2 kILviGsG--grEhAl~~~l~~s~~~~~v~~~p---gN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      ++|++|+|  |+|-++.  +++-.  .++....   +-|.+......+.++..|.+.+...++..++|++++-.+..-..
T Consensus         1 ~~~l~g~g~~g~~~~~~--~~~lg--~~~~~~d~~~~~p~~~~~~~~~~~~~~d~~~~~~~~~~~~p~~~~p~~~~~~~~   76 (407)
T TIGR01142         1 RVLLLGSGELGKEVAIE--AQRLG--VEVIAVDRYADAPALQVAHRSYVIDLLDGDALRAVIEREKPDYIVPEIEAIATD   76 (407)
T ss_pred             CEEEECCCCCCHHHHHH--HHHCC--CEEEEECCCCCCCHHHHHHHHHHEECCCHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             94661376533144444--54347--126873354576213332111100002678999998750674100024455466


Q ss_pred             HHHHHHHHCC---CCEEECCHHHHHHHHCCHHHHHH-HHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCC
Q ss_conf             8998986058---80670106665552010235788-8765310111122344011111210124202563046534300
Q gi|254780206|r   77 GISDALNAAG---FKVFGPSQRAAKLESSKSFAKKF-CTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKG  152 (424)
Q Consensus        77 gi~d~l~~~g---i~v~Gp~~~aa~le~sK~~~K~~-l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkG  152 (424)
                       ....+++.|   ..++ |+.+++++..++...|++ .++.++||..|...++.++..+....+|||+++||...++|+|
T Consensus        77 -~l~~~~~~gg~c~~~~-p~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~g~p~~~~p~~~~~g~g  154 (407)
T TIGR01142        77 -ALLELEAEGGECYTVV-PTARATKLTLNREGLRRLAAEELGLPTAPYEFADSLEELREAVEKIGFPCVVKPVLSSSGKG  154 (407)
T ss_pred             -HHHHHHHCCCCEEEEE-CCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCEEHHHHCCCCCC
T ss_conf             -6776652488246640-35202221210567787767763254220011101788999998607750001221146665


Q ss_pred             CCCHHHHHHHHHHHHHHH-----CC---CCHHHHHHHHHHC-CCCCEEEEC--CC--C-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             023235677888788751-----44---5317778877520-575234421--57--7-631035200011135665444
Q gi|254780206|r  153 VVVAATVDEATSAIDRCF-----QQ---INSTVIIEEYLEG-FEVSFFALC--DG--K-TAIPFTTARDHKRIHDGDIGP  218 (424)
Q Consensus       153 V~i~~~~~e~~~~~~~~~-----~~---~~~~VliEefl~G-~E~Sv~~i~--dG--~-~~~~l~~~~dyKr~~~~d~Gp  218 (424)
                      -.++.+.++...+++.+.     ..   ...++++|+|++- .|++...+.  +|  . ...+-|.-  | +-.++|.  
T Consensus       155 ~~~~~~~~~~~~~w~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~p~g--~-~~~~g~~--  229 (407)
T TIGR01142       155 QSVVRGPEDLEKAWEYAKGHQVQEGGRGGAGRVIVEEFIDFDYEITLLTVRAVDGNGPLTTFCAPIG--H-RQEDGDY--  229 (407)
T ss_pred             CEEECCHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCHHHHHHHEEEECCCCCCEEEECCCCC--C-CCCCCCC--
T ss_conf             3000473456788766504310113455556245520013102110000000277775011013224--3-0015540--


Q ss_pred             CCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEEC--CC
Q ss_conf             4434430000123443222010000089999986204623566445448985570489998865147751044332--65
Q gi|254780206|r  219 NTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR--LE  296 (424)
Q Consensus       219 nTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~--L~  296 (424)
                          .-++.|.. ++....++. +.+.+....++.     -.|++.+++++..+..+.-|+..|.-|.-...++..  --
T Consensus       230 ----~~~w~p~~-~~~~~~~~~-~~~~~~~~~~lg-----g~g~~g~~~~~~g~~~~~~~~~p~p~~~g~~~~~~~pp~~  298 (407)
T TIGR01142       230 ----HESWQPQE-LSEKALEEA-KRIAKRVTDALG-----GYGLFGVELFVKGDEVWFSEVSPRPHDTGLVTLISQPPDL  298 (407)
T ss_pred             ----HHCCCCHH-HHHHHHHHH-HHHHHHHHHHHC-----CCCEEEEEEEECCCEEEEECCCCCCCCCCEEEEEECCCCC
T ss_conf             ----00146212-217889999-999988887634-----6640014456516613542046676665137874068872


Q ss_pred             CCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECC----------CCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCE
Q ss_conf             4411566654201333321234444206754225----------446687757976248766689868998335877887
Q gi|254780206|r  297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVAT----------KGYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNN  366 (424)
Q Consensus       297 ~dl~~il~~~~~g~L~~~~~~~~~~~~v~Vvlas----------~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~  366 (424)
                      +.| .+-...+-|-  .+.-+|-+++.....+.+          .++-..+....+...+...   ..+-+. ....-|+
T Consensus       299 ~~~-~~~~~~~~g~--p~~g~w~~g~~~~~~~~p~~~~~~~~~~~~~~~~~~~~pp~~~~~~~---~~~~~~-~~~~~g~  371 (407)
T TIGR01142       299 SEF-ALHLRAILGL--PVPGEWVDGYRLIKQLGPGASAVILADGEGGKLAFGGAPPADALEDA---LGVPDT-DVRLFGK  371 (407)
T ss_pred             HHH-HHHHHHHHCC--CCCCCCCCCHHHHHHCCCCHHHHHHCHHCCCCCCCCCCCCHHHHHHH---HCCCCC-CEEEECC
T ss_conf             046-6544554236--66751001112222115410012200000011223567733455654---315543-0566216


Q ss_pred             EEECCCCEEEE-EEECCCHHHHHHHHHHHHHCCCC
Q ss_conf             99818807999-99628989999999999852589
Q gi|254780206|r  367 LTANGGRVLSA-TALGKTITESRELAYHMVENIDW  400 (424)
Q Consensus       367 l~t~GGRVL~v-v~~g~~l~eA~~~ay~~i~~I~~  400 (424)
                      -.+.++|-+.+ .+.+++.+.+++++......+..
T Consensus       372 p~~~~~~~~g~~l~~~~~~~~~~~~~~~~~~~~~~  406 (407)
T TIGR01142       372 PEAKGGRRLGVALATAESVEAARERAEEVAHAVKV  406 (407)
T ss_pred             CCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCC
T ss_conf             43333321012220220368889888887765227


No 62 
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only]
Probab=99.54  E-value=1.1e-12  Score=111.71  Aligned_cols=275  Identities=20%  Similarity=0.294  Sum_probs=166.0

Q ss_pred             CEEEEE----CCC---------HHH--HHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             958998----865---------889--99999998589967899954983575117055128789899999998718979
Q gi|254780206|r    1 MRVLLI----GSG---------GRE--HALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         1 MkILvi----GsG---------grE--hAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      ||||+-    ++|         ||.  -+|...+.++. + ++|..-+-..+ .++-..-.-..|.....+-.- ++.|.
T Consensus         1 mkilifEyA~atg~ee~~i~~EG~aMlesll~~F~~~~-v-e~y~~~~f~~~-~ig~~f~s~~~~~~~~~ek~l-e~~Da   76 (307)
T COG1821           1 MKILIFEYAVATGIEEFNILAEGRAMLESLLRAFAKSG-V-EVYETLTFADP-SIGVRFKSTADDVLRDEEKAL-EKADA   76 (307)
T ss_pred             CEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCC-C-EEEEEECCCCC-CCCEEEECCHHHHHHHHHHHH-HCCCE
T ss_conf             91799985302575530135768999999999998559-4-59986033266-665113204367889999987-52884


Q ss_pred             E-EECCCHH-HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             9-9979557-8748998986058806701066655520102357888765310111122344011111210124202563
Q gi|254780206|r   66 V-VVGPELP-LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus        66 v-ivgpE~p-L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVK  143 (424)
                      . +|.||+- |---+...+++. ...+|+|.+|++..+||..+-+.++.+ +++|+-...          ...+--+|||
T Consensus        77 ~LvIAPEdd~lLy~Ltri~E~~-~~nLG~S~~Ai~v~aDK~lty~aLr~a-V~~p~t~e~----------~~~~~k~ViK  144 (307)
T COG1821          77 TLVIAPEDDGLLYSLTRIYEEY-VENLGCSPRAIRVAADKRLTYKALRDA-VKQPPTREW----------AEEPKKYVIK  144 (307)
T ss_pred             EEEEECCCCCHHHHHHHHHHHH-HHHHCCCHHHHHHHHHHHHHHHHHHHH-CCCCCCCCC----------CCCCCEEEEC
T ss_conf             6998047677189999999987-675089777876751089899988411-248885535----------5678568862


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             04653430002323567788878875144531777887752057523442157763103520001113566544444344
Q gi|254780206|r  144 ADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGM  223 (424)
Q Consensus       144 p~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGM  223 (424)
                      |...+||.|+....+..+.              .|++|||+|.-+||+ +.+|+++.||...+-+ -++.++.   -++-
T Consensus       145 p~dgCgge~i~~~~~~pd~--------------~i~qEfIeG~~lSVS-L~~GEkv~pLsvNrQf-i~~~~~~---~~y~  205 (307)
T COG1821         145 PADGCGGEGILFGRDFPDI--------------EIAQEFIEGEHLSVS-LSVGEKVLPLSVNRQF-IIFAGSE---LVYN  205 (307)
T ss_pred             CCCCCCCCEEECCCCCCCH--------------HHHHHHCCCCCEEEE-EECCCCCCCCEECHHH-HHHCCCE---EEEC
T ss_conf             2556775102046777521--------------667874377614899-8558734430232232-1001423---4433


Q ss_pred             CEEECCCCCCCCCCEEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEEC-CCCCCHH
Q ss_conf             30000123443222010000089999986204-623566445448985570489998865147751044332-6544115
Q gi|254780206|r  224 GACSPALGMSQELYSTVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR-LESDILE  301 (424)
Q Consensus       224 Ga~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~-L~~dl~~  301 (424)
                      |.-+|.+   .+    ..+++++-.+++...- |+  +|...+++++. ++|||||+|+|+--|  .+-+.| ....+.+
T Consensus       206 gg~~pi~---he----~k~~~~~~Ai~aVeci~Gl--~GYVGVDlVls-D~pYvIEINpR~TTp--~vg~sr~~~~sv~~  273 (307)
T COG1821         206 GGRTPID---HE----LKREAFEEAIRAVECIPGL--NGYVGVDLVLS-DEPYVIEINPRPTTP--TVGLSRVTPESVAE  273 (307)
T ss_pred             CCCCCCC---CH----HHHHHHHHHHHHHHHHCCC--CCEEEEEEEEC-CCCEEEEECCCCCCC--EEEEECCCCHHHHH
T ss_conf             6767888---17----8899999999999740255--54266789964-985799946877764--34320146177999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCE
Q ss_conf             6665420133332123444420
Q gi|254780206|r  302 ILNSCVHGNLHNTHINWKAEYA  323 (424)
Q Consensus       302 il~~~~~g~L~~~~~~~~~~~~  323 (424)
                      +++.-..|++.+- ..++.+++
T Consensus       274 LLl~~~~g~~~~~-v~vkg~~~  294 (307)
T COG1821         274 LLLEGPTGKVLRY-VKVKGEAS  294 (307)
T ss_pred             HHHCCCCCCCCCE-EEECCCEE
T ss_conf             9852855665514-89826244


No 63 
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family; InterPro: IPR004666   Escherichia coli RimK adds additional Glu residues to the native Glu-Glu C-terminus of ribosomal protein S6. Mutation of the Glu-Glu terminus to Lys-Glu blocked addition. S6 has the C-terminal sequence Glu-Glu in few species, suggesting the homolog of rimK may have a function other than S6 modification in those species. However, most species having a member of this protein subfamily do not have an S6 homolog ending in Glu-Glu.; GO: 0006464 protein modification process.
Probab=99.52  E-value=1.4e-13  Score=118.06  Aligned_cols=268  Identities=17%  Similarity=0.220  Sum_probs=169.5

Q ss_pred             HHHHHHHHHHCCCCCEEEEECCCHHHHHCCE--EEECCCCCHHHHHHHHHHHCCCEEEECCCHH-----HHHHHHHHHHH
Q ss_conf             9999999985899678999549835751170--5512878989999999871897999979557-----87489989860
Q gi|254780206|r   12 EHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFCQEKHIDLVVVGPELP-----LVNGISDALNA   84 (424)
Q Consensus        12 EhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~--~~~i~~~d~~~i~~~a~~~~iDlvivgpE~p-----L~~gi~d~l~~   84 (424)
                      |..|-.++.+-..-.+++..+ +--+ .+.+  ...|-......-.+.+ ....|.+++=.-.|     -...++-.|+.
T Consensus        20 ~~~L~~~~~~~~~~~~~~~~~-~~~~-~~~~P~~~~I~~~~~~~~~~~~-~~~~d~~~~R~~TPWv~~~~~~~~~r~lE~   96 (321)
T TIGR00768        20 EKMLKEAAEERGIDYKVVTPP-EIVL-TFNQPAAFSIFYKEPRKNKELA-LAELDVVIVRIGTPWVSSFRGLAVLRALES   96 (321)
T ss_pred             HHHHHHHHHHHCCCEEEECCH-HHEE-CCCCCCCCEEECCCCCCCCHHH-HCCCCEEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             999999999717953676041-2200-3688851001114541001023-117888998389975110268899999985


Q ss_pred             CCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCC--------CCHHHHHHHHCCC---CEEEEEECCCCCCCCC
Q ss_conf             5880670106665552010235788876531011112234--------4011111210124---2025630465343000
Q gi|254780206|r   85 AGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFS--------DPMKAKQYVQNKS---MPIVVKADGLCAGKGV  153 (424)
Q Consensus        85 ~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~--------~~~ea~~~~~~~g---~PvVVKp~~~agGkGV  153 (424)
                      .|++++ -+..+..-++||.++-.+|.++|||+|+..+..        |.++|..+++++|   ||+|+||.-.+.|++|
T Consensus        97 ~G~~~~-N~s~aI~~a~dK~~s~~~L~~~G~P~P~~~~~~PqnfDReW~~~~a~~~ie~~g~lEfP~V~Kp~~GS~G~~V  175 (321)
T TIGR00768        97 LGVPVI-NSSQAILNAGDKVLSHQLLAKAGVPLPRTGVAGPQNFDREWSPEEALKLIEEIGQLEFPVVLKPVFGSWGRLV  175 (321)
T ss_pred             CCCEEC-CCHHHHHHCCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCCCCEE
T ss_conf             896310-7069986214658999999958689873357366322435898899999987317642458717856354268


Q ss_pred             CCHHHHHHHHHHHHHH--HC-CCCHHHHHHHHHH--CCC-CCEEEECCCCCCCCCCCCCCCCC-CCCCCC--CCCCCCCC
Q ss_conf             2323567788878875--14-4531777887752--057-52344215776310352000111-356654--44443443
Q gi|254780206|r  154 VVAATVDEATSAIDRC--FQ-QINSTVIIEEYLE--GFE-VSFFALCDGKTAIPFTTARDHKR-IHDGDI--GPNTGGMG  224 (424)
Q Consensus       154 ~i~~~~~e~~~~~~~~--~~-~~~~~VliEefl~--G~E-~Sv~~i~dG~~~~~l~~~~dyKr-~~~~d~--GpnTGGMG  224 (424)
                      ..+.++.++...++..  ++ ....-.+|+|||+  =++ -++=||+=|.+++-- .    .| ..+++-  .-+-||-+
T Consensus       176 ~l~~D~~~~~~~~e~~~~~~~~~~~~~~~QeyI~Pv~~~grDIR~fVvGd~v~aA-~----~R~~~~~~w~~N~a~GG~a  250 (321)
T TIGR00768       176 SLARDKQAAETLLEHFEQLNGPQYKVFLVQEYIKPVKPGGRDIRVFVVGDEVVAA-I----YRIITSGHWRTNLARGGKA  250 (321)
T ss_pred             EEEECHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCEEEEEEECCCEEEE-E----EECCCCCCHHHHHHCCCCC
T ss_conf             9850678999999999721883323578872011325789318999988920133-3----5417883024355438821


Q ss_pred             EEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECC-----EEEEEEEEEEECCCCCEEEEECCCCCC
Q ss_conf             000012344322201000008999998620462356644544898557-----048999886514775104433265441
Q gi|254780206|r  225 ACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-----GPYLIEYNVRFGDPECQAMMMRLESDI  299 (424)
Q Consensus       225 a~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~-----gp~viE~N~R~GDPE~q~ilp~L~~dl  299 (424)
                      .  |. .++    +++ +++   ++++-+..|..|.|   +||+-.++     |..|+|+|.-+|   -..+.-....|+
T Consensus       251 ~--~~-~l~----~e~-~~L---A~ka~~a~g~~v~g---iDlle~~~r~dw~GL~V~EVN~~~~---f~~~~~~tgvni  313 (321)
T TIGR00768       251 E--PC-SLT----EEI-EEL---AIKAAKALGLDVAG---IDLLESKDRDDWGGLLVLEVNANPE---FKNSVKTTGVNI  313 (321)
T ss_pred             C--CC-CCC----HHH-HHH---HHHHHHHHCCCEEE---EEEEECCCCCCCCCCEEEEECCCCC---CCCCEEECCCCH
T ss_conf             2--45-258----899-999---99999997683489---9776626854257837999849977---001111116776


Q ss_pred             HHHHHH
Q ss_conf             156665
Q gi|254780206|r  300 LEILNS  305 (424)
Q Consensus       300 ~~il~~  305 (424)
                      ...|..
T Consensus       314 A~~l~~  319 (321)
T TIGR00768       314 AGKLLD  319 (321)
T ss_pred             HHHHHH
T ss_conf             899997


No 64 
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IPR011870    The family of proteins found in this family include the characterised LysX from Thermus thermophilus  which is part of a well-organised lysine biosynthesis gene cluster . LysX is believed to carry out an ATP-dependent acylation of the amino group of alpha-aminoadipate in the prokaryotic version of the fungal AAA lysine biosynthesis pathway. No species having a sequence in this family contains the elements of the more common diaminopimelate lysine biosythesis pathway, and none has been shown to be a lysine auxotroph. These sequences have mainly recieved the name of the related enzyme, "ribosomal protein S6 modification protein RimK". RimK has been characterised in Escherichia coli, and acts by ATP-dependent condensation of S6 with glutamate residues .; GO: 0003824 catalytic activity, 0005524 ATP binding, 0009085 lysine biosynthetic process.
Probab=99.51  E-value=9.6e-14  Score=119.31  Aligned_cols=201  Identities=18%  Similarity=0.191  Sum_probs=136.9

Q ss_pred             HCCCEEEECCCH-HHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             189799997955-7874899898605880670106665552010235788876531011112234401111121012420
Q gi|254780206|r   61 KHIDLVVVGPEL-PLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus        61 ~~iDlvivgpE~-pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P  139 (424)
                      ...|++|.=+=. .=+.-.+-.++..|++++ -+..+...++||.|+.-.|.++|||||++.++.|.+.|+++++++|||
T Consensus        47 ~~~dv~i~R~VS~~R~L~~a~~~E~~G~~~i-N~~~~i~~cgDK~~T~~~L~~~gvP~P~t~~a~d~~~A~~~~e~lGYP  125 (289)
T TIGR02144        47 EDLDVAIIRNVSQSRALYSAFLLEAVGVPTI-NSSHAIIACGDKIFTTLKLAKAGVPTPRTYIAFDREAALKAAEELGYP  125 (289)
T ss_pred             CCCCEEEECHHHHHHHHHHHHHHHHCCCEEE-CCHHHHHHHCCHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHCCCC
T ss_conf             3755689830345679999999984897152-775898750461889999996678898358982868999999970898


Q ss_pred             EEEEECCCCCCCCCCCHHHHHHHHHHHH--HHHCCCCHH-HHHHHHHH--CCCCCEEEECCCCCCCCCCCCCCCCCCCC-
Q ss_conf             2563046534300023235677888788--751445317-77887752--05752344215776310352000111356-
Q gi|254780206|r  140 IVVKADGLCAGKGVVVAATVDEATSAID--RCFQQINST-VIIEEYLE--GFEVSFFALCDGKTAIPFTTARDHKRIHD-  213 (424)
Q Consensus       140 vVVKp~~~agGkGV~i~~~~~e~~~~~~--~~~~~~~~~-VliEefl~--G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~-  213 (424)
                      +|+||...|=||=|..++|.+++...++  +..++.... -+|+||++  |.-+-++++  |.+++. .+   | |..+ 
T Consensus       126 vV~KP~~GSWGRlV~~~~d~~~~~~llEh~e~~~~~~~~~~y~QEfi~KPgRDIR~fVi--Gd~~~~-AI---Y-R~~~P  198 (289)
T TIGR02144       126 VVLKPVIGSWGRLVSKIRDKDELESLLEHKEVLGGSQLKLYYVQEFINKPGRDIRVFVI--GDEAIA-AI---Y-RYSEP  198 (289)
T ss_pred             EEEECCCCCHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCEEEEEEE--CCCCEE-EE---E-ECCCC
T ss_conf             89708888437887640378898899999998679763337999887188960899999--797316-78---8-33885


Q ss_pred             CCCCCCCCCCCEE-ECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECC------EEEEEEEEEE
Q ss_conf             6544444344300-0012344322201000008999998620462356644544898557------0489998865
Q gi|254780206|r  214 GDIGPNTGGMGAC-SPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ------GPYLIEYNVR  282 (424)
Q Consensus       214 ~d~GpnTGGMGa~-~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~------gp~viE~N~R  282 (424)
                      ++==-||- -|+= +|.+         +-+++-+-+++|...-|..|   +-+|+.=.++      |--|+|+|--
T Consensus       199 ~~W~TNtA-rGG~A~P~~---------~~~e~~~La~kA~~avgg~~---~~iDi~Es~~rqndW~GlLV~EVN~~  261 (289)
T TIGR02144       199 NHWRTNTA-RGGKAEPCK---------IDEEVEELAVKAAEAVGGEV---VGIDIVESKRRQNDWGGLLVNEVNGV  261 (289)
T ss_pred             CCHHHHHH-CCCCCCCCC---------CCHHHHHHHHHHHHHHCCEE---EEEEEEECCCCCCCCCCEEEEEECCC
T ss_conf             30255630-588447887---------68768999999999978827---89988643344544378689735689


No 65 
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only]
Probab=99.49  E-value=3.3e-12  Score=108.22  Aligned_cols=336  Identities=20%  Similarity=0.256  Sum_probs=189.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEE----EC-CCHHHHH-CCEEE------ECCCCCHHHHHHHHHHHC--CCE-E
Q ss_conf             58998865889999999985899678999----54-9835751-17055------128789899999998718--979-9
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWS----IP-GNPGIAQ-HAQCV------AIDIQNHSAIIHFCQEKH--IDL-V   66 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~----~p-gN~g~~~-~~~~~------~i~~~d~~~i~~~a~~~~--iDl-v   66 (424)
                      ||||||---|--+  ..+++  .-.+||.    .| +-++-+. .-.+.      .+...|.+.+++.+.+..  +|. +
T Consensus        13 kiLviGvntR~vv--eSA~k--lGf~V~sv~~y~~~Dl~~~a~~~l~~r~~~~~~rfe~~de~~li~~~~~~~~dvD~~i   88 (389)
T COG2232          13 KILVIGVNTRPVV--ESASK--LGFEVYSVQYYDPADLPGDAISYLRERPGELLGRFENLDEQKLIEAAEDLAEDVDAPI   88 (389)
T ss_pred             EEEEEEECCHHHH--HHHHH--CCEEEEEEEEECCCCCCCCCCEEEEECCHHHCCCCCCCCHHHHHHHHHHHHHHCCEEE
T ss_conf             3899962341767--78774--4718998675343236642102788448545276558898999999986445324125


Q ss_pred             EECCCHHHHHHHHHHHH---HCCCCEEECCHHHHHHH-HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             99795578748998986---05880670106665552-010235788876531011112234401111121012420256
Q gi|254780206|r   67 VVGPELPLVNGISDALN---AAGFKVFGPSQRAAKLE-SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVV  142 (424)
Q Consensus        67 ivgpE~pL~~gi~d~l~---~~gi~v~Gp~~~aa~le-~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVV  142 (424)
                      +++.       ....|.   +.+-++.|-+.....-+ ++|...-..++..|.|.|.-+..       +-+..--.++++
T Consensus        89 i~~s-------g~e~l~~~g~~~~~v~~n~P~~~v~~~snk~~~~r~l~~lgmp~p~~~~~-------e~~~~gekt~Il  154 (389)
T COG2232          89 IPFS-------GFEALRTSGELGCEVAGNEPEVKVVEASNKLKFYRKLEVLGMPEPSEKKI-------EPLEEGEKTLIL  154 (389)
T ss_pred             EECC-------CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHH-------HHHHHCCEEEEE
T ss_conf             4035-------53212456754564456782788999888886520101028999704321-------144402101477


Q ss_pred             EECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             30465343000232356778887887514453177788775205752344215776310352000111356654444434
Q gi|254780206|r  143 KADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGG  222 (424)
Q Consensus       143 Kp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGG  222 (424)
                      ||...+||- +.++.-.++          ..-..+|++||++|.-+|+..+.+|.+.+++....   .+-++-.|-- ++
T Consensus       155 KPv~GaGG~-~el~~~~Ee----------~~~~~~i~Qefi~G~p~Svs~is~g~~a~~la~N~---QiI~~~~~~~-~~  219 (389)
T COG2232         155 KPVSGAGGL-VELVKFDEE----------DPPPGFIFQEFIEGRPVSVSFISNGSDALTLAVND---QIIDGLRGEY-SQ  219 (389)
T ss_pred             EECCCCCCE-EEECCCCCC----------CCCCCEEHHHHCCCCEEEEEEEECCCCEEEEEEEE---EEECCCCCCC-CC
T ss_conf             302378860-131004334----------58766003343178413799973586238999700---2214532334-44


Q ss_pred             ---CCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEE-CCCCCEEEEECCCCC
Q ss_conf             ---4300001234432220100000899999862046235664454489855704899988651-477510443326544
Q gi|254780206|r  223 ---MGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRF-GDPECQAMMMRLESD  298 (424)
Q Consensus       223 ---MGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~-GDPE~q~ilp~L~~d  298 (424)
                         -|-.+|.+....    +..+++.+-.+..|-..|     --.+||+++++||||||+|.|+ |-=||.  =....-+
T Consensus       220 f~Y~GNlTP~~~~~~----ee~e~la~elV~~lgL~G-----snGVDfvl~d~gpyViEVNPR~qGt~e~i--E~s~giN  288 (389)
T COG2232         220 FVYKGNLTPFPYEEV----EEAERLAEELVEELGLVG-----SNGVDFVLNDKGPYVIEVNPRIQGTLECI--ERSSGIN  288 (389)
T ss_pred             CEECCCCCCCCCHHH----HHHHHHHHHHHHHHCCCC-----CCCCCEEEECCCCEEEEECCCCCCHHHHH--HHHCCCC
T ss_conf             101267677765026----899999999999842356-----66610686068857999568545237888--9861777


Q ss_pred             CHHHHHHHHHCCCCCCCCCCCCC-CEE-EEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEE-ECCEEEECCCCEE
Q ss_conf             11566654201333321234444-206-75422544668775797624876668986899833587-7887998188079
Q gi|254780206|r  299 ILEILNSCVHGNLHNTHINWKAE-YAL-TVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGTAI-VNNNLTANGGRVL  375 (424)
Q Consensus       299 l~~il~~~~~g~L~~~~~~~~~~-~~v-~Vvlas~GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~-~~g~l~t~GGRVL  375 (424)
                      ++++-..+.+|+|.+   +|++. +++ .|+-|+.         ..+.+  + ... .++|   .. ..|.++-.|--++
T Consensus       289 l~~lHi~af~G~LpE---r~kpr~~a~krILyap~---------~v~v~--~-l~~-~~~~---DiP~~GtviekgePl~  349 (389)
T COG2232         289 LFRLHIQAFDGELPE---RPKPRGYACKRILYAPR---------TVRVP--I-LKL-SWTH---DIPRPGTVIEKGEPLC  349 (389)
T ss_pred             HHHHHHHHHCCCCCC---CCCCCEEEEEEEEECCC---------EEECC--C-CCC-CCCC---CCCCCCCCCCCCCCEE
T ss_conf             899999984575767---77765347767886452---------36613--1-025-5211---3798982257998304


Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCC
Q ss_conf             9999628989999999999852589
Q gi|254780206|r  376 SATALGKTITESRELAYHMVENIDW  400 (424)
Q Consensus       376 ~vv~~g~~l~eA~~~ay~~i~~I~~  400 (424)
                      +|.+.+++.+.|+..+.+.+++++-
T Consensus       350 sviA~~nt~~~a~~~~er~~ervk~  374 (389)
T COG2232         350 SVIASSNTRSGAESMAERLAERVKN  374 (389)
T ss_pred             EEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             6552268778999999999999988


No 66 
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional
Probab=99.44  E-value=3.9e-13  Score=114.91  Aligned_cols=98  Identities=29%  Similarity=0.456  Sum_probs=84.2

Q ss_pred             HHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCC-CCEEEEEECCCCCCCCCCCH---HHHHHHHHHHHHHHCCC
Q ss_conf             552010235788876531011112234401111121012-42025630465343000232---35677888788751445
Q gi|254780206|r   98 KLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNK-SMPIVVKADGLCAGKGVVVA---ATVDEATSAIDRCFQQI  173 (424)
Q Consensus        98 ~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~-g~PvVVKp~~~agGkGV~i~---~~~~e~~~~~~~~~~~~  173 (424)
                      -+..+|..+|+++.++|+|+|++..|++.++|.++...+ +.|+||||-.-.-|.|+.+-   .+.++..+|++.+|+. 
T Consensus       485 limenk~vtK~vl~~~g~~vp~g~~~~~~~~a~~~~~~~~~k~ivvKpkstn~g~gi~if~~~~~~~~~~~A~~~af~~-  563 (753)
T PRK02471        485 LIMENKVVTKKILAEAGFPVPAGDEFTSLEEALADYSLFEDKAIVVKPKSTNFGLGISIFKEVASLEDYQKALEIAFKE-  563 (753)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEECCHHHHHHHHHHHCCCCEEECCCCCCCCCCEEEECCCCCHHHHHHHHHHHHHC-
T ss_conf             9884119999999985998999874078999999999867996686807777877659834899989999999999856-


Q ss_pred             CHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf             317778877520575234421577
Q gi|254780206|r  174 NSTVIIEEYLEGFEVSFFALCDGK  197 (424)
Q Consensus       174 ~~~VliEefl~G~E~Sv~~i~dG~  197 (424)
                      ++.||||+|+.|.|+.+.++ ||+
T Consensus       564 d~~VlVE~~i~G~dyR~lVI-~~k  586 (753)
T PRK02471        564 DSSVLVEEFIVGTEYRFFVL-DGK  586 (753)
T ss_pred             CCEEEEEEEECCCCEEEEEE-CCE
T ss_conf             98189997316870699999-999


No 67 
>COG3919 Predicted ATP-grasp enzyme [General function prediction only]
Probab=99.09  E-value=3e-09  Score=86.85  Aligned_cols=284  Identities=20%  Similarity=0.230  Sum_probs=167.8

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEEECC--CHHHHHCCEEE-----ECCCCCHHHHHHHHHHHCCC--EEE-EC-CC
Q ss_conf             8998865889999999985899678999549--83575117055-----12878989999999871897--999-97-95
Q gi|254780206|r    3 VLLIGSGGREHALAWKIAQSPLLSELWSIPG--NPGIAQHAQCV-----AIDIQNHSAIIHFCQEKHID--LVV-VG-PE   71 (424)
Q Consensus         3 ILviGsGgrEhAl~~~l~~s~~~~~v~~~pg--N~g~~~~~~~~-----~i~~~d~~~i~~~a~~~~iD--lvi-vg-pE   71 (424)
                      |++||+---..|||..+-... +...++..+  -|+.+.+.+..     +-|..-+.-+.+||.+|.-.  |-| +| +|
T Consensus         6 viilGgahgtlalARSfg~~~-vpv~~ls~d~plPt~Sr~vr~t~~w~gphd~gaiafLrd~Aekhglkg~LLva~GDge   84 (415)
T COG3919           6 VIILGGAHGTLALARSFGEEF-VPVLALSADGPLPTYSRIVRVTTHWNGPHDEGAIAFLRDFAEKHGLKGYLLVACGDGE   84 (415)
T ss_pred             EEEECCCCHHHHHHHHHCCCC-CEEEEEECCCCCCCHHHHHEEEECCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCE
T ss_conf             699746501689887614012-5179984698886444431010004899852099999998761476735999638830


Q ss_pred             HHHHHHHHHHHHHCCCCEEECCHHHH-HHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCC
Q ss_conf             57874899898605880670106665-55201023578887653101111223440111112101242025630465343
Q gi|254780206|r   72 LPLVNGISDALNAAGFKVFGPSQRAA-KLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAG  150 (424)
Q Consensus        72 ~pL~~gi~d~l~~~gi~v~Gp~~~aa-~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agG  150 (424)
                      .-|+.--.+.|.+. +.|.-|...-- +|| .|-..-+.+.++|+|.|+-..++|..++.  ..++-||+++||... +|
T Consensus        85 v~lvSq~reeLSa~-f~v~lp~w~~l~wlc-eKPllY~ra~elgl~~P~Ty~v~S~~d~~--~~el~FPvILKP~mg-g~  159 (415)
T COG3919          85 VLLVSQYREELSAF-FEVPLPDWALLRWLC-EKPLLYNRAEELGLPYPKTYLVNSEIDTL--VDELTFPVILKPGMG-GS  159 (415)
T ss_pred             EEEHHHHHHHHHHH-HCCCCCCHHHHHHHH-HCCHHHHHHHHHCCCCCCEEEECCHHHHH--HHHEEEEEEECCCCC-CC
T ss_conf             66257569999887-657787389999986-08288888998199976067723144321--231440388617888-75


Q ss_pred             ------CCCCCHHHHHHHHHHHHHHHCCC-CHHHHHHHHHHCC---CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ------00023235677888788751445-3177788775205---7523442157763103520001113566544444
Q gi|254780206|r  151 ------KGVVVAATVDEATSAIDRCFQQI-NSTVIIEEYLEGF---EVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNT  220 (424)
Q Consensus       151 ------kGV~i~~~~~e~~~~~~~~~~~~-~~~VliEefl~G~---E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnT  220 (424)
                            +-++.+.+.+|.+.++-++.++. .+.|+|+|||.|-   .+|.-++.|..+-+.+-+++- -|-+.-|.|   
T Consensus       160 ~~~~araKa~~a~d~ee~k~a~~~a~eeigpDnvvvQe~IPGGgE~qfsyaAlw~~g~pvaeftarr-~rqyPvdfg---  235 (415)
T COG3919         160 VHFEARAKAFTAADNEEMKLALHRAYEEIGPDNVVVQEFIPGGGENQFSYAALWDKGHPVAEFTARR-LRQYPVDFG---  235 (415)
T ss_pred             CEEEHHHHEEECCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHCCCCHHHHHCCH-HHCCCCCCC---
T ss_conf             1001010014316779999999998874399725887705799822320988985798346442342-221886546---


Q ss_pred             CCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC-CE-EEEEEEEEEECCCCCEEEEECCCCC
Q ss_conf             344300001234432220100000899999862046235664454489855-70-4899988651477510443326544
Q gi|254780206|r  221 GGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE-QG-PYLIEYNVRFGDPECQAMMMRLESD  298 (424)
Q Consensus       221 GGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~-~g-p~viE~N~R~GDPE~q~ilp~L~~d  298 (424)
                           |+-.-.   +..+  .++.++..-+-|.  .+.+.|+..++|..+. +| -|++|+|.|.+--  --+...-.-|
T Consensus       236 -----ytst~v---evvD--n~Q~i~aar~~L~--si~htGlvevefK~D~RDGs~KlldvNpRpw~w--fgl~taaG~n  301 (415)
T COG3919         236 -----YTSTVV---EVVD--NQQVIQAARDFLE--SIEHTGLVEVEFKYDPRDGSYKLLDVNPRPWRW--FGLVTAAGYN  301 (415)
T ss_pred             -----CCCEEE---EECC--CHHHHHHHHHHHH--HHCCCCEEEEEEEECCCCCCEEEEEECCCCCCE--EEEEECCCCC
T ss_conf             -----452799---9528--2899999999998--631255478998756877724677625887304--5477404545


Q ss_pred             CHHHHHHHHHCC
Q ss_conf             115666542013
Q gi|254780206|r  299 ILEILNSCVHGN  310 (424)
Q Consensus       299 l~~il~~~~~g~  310 (424)
                      |.-++.+...++
T Consensus       302 Lg~~Lwa~~~~~  313 (415)
T COG3919         302 LGRYLWADRINN  313 (415)
T ss_pred             CCCEEEEEECCC
T ss_conf             301478651589


No 68 
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809   There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site. These enzymes are: ATP citrate-lyase (4.1.3.8 from EC) , the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues, catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. ATP-citrate lyase is a tetramer of identical subunits; Succinyl-CoA ligase (GDP-forming) (6.2.1.4 from EC)  is a mitochondrial enzyme that catalyzes the substrate level phosphorylation step of the tricarboxylic acid cycle: the formation of succinyl-CoA from succinate with a concomitant hydrolysis of GTP to GDP and phosphate. This enzyme is a dimer composed of an alpha and a beta subunits; Succinyl-CoA ligase (ADP-forming) (6.2.1.5 from EC)  is a bacterial enzyme that during aerobic metabolism functions in the citric acid cycle, coupling the hydrolysis of succinyl-CoA to the synthesis of ATP. It can also function in the other direction for anabolic purposes. This enzyme is a tetramer composed of two alpha and two beta subunits; and Malate-CoA ligase (6.2.1.9 from EC) (malyl-CoA synthetase) , is a bacterial enzyme that forms malyl-CoA from malate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. Malate-CoA ligase is composed of two different subunits.   This entry corresponds to a conserved region located in the first half of ATP citrate lyase and in the beta subunits of succinyl-CoA ligases and malate-CoA ligase. ; GO: 0003824 catalytic activity, 0008152 metabolic process.
Probab=98.98  E-value=3.2e-10  Score=93.88  Aligned_cols=101  Identities=24%  Similarity=0.330  Sum_probs=86.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCC-CEEEEEECCCCCCC----CCCCHHHHHHHHHHHHHHHCCC-----
Q ss_conf             2357888765310111122344011111210124-20256304653430----0023235677888788751445-----
Q gi|254780206|r  104 SFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKS-MPIVVKADGLCAGK----GVVVAATVDEATSAIDRCFQQI-----  173 (424)
Q Consensus       104 ~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g-~PvVVKp~~~agGk----GV~i~~~~~e~~~~~~~~~~~~-----  173 (424)
                      .-+|++|++||||+|++..+++.+|+...+++.| .++|||+--++|||    ||.+++|.+|+.++.++.|+..     
T Consensus         6 YqAK~if~~YGiPvp~g~v~~s~~e~~~~~~~~g~~~~VvKaQVhaGGRGKAGGv~~a~s~ee~~~~a~~llg~~l~t~Q   85 (389)
T TIGR01016         6 YQAKEIFAKYGIPVPEGEVATSVEEVEEIAEELGEGKVVVKAQVHAGGRGKAGGVKVAKSKEEALKAAEKLLGKELKTFQ   85 (389)
T ss_pred             HHHHHHHHHCCCCCCCCCEEECHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCCEEEEECHHHHHHHHHHHHCCEEEEEE
T ss_conf             55899998478967886004167899999997079978999877326711215768970879999999987089157864


Q ss_pred             ----C---HHHHHHHHHH-CCCCCEEEECCCCC--CCCCCC
Q ss_conf             ----3---1777887752-05752344215776--310352
Q gi|254780206|r  174 ----N---STVIIEEYLE-GFEVSFFALCDGKT--AIPFTT  204 (424)
Q Consensus       174 ----~---~~VliEefl~-G~E~Sv~~i~dG~~--~~~l~~  204 (424)
                          +   ++|+||+-++ -.||-+.++.|-++  .++|-.
T Consensus        86 t~~~g~~VnkiliE~~~~I~kEyY~s~v~DR~~~~pv~maS  126 (389)
T TIGR01016        86 TDPLGQPVNKILIEEKIDIDKEYYLSIVIDRSAKKPVIMAS  126 (389)
T ss_pred             CCCCCCEEEEEEECCCCCCCCEEEEEEEEEECCCCCEEEEE
T ss_conf             07888634478732677412001477999804787179970


No 69 
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional
Probab=98.95  E-value=4e-08  Score=78.69  Aligned_cols=263  Identities=19%  Similarity=0.254  Sum_probs=154.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCC-CEEEECCCHHHH
Q ss_conf             95899886588999999998589967899954983575----1170551287898999999987189-799997955787
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHI-DLVVVGPELPLV   75 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~i-DlvivgpE~pL~   75 (424)
                      |.|.++||-.-=| +..-.++...-+-++|-.|...+-    ..++.+.+  .++.++++..++..= +.++| |--.++
T Consensus        19 i~I~tl~SHSALq-Il~GAK~EGF~T~~vc~~gr~~~Y~~f~~~De~iv~--d~f~di~~~q~~L~~~NaI~I-PhgSfv   94 (356)
T PRK13278         19 ITIATIGSHSSLQ-ILKGAKKEGFRTIAICEKKREKFYKRFPFADEFIIV--DSFSDILEIQEELREMNAIVI-PHGSFV   94 (356)
T ss_pred             CEEEEEECHHHHH-HHCCHHHCCCCEEEEECCCCCCHHHHCCCCCEEEEE--CCHHHHHHHHHHHHHCCEEEE-CCCCEE
T ss_conf             3899984425988-853287739957999669974534547764279994--768999999999987896996-488858


Q ss_pred             HHH-HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCC
Q ss_conf             489-9898605880670106665552010235788876531011112234401111121012420256304653430002
Q gi|254780206|r   76 NGI-SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVV  154 (424)
Q Consensus        76 ~gi-~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~  154 (424)
                      +-+ .|.+++..+|+|| ++..-+.|+++..-+++|+++|||.|+  .+.+.++       +.-|++||.-|-.||||-+
T Consensus        95 ~Y~G~~~iE~~~VP~FG-NR~lLrwEs~r~~~~~lLe~Agi~~Pk--~~~~Pee-------IDr~VIVK~~gAkggrGyF  164 (356)
T PRK13278         95 AYLGLENVEEFKVPMFG-NREILRWESDRDKERKLLEGAGIRIPR--KYEDPED-------IDGPVIVKLPGAKGGRGYF  164 (356)
T ss_pred             EEECHHHHHHCCCCCCC-CHHHHHHHHCHHHHHHHHHHCCCCCCE--ECCCHHH-------CCCCEEEEECCCCCCCEEE
T ss_conf             98368888508888205-877866510307899999867999871--1589555-------7852699746777774589


Q ss_pred             CHHHHHHHHHHHHHHHCC----CCHHHHHHHHHHCCCCCEEEECC--CCCCCCCCCCCCCCCCCCC------------CC
Q ss_conf             323567788878875144----53177788775205752344215--7763103520001113566------------54
Q gi|254780206|r  155 VAATVDEATSAIDRCFQQ----INSTVIIEEYLEGFEVSFFALCD--GKTAIPFTTARDHKRIHDG------------DI  216 (424)
Q Consensus       155 i~~~~~e~~~~~~~~~~~----~~~~VliEefl~G~E~Sv~~i~d--G~~~~~l~~~~dyKr~~~~------------d~  216 (424)
                      ++.|.+|..+-++...+.    .-+...||||+-|.-+-++-|-.  -+++-.|..-+-|..--|+            +.
T Consensus       165 ~a~s~~ef~~k~~~l~~~g~i~d~~~~~IeEyv~G~~~~~~yFySpl~~~lEllg~D~R~esniDg~~rlPa~~qle~~~  244 (356)
T PRK13278        165 IASSPEEFWEKIDRLKEKGLIEDVEKYIIQEYVVGVPYYIHYFYSPIKNRLELLGIDRRYESNIDGLVRIPAKDQLEAGI  244 (356)
T ss_pred             EECCHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCEEEHHHCCCCCCCCEEEEECCEEEEECCHHHCCCCHHHHHHCCC
T ss_conf             95798999999999886275455544279998347412312203520066136631003440522320488788853689


Q ss_pred             CCC---CCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECCE-EEEEEEEEEE
Q ss_conf             444---434430000123443222010000089999986204-623566445448985570-4899988651
Q gi|254780206|r  217 GPN---TGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQG-PYLIEYNVRF  283 (424)
Q Consensus       217 Gpn---TGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~g-p~viE~N~R~  283 (424)
                      -|.   ||-    .|. .+-+++..++.+ .=+..+++.+++ .-...|++..+.++|++. .+|-|+.+|.
T Consensus       245 ~p~~vvvGn----~p~-vlRESLL~~vf~-~ge~fV~a~k~l~~PG~iGPFcLq~vvt~~le~vvFevS~RI  310 (356)
T PRK13278        245 DPTYVVTGN----IPL-VLRESLLPQVFE-YGERFVEASKELVGPGMIGPFCLESVITDDLEIVVFEISARI  310 (356)
T ss_pred             CCCEEEECC----CCC-EEEHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEEEEEEEECCC
T ss_conf             984699888----532-441765799999-999999999974699863454366898698609999985431


No 70 
>pfam08442 ATP-grasp_2 ATP-grasp domain.
Probab=98.88  E-value=1e-09  Score=90.20  Aligned_cols=95  Identities=26%  Similarity=0.316  Sum_probs=79.9

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCC-EEEEEECCCCCCC----CCCCHHHHHHHHHHHHHHHCCC------
Q ss_conf             3578887653101111223440111112101242-0256304653430----0023235677888788751445------
Q gi|254780206|r  105 FAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSM-PIVVKADGLCAGK----GVVVAATVDEATSAIDRCFQQI------  173 (424)
Q Consensus       105 ~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~-PvVVKp~~~agGk----GV~i~~~~~e~~~~~~~~~~~~------  173 (424)
                      -+|++|+++|||+|++..+++.++|.+++++++. |+|||+.-++|||    ||.++.|.+|+.++.++.++..      
T Consensus         6 qaK~ll~~~gIpvp~g~~~~~~~ea~~~~~~l~~~~~VvKaQv~aGGRGKaGGVk~~~~~~ea~~~a~~~lg~~l~T~QT   85 (202)
T pfam08442         6 QAKEILAKYGVPVPRGEVAFSPEEAEEIAKKLGGKVYVVKAQVLAGGRGKAGGVKLAKSPEEAKEAAKEMLGKNLVTKQT   85 (202)
T ss_pred             HHHHHHHHCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCEEEEECCHHHHHHHHHHHCCCEEEEEEC
T ss_conf             99999998599899915969999999999980998699987423588876773899789999999999872977875502


Q ss_pred             ------CHHHHHHHHHHC-CCCCEEEECCCCCC
Q ss_conf             ------317778877520-57523442157763
Q gi|254780206|r  174 ------NSTVIIEEYLEG-FEVSFFALCDGKTA  199 (424)
Q Consensus       174 ------~~~VliEefl~G-~E~Sv~~i~dG~~~  199 (424)
                            -++|+|||.++- .|+-+..+.|..+-
T Consensus        86 g~~G~~V~~vlvee~~~i~~E~Ylsi~~DR~~~  118 (202)
T pfam08442        86 GPEGKPVNKVLVEEAVDIAREYYLSIVLDRASR  118 (202)
T ss_pred             CCCCCEEEEEEEEECCCCCCEEEEEEEECCCCC
T ss_conf             788962338999851540100799999757778


No 71 
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion]
Probab=98.79  E-value=1.4e-09  Score=89.22  Aligned_cols=101  Identities=26%  Similarity=0.335  Sum_probs=84.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCC-CEEEEEECCCCCCC----CCCCHHHHHHHHHHHHHHHC----CC-
Q ss_conf             2357888765310111122344011111210124-20256304653430----00232356778887887514----45-
Q gi|254780206|r  104 SFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKS-MPIVVKADGLCAGK----GVVVAATVDEATSAIDRCFQ----QI-  173 (424)
Q Consensus       104 ~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g-~PvVVKp~~~agGk----GV~i~~~~~e~~~~~~~~~~----~~-  173 (424)
                      .-+|++|.++|||+|++..+++.+++.+.++++| .|+|||+.-++|||    ||.++.|.+|+.++.++.++    .. 
T Consensus         6 YqaKelf~~~GiPvp~g~v~~s~eea~~~a~~lg~~~~VvKaQV~aGGRGKaGGVk~~~s~~ea~~~a~~~lg~~~q~~~   85 (387)
T COG0045           6 YQAKELFAKYGIPVPPGYVATSPEEAEEAAKELGGGPVVVKAQVHAGGRGKAGGVKLAKSPEEAKEAAEEILGKNYQTDI   85 (387)
T ss_pred             HHHHHHHHHCCCCCCCCEEEECHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCEEEECCHHHHHHHHHHHHCCCCCCCC
T ss_conf             88998999729989995454089999999998189967999225305766667668838989999999998486654576


Q ss_pred             ----CHHHHHHHHHH-CC-CCCEEEECCCC--CCCCCCC
Q ss_conf             ----31777887752-05-75234421577--6310352
Q gi|254780206|r  174 ----NSTVIIEEYLE-GF-EVSFFALCDGK--TAIPFTT  204 (424)
Q Consensus       174 ----~~~VliEefl~-G~-E~Sv~~i~dG~--~~~~l~~  204 (424)
                          -.+++|||+.+ =. |+-+..+.|-.  ..+++..
T Consensus        86 ~G~~v~~vlvee~~~~~~~E~Ylsiv~DR~~~~p~~~~S  124 (387)
T COG0045          86 KGEPVNKVLVEEAVDIIKKEYYLSIVLDRSSRRPVLMAS  124 (387)
T ss_pred             CCCEEEEEEEEECCCCCCCEEEEEEEEECCCCCEEEEEE
T ss_conf             884542899974677764337999999737783799996


No 72 
>PRK05246 glutathione synthetase; Provisional
Probab=98.79  E-value=5.2e-08  Score=77.90  Aligned_cols=280  Identities=18%  Similarity=0.214  Sum_probs=154.9

Q ss_pred             CEEEEECCC--------HHHHHHHHHHHHCCCCCEEE-EECCCHHHH---HCCEEEEC--CCC--CHHHHH--HHHHHHC
Q ss_conf             958998865--------88999999998589967899-954983575---11705512--878--989999--9998718
Q gi|254780206|r    1 MRVLLIGSG--------GREHALAWKIAQSPLLSELW-SIPGNPGIA---QHAQCVAI--DIQ--NHSAII--HFCQEKH   62 (424)
Q Consensus         1 MkILviGsG--------grEhAl~~~l~~s~~~~~v~-~~pgN~g~~---~~~~~~~i--~~~--d~~~i~--~~a~~~~   62 (424)
                      |||+++..-        ---.||+...++-..  +|| +-|.+=.+.   ..+....+  ...  ++-.+.  +...-.+
T Consensus         2 mki~f~mDpie~l~~~kDTT~~Lm~eAq~rGh--ev~~~~p~dL~~~~~~v~a~~~~v~~~~~~~~~~~~~~~~~~~L~~   79 (316)
T PRK05246          2 MKVAFIMDPIESINIKKDSTFAMMLEAQRRGH--ELFYYEPDDLSLRGGEVRARARPLTVRDDKGDWYELGEEQRLPLAD   79 (316)
T ss_pred             CEEEEEECCHHHCCCCCCHHHHHHHHHHHCCC--EEEEEECCCEEEECCEEEEEEEEEEECCCCCCCEEECCCEECCHHH
T ss_conf             47999968978779988729999999998799--8999972756998999999999999815888747941515513001


Q ss_pred             CCEEEECCC-----HHH-HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCC
Q ss_conf             979999795-----578-74899898605880670106665552010235788876531011112234401111121012
Q gi|254780206|r   63 IDLVVVGPE-----LPL-VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNK  136 (424)
Q Consensus        63 iDlvivgpE-----~pL-~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~  136 (424)
                      .|.|++=-+     .+| ..-+-|.++..|..|+ -+..+.+-...|.++-+|- +.   +|+.-+.+|.+++++|+++.
T Consensus        80 fD~V~mRkDPPfD~~Yi~~T~lLe~~~~~gv~Vi-N~P~~IR~~nEKL~~l~F~-~~---iP~TlVt~~~~~i~~F~~~~  154 (316)
T PRK05246         80 FDVILMRKDPPFDMEYIYATYLLERAERAGTLVV-NKPQSLRDANEKLFTLWFP-EL---MPPTLVTRDKAEIRAFRAEH  154 (316)
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEE-CCHHHHHHHHHHHHHHHHH-HH---CCCEEEECCHHHHHHHHHHH
T ss_conf             9899992699997688899999985153870897-6989986426478887406-44---89935737899999999973


Q ss_pred             CCEEEEEECCCCCCCCCCCHHH-HHHHHHHHHHHHCCCCHHHHHHHHHHCC---CCCEEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             4202563046534300023235-6778887887514453177788775205---75234421577631035200011135
Q gi|254780206|r  137 SMPIVVKADGLCAGKGVVVAAT-VDEATSAIDRCFQQINSTVIIEEYLEGF---EVSFFALCDGKTAIPFTTARDHKRIH  212 (424)
Q Consensus       137 g~PvVVKp~~~agGkGV~i~~~-~~e~~~~~~~~~~~~~~~VliEefl~G~---E~Sv~~i~dG~~~~~l~~~~dyKr~~  212 (424)
                      + .+||||-+..||+||+.+.. ...+...++.........|+++|||.-.   ...+ .+.||+-+-. ...|- .  -
T Consensus       155 ~-~iVlKPL~g~gG~gV~~i~~~d~n~~~i~e~~t~~~~~~v~vQ~yl~ei~~GDkRi-ilv~G~~ig~-a~~R~-p--~  228 (316)
T PRK05246        155 G-DIILKPLDGMGGAGIFRVKADDPNLGVILETLTEQGRRPVMAQRYLPEIKEGDKRI-LLVDGEPVGY-ALARI-P--A  228 (316)
T ss_pred             C-CEEEEECCCCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEEEEEHHHCCCCCEEE-EEECCEEEHH-EEEEC-C--C
T ss_conf             8-78999756889840899777862389999999745873689886512436898799-9999999114-68832-6--7


Q ss_pred             CCC--CCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEE-E-CCCCC
Q ss_conf             665--4444434430000123443222010000089999986204623566445448985570489998865-1-47751
Q gi|254780206|r  213 DGD--IGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVR-F-GDPEC  288 (424)
Q Consensus       213 ~~d--~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R-~-GDPE~  288 (424)
                      ++|  ..-..||-+..++   ++++     ..+|++.+..-|++.|+-|.|   +|++    |+|++|+|+- . |=.|.
T Consensus       229 ~gdfR~Nl~~Gg~~~~~~---lt~~-----~~~i~~~i~p~L~~~gl~f~G---iDvi----g~~ltEINVTSPtgl~ei  293 (316)
T PRK05246        229 GGETRGNLAAGGRGEATP---LTER-----DREICAAIGPELKERGLIFVG---IDVI----GDYLTEINVTSPTGIREI  293 (316)
T ss_pred             CCCCEEEEECCCEEEEEC---CCHH-----HHHHHHHHHHHHHHCCCEEEE---EEEE----CCEEEEEECCCCHHHHHH
T ss_conf             886113230598026716---9989-----999999999999987988999---9753----782689936895459999


Q ss_pred             EEEEECCCCCCHHHHHHHHHCCC
Q ss_conf             04433265441156665420133
Q gi|254780206|r  289 QAMMMRLESDILEILNSCVHGNL  311 (424)
Q Consensus       289 q~ilp~L~~dl~~il~~~~~g~L  311 (424)
                         --+-..|+...+...++.++
T Consensus       294 ---~~~~~~~~~~~~~d~lE~~~  313 (316)
T PRK05246        294 ---ERLTGVDIAGMLWDAIEAKL  313 (316)
T ss_pred             ---HHHHCCCHHHHHHHHHHHHH
T ss_conf             ---98759998999999999876


No 73 
>pfam02955 GSH-S_ATP Prokaryotic glutathione synthetase, ATP-grasp domain.
Probab=98.76  E-value=2.6e-08  Score=80.09  Aligned_cols=146  Identities=19%  Similarity=0.237  Sum_probs=92.1

Q ss_pred             CCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHH-HHHHHHHHHCCCCHHHHHHHHHHC---CCCCEEE
Q ss_conf             111122344011111210124202563046534300023235677-888788751445317778877520---5752344
Q gi|254780206|r  117 TATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-ATSAIDRCFQQINSTVIIEEYLEG---FEVSFFA  192 (424)
Q Consensus       117 t~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e-~~~~~~~~~~~~~~~VliEefl~G---~E~Sv~~  192 (424)
                      +|+-...+|.+++++|++..+ ++|+||-..++|+||+.+.+.+. +...++.........++++|||+.   -++.+.+
T Consensus        12 ~P~T~vt~~~~~i~~f~~~~g-~vVvKPl~Gs~G~GV~~i~~~~~~~~~i~e~~~~~~~~~ii~QeyI~~~~~gD~Rv~v   90 (176)
T pfam02955        12 IPPTLVTRDKEEIRAFLEEHG-DIILKPLDGMGGAGVFRIKKDDPNLNVILETLTQYGRRPVMAQRYLPEIKEGDKRILL   90 (176)
T ss_pred             CCCEEEECCHHHHHHHHHHCC-CEEEEECCCCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCEEEEE
T ss_conf             869479889999999999779-8999957888876759954783558999999984688839864313767899769999


Q ss_pred             ECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC
Q ss_conf             2157763103520001113-566544444344300001234432220100000899999862046235664454489855
Q gi|254780206|r  193 LCDGKTAIPFTTARDHKRI-HDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE  271 (424)
Q Consensus       193 i~dG~~~~~l~~~~dyKr~-~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~  271 (424)
                      + ||+-+   ...   .|. .++|---|.---|...+.     ++.++ .++|...+...|++.|+.|.|   +|++   
T Consensus        91 i-~g~~v---~a~---~R~~~~g~~r~Nl~~Gg~~~~~-----~lt~~-~~~ia~~~a~~l~~~Gl~faG---VDii---  151 (176)
T pfam02955        91 V-NGEPI---GAL---ARIPAEGEFRGNLAAGGRGEAT-----ELTER-DREICETIGPKLKERGLFFVG---LDVI---  151 (176)
T ss_pred             E-CCEEE---EEE---EEECCCCCCEEEECCCCEEECC-----CCCHH-HHHHHHHHHHHHHHCCCEEEE---EEEE---
T ss_conf             9-99998---999---9854798521440269800057-----89999-999999999999986997999---9984---


Q ss_pred             CEEEEEEEEE-EE
Q ss_conf             7048999886-51
Q gi|254780206|r  272 QGPYLIEYNV-RF  283 (424)
Q Consensus       272 ~gp~viE~N~-R~  283 (424)
                       |+||+|+|+ -.
T Consensus       152 -g~~l~EVNvtsP  163 (176)
T pfam02955       152 -GDYLTEINVTSP  163 (176)
T ss_pred             -CCEEEEEECCCC
T ss_conf             -790889958890


No 74 
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional
Probab=98.75  E-value=4.6e-09  Score=85.48  Aligned_cols=99  Identities=26%  Similarity=0.290  Sum_probs=82.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE-EEEEECCCCCCC----CCCCHHHHHHHHHHHHHHHCCC-----
Q ss_conf             235788876531011112234401111121012420-256304653430----0023235677888788751445-----
Q gi|254780206|r  104 SFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP-IVVKADGLCAGK----GVVVAATVDEATSAIDRCFQQI-----  173 (424)
Q Consensus       104 ~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P-vVVKp~~~agGk----GV~i~~~~~e~~~~~~~~~~~~-----  173 (424)
                      .-+|++|+++|||+|++..+++.+|+.+++++++.| +|||+--++|||    ||.+++|.+|+.++.+++|+..     
T Consensus         6 yqaKell~~~gIpvp~g~v~~~~~ea~~~~~~l~~~~~VvKAQV~aGGRGKaGGVk~~~s~~ea~~~a~~ilg~~lvT~Q   85 (388)
T PRK00696          6 YQAKELLAEYGVPVPRGYVAFTPEEAVEAAEELGGPVWVVKAQVHAGGRGKAGGVKVAKSKEEVRAAAEEILGKDLVTHQ   85 (388)
T ss_pred             HHHHHHHHHCCCCCCCCEEECCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCEEC
T ss_conf             99999999869989997377999999999998299958999805458888686079908999999999998567742101


Q ss_pred             -------CHHHHHHHHHH-CCCCCEEEECCCCCCCCC
Q ss_conf             -------31777887752-057523442157763103
Q gi|254780206|r  174 -------NSTVIIEEYLE-GFEVSFFALCDGKTAIPF  202 (424)
Q Consensus       174 -------~~~VliEefl~-G~E~Sv~~i~dG~~~~~l  202 (424)
                             -..|+|||.++ -.|+-+..+.|..+-.|+
T Consensus        86 Tg~~G~~V~~vlvee~~~i~~E~Ylsi~~DR~~~~~~  122 (388)
T PRK00696         86 TGPEGQPVNRLLIEEGADIAKELYLSAVVDRATRRVV  122 (388)
T ss_pred             CCCCCCEEEEEEEEECCCHHHHEEEEEEEECCCCCEE
T ss_conf             5888844479998751661240689999864778579


No 75 
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional
Probab=98.64  E-value=2.3e-06  Score=65.95  Aligned_cols=263  Identities=18%  Similarity=0.243  Sum_probs=144.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH-HH----CCEEEECCCCCHHHHH-----HHHHHHCCCEEEECC
Q ss_conf             9589988658899999999858996789995498357-51----1705512878989999-----999871897999979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI-AQ----HAQCVAIDIQNHSAII-----HFCQEKHIDLVVVGP   70 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~-~~----~~~~~~i~~~d~~~i~-----~~a~~~~iDlvivgp   70 (424)
                      ++|.++||-.-=| +..-.++...-+-++|-.|...+ ..    .++.+.++  ++..++     +.-++.+  .++| |
T Consensus        15 i~I~tlgSHSALq-Il~GAK~EGF~Tv~vc~kgRe~~Y~~f~~~~De~iv~d--~f~di~~~~~q~~L~~~N--aI~I-P   88 (363)
T PRK13277         15 VKIGVLASHSALD-VLDGAKDEGFRTIAVCQRGRERTYREFKGIVDEVIVLD--KFKDILSEEIQEELREEN--AIFV-P   88 (363)
T ss_pred             CEEEEEECHHHHH-HHCCHHHCCCCEEEEECCCCCCHHHHCCCCCCEEEEEC--CHHHHHHHHHHHHHHHCC--EEEE-C
T ss_conf             4799984425988-85448773994799957987524775557784699955--577775489999998789--7996-4


Q ss_pred             CHHHHH--HHHHHHH-HCCCCEEECCHHHHHHHHCCHH--HHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             557874--8998986-0588067010666555201023--5788876531011112234401111121012420256304
Q gi|254780206|r   71 ELPLVN--GISDALN-AAGFKVFGPSQRAAKLESSKSF--AKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        71 E~pL~~--gi~d~l~-~~gi~v~Gp~~~aa~le~sK~~--~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                      --.+++  |. |.++ +..+|+|| ++..-+.|.+..-  ...+|+++|||.|+  .+.+.++       +.-||+||.-
T Consensus        89 hgSfv~Y~G~-d~iE~~~~VP~FG-NR~lLrwEer~~~~~~~~LLe~Agi~~Pk--~~~~Pee-------IDr~VIVK~~  157 (363)
T PRK13277         89 NRSFAVYVGY-DAIENEFPVPIFG-NRYLLRWEERTGEKNYYRLLEKAGIPRPR--TFKPPEE-------IDRPVIVKLP  157 (363)
T ss_pred             CCCEEEEECH-HHHHCCCCCCEEC-CHHHHHHCCCCHHHHHHHHHHHCCCCCCC--CCCCHHH-------CCCCEEEEEC
T ss_conf             8884677448-8885068887114-75663223451167899999867999870--0599666-------7852699745


Q ss_pred             CCCC--CCCCCCHHHHHHHHHHHHHHHCC------CCHHHHHHHHHHCCCCCEEEECC--CCCCCCCCCCCCCCCCCCC-
Q ss_conf             6534--30002323567788878875144------53177788775205752344215--7763103520001113566-
Q gi|254780206|r  146 GLCA--GKGVVVAATVDEATSAIDRCFQQ------INSTVIIEEYLEGFEVSFFALCD--GKTAIPFTTARDHKRIHDG-  214 (424)
Q Consensus       146 ~~ag--GkGV~i~~~~~e~~~~~~~~~~~------~~~~VliEefl~G~E~Sv~~i~d--G~~~~~l~~~~dyKr~~~~-  214 (424)
                      +-.|  |||-+++.|.+|..+-.++..+.      .-....||||+-|.-+-++-|..  -+++-.|..-+-|..--|+ 
T Consensus       158 gAkg~~grGyF~a~s~~ef~~k~~~li~~G~I~~e~l~~~~IeEyv~G~~~~~~fFySpl~~~lEllgiD~R~esniDg~  237 (363)
T PRK13277        158 EAKRRLERGFFIAASYKDFYEKSERLIKQGVIDREDLEKARIEEYVIGAHFNFNYFYSPIRDRVELLGIDRRIQSNLDGF  237 (363)
T ss_pred             CCCCCCCCEEEEECCHHHHHHHHHHHHHCCCCCHHHCCCCEEEEEECCCEEEEEECCCCCCCCEEEEECCCEEEECHHHH
T ss_conf             67787763589967989999999999875875722144437899843764665210253237503663111024141444


Q ss_pred             -----------CCCCC---CCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECCE-EEEEE
Q ss_conf             -----------54444---434430000123443222010000089999986204-623566445448985570-48999
Q gi|254780206|r  215 -----------DIGPN---TGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQG-PYLIE  278 (424)
Q Consensus       215 -----------d~Gpn---TGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~g-p~viE  278 (424)
                                 +.-|.   ||-    .|+ .+-+++..++.+ .=+..+++-+++ .....|++..+.++|++. -+|-|
T Consensus       238 ~rlpA~~Ql~~~~~p~~vvvGn----~p~-vlRESLL~~vf~-~ge~fV~ask~l~~pG~iGPFcLq~ivt~dle~vvFe  311 (363)
T PRK13277        238 VRLPAPQQLKLNEEPRYIEVGH----EPA-TIRESLLEKVFD-MGEKFVEATKELYPPGIIGPFTLQTIVTPDLDFVVYD  311 (363)
T ss_pred             HCCCHHHHHCCCCCCCEEEECC----CCC-EEEHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEEEEEE
T ss_conf             2398678841689984599888----532-431765799999-9999999999746998614433568985886099999


Q ss_pred             EEEEE-CCC
Q ss_conf             88651-477
Q gi|254780206|r  279 YNVRF-GDP  286 (424)
Q Consensus       279 ~N~R~-GDP  286 (424)
                      +.+|. |.+
T Consensus       312 vS~RI~gGt  320 (363)
T PRK13277        312 VAPRIGGGT  320 (363)
T ss_pred             EECCCCCCC
T ss_conf             844214887


No 76 
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl    5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and    metabolism]
Probab=98.50  E-value=5.9e-06  Score=63.03  Aligned_cols=255  Identities=17%  Similarity=0.282  Sum_probs=146.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCH--HHHH--CCEEEECCCCCHHHHH-----H-HHHHHCCCEEEECC
Q ss_conf             95899886588999999998589967899954983--5751--1705512878989999-----9-99871897999979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNP--GIAQ--HAQCVAIDIQNHSAII-----H-FCQEKHIDLVVVGP   70 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~--g~~~--~~~~~~i~~~d~~~i~-----~-~a~~~~iDlvivgp   70 (424)
                      ++|..+||-.-=| +....++...-.-+.|--|-+  -...  ..+++.++  ++..++     + +.+.+   .++| |
T Consensus        19 i~Iat~gSHSaL~-Il~GAK~EGF~Ti~v~~~gr~~~Y~~f~~a~e~i~v~--~f~dil~~~iqe~L~~~n---~I~I-P   91 (361)
T COG1759          19 ITIATIGSHSALQ-ILDGAKEEGFRTIAVCQRGREKPYEKFPVADEVIIVD--KFSDILNEEIQEELRELN---AIFI-P   91 (361)
T ss_pred             EEEEEEECCHHHH-HHHHHHHCCCCEEEEEECCCCCHHHHCCHHHEEEEEC--HHHHHHHHHHHHHHHHCC---EEEE-C
T ss_conf             6999851504788-8633776087279998357623676502023488952--047776489999998758---4994-2


Q ss_pred             CHHH-----HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             5578-----74899898605880670106665552010235788876531011112234401111121012420256304
Q gi|254780206|r   71 ELPL-----VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        71 E~pL-----~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                      --.+     ..|+.+   +.-+|+|| +++.-+-|.+....+++|+++|||.|+  .+++.+|       +.-|++||..
T Consensus        92 ~gSfv~Y~G~d~ie~---~~~vP~fG-nR~lLrwE~~~~~~~~lLekAgi~~P~--~~~~Pee-------Idr~ViVK~p  158 (361)
T COG1759          92 HGSFVAYVGYDGIEN---EFEVPMFG-NRELLRWEEDRKLEYKLLEKAGLRIPK--KYKSPEE-------IDRPVIVKLP  158 (361)
T ss_pred             CCCEEEEECCHHHHH---CCCCCCCC-CHHHHHHHCCHHHHHHHHHHCCCCCCC--CCCCHHH-------CCCCEEEECC
T ss_conf             786478853144644---11466116-676753000335689999974999885--6699678-------6873698557


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHCCC------CHHHHHHHHHHCCCCCEEEECC--CCCCCCCCCCCCCCCCCCCCC-
Q ss_conf             6534300023235677888788751445------3177788775205752344215--776310352000111356654-
Q gi|254780206|r  146 GLCAGKGVVVAATVDEATSAIDRCFQQI------NSTVIIEEYLEGFEVSFFALCD--GKTAIPFTTARDHKRIHDGDI-  216 (424)
Q Consensus       146 ~~agGkGV~i~~~~~e~~~~~~~~~~~~------~~~VliEefl~G~E~Sv~~i~d--G~~~~~l~~~~dyKr~~~~d~-  216 (424)
                      +--||||-+++.|.+|..+-.++..+..      -..+.||||+-|.-+-++-|..  -..+-.+..-    |.++.+. 
T Consensus       159 gAkggRGyFiA~s~eef~ek~erl~~~gvi~~Edlkna~IeEYv~G~~f~~~yFyS~i~~~lEl~g~D----~R~Esn~D  234 (361)
T COG1759         159 GAKGGRGYFIASSPEEFYEKAERLLKRGVITEEDLKNARIEEYVVGAPFYFHYFYSPIKDRLELLGID----RRYESNLD  234 (361)
T ss_pred             CCCCCCEEEEECCHHHHHHHHHHHHHCCCCCHHHHHHCEEEEEEECCCEEEEEEECCCCCCEEEEEEE----HHEECCCH
T ss_conf             76677437997698999999999987287653443213544775066013455202345704576300----20131621


Q ss_pred             -------------C--CC---CCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECC-EEEE
Q ss_conf             -------------4--44---434430000123443222010000089999986204-62356644544898557-0489
Q gi|254780206|r  217 -------------G--PN---TGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQ-GPYL  276 (424)
Q Consensus       217 -------------G--pn---TGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~-gp~v  276 (424)
                                   +  |.   +|-    -|+ .+-+++..++.+ .-+..++|-++. .....|.+..+-|+|++ .-+|
T Consensus       235 g~~RlPa~~ql~l~~~ptyvv~Gn----~p~-vlRESLL~~vfe-~ger~V~a~kel~~PG~iGpFcLq~i~t~dl~~vV  308 (361)
T COG1759         235 GLVRLPAKDQLELNLEPTYVVVGN----IPV-VLRESLLPKVFE-MGERFVEATKELVPPGIIGPFCLQTIVTDDLEFVV  308 (361)
T ss_pred             HHCCCCHHHHHHCCCCCEEEEECC----CCH-HHHHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCEEE
T ss_conf             211578789974589952899878----513-247777899999-99999999987459985132002001468751899


Q ss_pred             EEEEEEE-CC
Q ss_conf             9988651-47
Q gi|254780206|r  277 IEYNVRF-GD  285 (424)
Q Consensus       277 iE~N~R~-GD  285 (424)
                      -|+.+|. |+
T Consensus       309 FevS~Ri~gG  318 (361)
T COG1759         309 FEVSARIVGG  318 (361)
T ss_pred             EEEECCCCCC
T ss_conf             9975310477


No 77 
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase homolog; InterPro: IPR011758   Members of this protein family contain a region of homology to the RimK family of alpha-L-glutamate ligases (IPR004666 from INTERPRO), various members of which modify the Glu-Glu C-terminus of ribosomal protein S6, or tetrahydromethanopterin, or a form of coenzyme F420 derivative. Members of this family are found so far in various Vibrio and Pseudomonas species and some other gamma and beta Proteobacteria. The function is unknown..
Probab=98.47  E-value=5.1e-07  Score=70.71  Aligned_cols=180  Identities=19%  Similarity=0.246  Sum_probs=100.1

Q ss_pred             HCCHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHCC-CC-EEEEEECCCCCCCCCCCHHH---------------HHHH
Q ss_conf             0102357888765310111-12234401111121012-42-02563046534300023235---------------6778
Q gi|254780206|r  101 SSKSFAKKFCTKYGIPTAT-YQHFSDPMKAKQYVQNK-SM-PIVVKADGLCAGKGVVVAAT---------------VDEA  162 (424)
Q Consensus       101 ~sK~~~K~~l~~~gIPt~~-~~~~~~~~ea~~~~~~~-g~-PvVVKp~~~agGkGV~i~~~---------------~~e~  162 (424)
                      .||..||.+...+||-.|. |-+.++..|+..+=+-+ ++ -+||||.-.|||+|+.|+.+               .+|.
T Consensus        36 DDKl~TK~~A~AaGi~VPelyGVI~~q~ev~~~~~ivkdh~dFVIKPAqGsGG~GIlVit~r~~~ryr~~sG~~i~~eei  115 (320)
T TIGR02291        36 DDKLKTKILAIAAGIAVPELYGVIEIQKEVKSLDDIVKDHEDFVIKPAQGSGGDGILVITDRLDERYRKSSGALISKEEI  115 (320)
T ss_pred             CCHHHHHHHHHHCCCCCCHHCCCCCCHHHHHHHHHHHCCCCCCEEECCCCCCCCEEEEECCCCCCCEECCCCCCCCHHHH
T ss_conf             31367889987336711013010023466543466627889836726606798727997036688403541010154567


Q ss_pred             HHHHHHHH------CCCCHHHHHHHHHHCC----CCCEEEECCCCCCCCC--C---CCCCCCCCCCCCCCCCCCCCCE--
Q ss_conf             88788751------4453177788775205----7523442157763103--5---2000111356654444434430--
Q gi|254780206|r  163 TSAIDRCF------QQINSTVIIEEYLEGF----EVSFFALCDGKTAIPF--T---TARDHKRIHDGDIGPNTGGMGA--  225 (424)
Q Consensus       163 ~~~~~~~~------~~~~~~VliEefl~G~----E~Sv~~i~dG~~~~~l--~---~~~dyKr~~~~d~GpnTGGMGa--  225 (424)
                      +..+..++      +...+..|||-.+.-.    -+|...+=|=..+++.  |   ..|==-|..||--...-|..|+  
T Consensus       116 E~hvSniL~GLySLGG~~D~AliEyrvkfDp~F~~~SYeGVPDiRiIVf~GyPVmaM~RlpTr~SdGKANLHQGAvGvGi  195 (320)
T TIGR02291       116 ERHVSNILAGLYSLGGKRDRALIEYRVKFDPLFESVSYEGVPDIRIIVFKGYPVMAMLRLPTRASDGKANLHQGAVGVGI  195 (320)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCHHHHCCCCCCCCCCCCCCCCCCEEEEE
T ss_conf             78888888777650799773688532010534477111345872689641861021002765678883021246024202


Q ss_pred             -----------EE--C---CCCCCCCCCEEE----ECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC-CEEEEEEEEEEEC
Q ss_conf             -----------00--0---123443222010----0000899999862046235664454489855-7048999886514
Q gi|254780206|r  226 -----------CS--P---ALGMSQELYSTV----IQKIILPTIEGMQKEQNPFQGVLFAGLMITE-QGPYLIEYNVRFG  284 (424)
Q Consensus       226 -----------~~--p---~~~~~~~~~~~i----~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~-~gp~viE~N~R~G  284 (424)
                                 +-  |   .|-...++ +-+    =++.++-+..+...-|+.|-|   +|++|++ .||-|||.|+|.|
T Consensus       196 DlaTG~t~~a~w~n~pi~~HPDTg~~~-sglq~PhW~~ll~LAa~c~el~GLGY~G---vD~VLDke~GPlvLELNARPG  271 (320)
T TIGR02291       196 DLATGKTLRAVWLNQPIEKHPDTGKDV-SGLQVPHWEKLLKLAAECYELVGLGYLG---VDMVLDKEKGPLVLELNARPG  271 (320)
T ss_pred             ECCCCCEEEEEECCCCCCCCCCCCCCC-CCEECCCHHHHHHHHHHHHHHCCCCCCC---EEEEEECCCCCEEEEECCCCC
T ss_conf             311450321242067614583888753-5101667778999998775430676002---106874579881786447887


No 78 
>PRK06524 biotin carboxylase-like protein; Validated
Probab=98.45  E-value=4.4e-06  Score=63.93  Aligned_cols=220  Identities=14%  Similarity=0.166  Sum_probs=148.3

Q ss_pred             CHHHHHHHHHHHCCC--EEEE--CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CC
Q ss_conf             989999999871897--9999--79557874899898605880670106665552010235788876531011112--23
Q gi|254780206|r   50 NHSAIIHFCQEKHID--LVVV--GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HF  123 (424)
Q Consensus        50 d~~~i~~~a~~~~iD--lviv--gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~  123 (424)
                      ...++.++++.....  .+++  -.|.   ..+   .++.|+.++-|+++--+...||.-+-.+-.++|+|+.++.  .+
T Consensus        78 qhpEv~~~ik~rg~~gk~~fvmfdEeT---e~L---a~~lGl~v~~P~a~LR~~ldsKi~t~Rlgn~AGvpsVPnvl~~v  151 (480)
T PRK06524         78 RDPETLEFIKNRGPGGKACFVMFDEET---QAL---ARQAGLEVMHPPAELRHRLDSKIVMTRLADEAGVPSVPHVIGRV  151 (480)
T ss_pred             CCHHHHHHHHHCCCCCEEEEEEECHHH---HHH---HHHHCCCEECCHHHHHHHHCCEEEEEEECCCCCCCCCCCEEECC
T ss_conf             298999999843898758999956378---999---99709727558299997743611467521115887676300035


Q ss_pred             CCCHHHHHHHHC--CCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCC
Q ss_conf             440111112101--242025630465343000232356778887887514453177788775205752344215776310
Q gi|254780206|r  124 SDPMKAKQYVQN--KSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIP  201 (424)
Q Consensus       124 ~~~~ea~~~~~~--~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~  201 (424)
                      .+++++.+..++  +|--+||-.....+|+..+.+.++.|..++-.++.++  ..+=|=+.|.-.+..+++-.-....+.
T Consensus       152 ~sY~~L~~~~~~aglG~DLVvQt~~GdsG~tTFFi~~e~D~~k~a~eIvge--~eiKiMKRI~~~~~aiEac~T~~GTiv  229 (480)
T PRK06524        152 DSYEELSALAHEAGLGDDLVVQTAYGDAGSTTFFVRGERDWDKYAGEIVGQ--PEIKVMKRIRNVEVCIEACVTRHGTVI  229 (480)
T ss_pred             CCHHHHHHHHHHCCCCCCEEEECCCCCCCCEEEEEECHHHHHHHHHHHHCC--CHHHHHHHHCCCCCCEEEEECCCCEEE
T ss_conf             669999999887088863588425678874169972565676757764066--315344342476411112200387363


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEECCC----CCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEEC--CEEE
Q ss_conf             35200011135665444443443000012----34432220100000899999862046235664454489855--7048
Q gi|254780206|r  202 FTTARDHKRIHDGDIGPNTGGMGACSPAL----GMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE--QGPY  275 (424)
Q Consensus       202 l~~~~dyKr~~~~d~GpnTGGMGa~~p~~----~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~--~gp~  275 (424)
                      -|...+  -++-.+.-|--||   +|-..    .+++...++. ++...+.=+.|.++|  |+|++-+++.+..  +..|
T Consensus       230 gP~MTe--lvGf~ELTPykGg---WCGNei~~~~~~p~~r~ka-re~~~k~Gd~L~~eG--YrGyFevDfLiD~dt~evy  301 (480)
T PRK06524        230 GPAMTS--LVGYPELTPYRGA---WCGNDIWRGALPPAQTRAA-REMVAKLGDVLSREG--YRGYFEVDLLHDLDADELY  301 (480)
T ss_pred             CHHHHH--HCCCCCCCCCCCC---CCCCCCCCCCCCCHHHHHH-HHHHHHHHHHHHHCC--CCCEEEEEEEEECCCCCEE
T ss_conf             246775--4284116766776---4355455022891366999-999999879987445--6635899998855778475


Q ss_pred             EEEEEEEE-CC
Q ss_conf             99988651-47
Q gi|254780206|r  276 LIEYNVRF-GD  285 (424)
Q Consensus       276 viE~N~R~-GD  285 (424)
                      +=|.|.|. |-
T Consensus       302 LGElNPRisGA  312 (480)
T PRK06524        302 LGEVNPRLSGA  312 (480)
T ss_pred             EECCCCCCCCC
T ss_conf             40367644488


No 79 
>PRK12458 glutathione synthetase; Provisional
Probab=98.28  E-value=4.4e-06  Score=63.93  Aligned_cols=229  Identities=16%  Similarity=0.196  Sum_probs=131.3

Q ss_pred             CCCEEEECCCHH-----H--H----HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHH
Q ss_conf             897999979557-----8--7----4899898605880670106665552010235788876531011112234401111
Q gi|254780206|r   62 HIDLVVVGPELP-----L--V----NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAK  130 (424)
Q Consensus        62 ~iDlvivgpE~p-----L--~----~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~  130 (424)
                      ..|.|++=-+-|     |  .    .-+-+..++.|..|+ -+..+.|-...|.|+-+|.+-   -+|+.-+-+|.++++
T Consensus        85 ~~D~I~mRkDPPfD~~yln~~~yi~~~~l~~~~~~gv~VI-N~P~slR~~nEKL~~~~Fp~~---i~P~TLVT~d~~~I~  160 (349)
T PRK12458         85 GFDVLFLRNNPSLDNLARPWADSVGIIFGRLAMRDGVLVL-NDPDGLRIANNKLYFQSFPEE---VRPTTHISRNREEIR  160 (349)
T ss_pred             HCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEE-CCHHHHHCCCCHHHHHHCCCC---CCCCEEEECCHHHHH
T ss_conf             6989999489999831265999999999987650898898-185998617012006415554---798779867999999


Q ss_pred             HHHHCCCC-EEEEEECCCCCCCCCCCHHHHHH-HHHHHHHHHCCCCHHHHHHHHHHCCCC-CE-EEECCCCCCCC----C
Q ss_conf             12101242-02563046534300023235677-888788751445317778877520575-23-44215776310----3
Q gi|254780206|r  131 QYVQNKSM-PIVVKADGLCAGKGVVVAATVDE-ATSAIDRCFQQINSTVIIEEYLEGFEV-SF-FALCDGKTAIP----F  202 (424)
Q Consensus       131 ~~~~~~g~-PvVVKp~~~agGkGV~i~~~~~e-~~~~~~~~~~~~~~~VliEefl~G~E~-Sv-~~i~dG~~~~~----l  202 (424)
                      +|+++.+. .+|+||-+..||+||+.++..++ -...+-+.+.. .+.|++++||.-..- .. ..+.||+-+-.    -
T Consensus       161 ~F~~~~k~~~iIlKPL~G~GG~gIf~i~~~d~~Nl~~I~e~~~~-~~~vm~Q~flpei~~GDkRIilinGepi~~~~~~g  239 (349)
T PRK12458        161 AFLEESPSDKMILKPLQGSGGQGVFLIEKSAESNLNQILEFYSG-DGYVIAQEYIPGAEEGDVRILMLNGEPLERDGRYA  239 (349)
T ss_pred             HHHHHCCCCCEEEEECCCCCCCCEEEECCCCHHHHHHHHHHHHC-CCCEEEECCCHHCCCCCEEEEEECCEEECCCCCEE
T ss_conf             99998158838986467888876388635743419999999704-88199992100341688699999999911445413


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEE
Q ss_conf             52000111356654444434430000123443222010000089999986204623566445448985570489998865
Q gi|254780206|r  203 TTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVR  282 (424)
Q Consensus       203 ~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R  282 (424)
                      ...|-. ..+|-=..-..||.+..++   ++++     ..+|++.+...|.+.|+-|.|   +|++    |-|+.|+|+-
T Consensus       240 al~RiP-~~gd~R~Nl~~GG~~~~~~---Lt~~-----d~~I~~~i~p~L~~~gl~fvG---iDvI----G~~LtEINVT  303 (349)
T PRK12458        240 AMRRVP-AEGDVRSNIHAGGTVVKHT---LTKE-----ELELCEHIRPKLVRDGLFFVG---LDIV----GDKLIEVNVF  303 (349)
T ss_pred             EEECCC-CCCCHHHHHHCCCCCCCCC---CCHH-----HHHHHHHHHHHHHHCCCEEEE---EEEE----CCCEEEECCC
T ss_conf             565356-6761355652688630368---8999-----999999999999987998999---9861----7845688178


Q ss_pred             ECCCCCEEEEECC-CCCCHHHHHHHHHCCCCC
Q ss_conf             1477510443326-544115666542013333
Q gi|254780206|r  283 FGDPECQAMMMRL-ESDILEILNSCVHGNLHN  313 (424)
Q Consensus       283 ~GDPE~q~ilp~L-~~dl~~il~~~~~g~L~~  313 (424)
                      -  |.+..=+-.+ ..|+...+..+++.++..
T Consensus       304 S--Ptgi~ei~~~~~~~~a~~~~d~~E~~~~~  333 (349)
T PRK12458        304 S--PGGLGRINKLNNVDFSETIINAKERKVQR  333 (349)
T ss_pred             C--CHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             9--60299998751998699999999999998


No 80 
>pfam05770 Ins134_P3_kin Inositol 1, 3, 4-trisphosphate 5/6-kinase. This family consists of several inositol 1, 3, 4-trisphosphate 5/6-kinase proteins. Inositol 1,3,4-trisphosphate is at a branch point in inositol phosphate metabolism. It is dephosphorylated by specific phosphatases to either inositol 3,4-bisphosphate or inositol 1,3-bisphosphate. Alternatively, it is phosphorylated to inositol 1,3,4,6-tetrakisphosphate or inositol 1,3,4,5-tetrakisphosphate by inositol trisphosphate 5/6-kinase.
Probab=97.84  E-value=0.0002  Score=51.91  Aligned_cols=231  Identities=13%  Similarity=0.242  Sum_probs=122.0

Q ss_pred             HHHHHHHHHHCCCEEEECCCHHHHH-H-----------------HHHHHHHC-CCCEEECCHHHHHHHHCCHHHHHHHHH
Q ss_conf             9999999871897999979557874-8-----------------99898605-880670106665552010235788876
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPELPLVN-G-----------------ISDALNAA-GFKVFGPSQRAAKLESSKSFAKKFCTK  112 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE~pL~~-g-----------------i~d~l~~~-gi~v~Gp~~~aa~le~sK~~~K~~l~~  112 (424)
                      .++..+|++.+|+++-+-++.||.. |                 +-++.+++ ++.++-|.....+| .|+..|-+.+.+
T Consensus        25 ~~f~~~~~~~gi~~v~ID~~~pL~~QGPfDvilHKltd~~~~~~l~~y~~~hP~v~viDP~~ai~~L-~dR~~m~~~v~~  103 (307)
T pfam05770        25 PSLAELARKRGIDLVQLDPSRPLSEQGPFDIIIHKLTDKEWRHRLEEFREAHPEVPVLDPPPAIRRL-HNRQSMLQVVAD  103 (307)
T ss_pred             HHHHHHHHHCCCEEEECCCCCCHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEECCHHHHHHH-HCHHHHHHHHHH
T ss_conf             9999989767967998789998455498269999656289999999999978997897799999998-789999999998


Q ss_pred             HH-------HHCCCCCCCC-CCHHHHHHHH--CCCCEEEEEE---CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             53-------1011112234-4011111210--1242025630---46534300023235677888788751445317778
Q gi|254780206|r  113 YG-------IPTATYQHFS-DPMKAKQYVQ--NKSMPIVVKA---DGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII  179 (424)
Q Consensus       113 ~g-------IPt~~~~~~~-~~~ea~~~~~--~~g~PvVVKp---~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~Vli  179 (424)
                      .+       +-+|++-.+. +.++..+.+.  .+.||+|.||   +|.+.+.-+.++.+.+.+.+        -.-+.++
T Consensus       104 l~~~~~~~~v~~P~~v~i~~d~~~~~~~l~~agL~fPlI~KPlvA~Gsa~SH~Malvf~~~gL~~--------L~pP~Vl  175 (307)
T pfam05770       104 LNLSMEDGRFGVPPQVVVMKDASSLSRAGAKAGLTFPLIAKPLVADGTAKSHEMSLVYDQEGLNK--------LQPPLVL  175 (307)
T ss_pred             HCCCCCCCEEECCCEEEECCCHHHHHHHHHHCCCCCCEEECCHHCCCCCCCCEEEEEECHHHHHC--------CCCCEEE
T ss_conf             10656798383697799728677889999975986765623300257856534789977757622--------7997588


Q ss_pred             HHHHH--CCCCCEEEECCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCE--EECCC---CCCC-----CCCEEEECCHH
Q ss_conf             87752--057523442157763103--52000111356654444434430--00012---3443-----22201000008
Q gi|254780206|r  180 EEYLE--GFEVSFFALCDGKTAIPF--TTARDHKRIHDGDIGPNTGGMGA--CSPAL---GMSQ-----ELYSTVIQKII  245 (424)
Q Consensus       180 Eefl~--G~E~Sv~~i~dG~~~~~l--~~~~dyKr~~~~d~GpnTGGMGa--~~p~~---~~~~-----~~~~~i~~~i~  245 (424)
                      +||+.  |.=+-+.++  |+++...  +...|   ...++..-.+|-+-.  +|..+   ....     ...+.--...+
T Consensus       176 QefvNH~gvlfKvyVv--Gd~~~vv~R~Slpn---~~~~~~~~~~~~~~f~~vS~~~~~~~~~~~~~~~~~~~~p~~~~~  250 (307)
T pfam05770       176 QEFVNHGGVLFKVYVV--GEHVTVVKRRSLPD---VSAGTLDRSSGSFRFSQVSNLTASADDAELDKILEIAEMPPDPFL  250 (307)
T ss_pred             EEEECCCCEEEEEEEE--CCEEEEEECCCCCC---CCCCCCCCCCCCEECCCCCCCCCCCCHHHCCCCCCCCCCCCHHHH
T ss_conf             9875478679999996--43789996467778---773323465641331004677788622321356520239998999


Q ss_pred             HHHHHHHHHC-CCEEEEEEEEEEEEECC---EEEEEEEEEEECCCCCEEEEECCCCCCHHHH
Q ss_conf             9999986204-62356644544898557---0489998865147751044332654411566
Q gi|254780206|r  246 LPTIEGMQKE-QNPFQGVLFAGLMITEQ---GPYLIEYNVRFGDPECQAMMMRLESDILEIL  303 (424)
Q Consensus       246 ~~~~~~l~~~-~~~y~G~l~~~~m~t~~---gp~viE~N~R~GDPE~q~ilp~L~~dl~~il  303 (424)
                      +...++|++. |+.--   .++++..+.   .-+||.+|-=.|.=    =||-.++.|.+.+
T Consensus       251 ~~la~~LR~~lgL~LF---gfDvI~~~~t~~r~~VIDINyFPgY~----~vP~~e~~l~df~  305 (307)
T pfam05770       251 EDLARALRRALGLRLF---NFDIIRDAGTADRYLVIDINYFPGYA----KMPEYETVLTDFF  305 (307)
T ss_pred             HHHHHHHHHHCCCEEE---CEEEEEECCCCCEEEEEEECCCCCCC----CCCCHHHHHHHHH
T ss_conf             9999999998099496---64899988989858999906798988----8887299999984


No 81 
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=97.80  E-value=0.00048  Score=49.22  Aligned_cols=109  Identities=23%  Similarity=0.244  Sum_probs=76.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH-HHC-------CEEEECCCCCHHHHHHHHHHHCCCEEEECCCH
Q ss_conf             9589988658899999999858996789995498357-511-------70551287898999999987189799997955
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI-AQH-------AQCVAIDIQNHSAIIHFCQEKHIDLVVVGPEL   72 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~-~~~-------~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~   72 (424)
                      |||||||+|+--+++||+|.++.. .+|+++.-++.- ..+       .+...+|..|.+++.++.++.  |+||-.---
T Consensus         2 ~~ilviGaG~Vg~~va~~la~~~d-~~V~iAdRs~~~~~~i~~~~~~~v~~~~vD~~d~~al~~li~~~--d~VIn~~p~   78 (389)
T COG1748           2 MKILVIGAGGVGSVVAHKLAQNGD-GEVTIADRSKEKCARIAELIGGKVEALQVDAADVDALVALIKDF--DLVINAAPP   78 (389)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCC-CEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCC--CEEEEECCC
T ss_conf             728998986667999999985789-62999848888999987533466316994256758899987257--789992870


Q ss_pred             HHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             78748998986058806701066655520102357888765310
Q gi|254780206|r   73 PLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        73 pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP  116 (424)
                      ++...+.+++-+.|+.++=.+..    +-+....++.++++|+-
T Consensus        79 ~~~~~i~ka~i~~gv~yvDts~~----~~~~~~~~~~a~~Agit  118 (389)
T COG1748          79 FVDLTILKACIKTGVDYVDTSYY----EEPPWKLDEEAKKAGIT  118 (389)
T ss_pred             HHHHHHHHHHHHHCCCEEECCCC----CCHHHHHHHHHHHCCCE
T ss_conf             54299999999859988975467----75065654898874907


No 82 
>pfam00289 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N-terminal domain. Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. This important enzyme initiates both the urea cycle and the biosynthesis of arginine and/or pyrimidines. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain. The small chain promotes the hydrolysis of glutamine to ammonia, which is used by the large chain to synthesize carbamoyl phosphate. See pfam00988. The small chain has a GATase domain in the carboxyl terminus. See pfam00117.
Probab=97.39  E-value=0.0021  Score=44.64  Aligned_cols=90  Identities=20%  Similarity=0.285  Sum_probs=61.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH----HCCEE-EEC-------CCCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             5899886588999999998589967899954983575----11705-512-------87898999999987189799997
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA----QHAQC-VAI-------DIQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~-~~i-------~~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      ||||++.|--.--+++++++-. +..|.+. -||-+.    ..++. +.+       ...|.+.|++.|+++++|.+++|
T Consensus         3 kvLIanrGeiA~ri~rt~re~g-i~~v~i~-s~~d~~s~~~~~ad~~~~~~~~~~~~~Yl~~~~Ii~ia~~~~~~aihpG   80 (109)
T pfam00289         3 KVLVANRGEIAVRIIRALRELG-IETVAVN-SNPDTVSTHVRLADEAYFLGPGPASESYLNIERILDIAEKEGADAIHPG   80 (109)
T ss_pred             EEEEECCCHHHHHHHHHHHHCC-CCEEEEE-CHHHCCCHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCEEECC
T ss_conf             8999888799999999999869-9799996-3344152256650576534799832111379999999998188968779


Q ss_pred             ----CCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             ----955787489989860588067010666
Q gi|254780206|r   70 ----PELPLVNGISDALNAAGFKVFGPSQRA   96 (424)
Q Consensus        70 ----pE~pL~~gi~d~l~~~gi~v~Gp~~~a   96 (424)
                          +|.+   .+++.+++.|+.++||+.++
T Consensus        81 yGflsEn~---~fa~~~~~~Gi~fiGPs~~~  108 (109)
T pfam00289        81 YGFLSENA---EFAEACEKAGITFIGPSPEA  108 (109)
T ss_pred             CCCCCCCH---HHHHHHHHCCCEEECCCHHH
T ss_conf             76233599---99999998889899958354


No 83 
>pfam02571 CbiJ Precorrin-6x reductase CbiJ/CobK. This family consists of Precorrin-6x reductase EC:1.3.1.54. This enzyme catalyses the reaction: precorrin-6Y + NADP(+) <= precorrin-6X + NADPH. CbiJ and CobK both catalyse the reduction of macocycle in the colbalmin biosynthesis pathway.
Probab=97.08  E-value=0.012  Score=39.24  Aligned_cols=119  Identities=18%  Similarity=0.251  Sum_probs=66.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH--CCEE--EEC-CCCCHHHHHHHHHHHCCCEEEECCCHHH-
Q ss_conf             958998865889999999985899678999549835751--1705--512-8789899999998718979999795578-
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQC--VAI-DIQNHSAIIHFCQEKHIDLVVVGPELPL-   74 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~--~~~~--~~i-~~~d~~~i~~~a~~~~iDlvivgpE~pL-   74 (424)
                      |||||+|+=+=-+.|+..|.+...+ .++.  .-++-..  ...+  +.. ...|.+.+.+|+++++|++||=.. -|. 
T Consensus         1 ~~IlilgGT~e~r~la~~L~~~g~~-~v~t--~~~~~~~~~~~~~~~~~~G~l~~~~~m~~~i~~~~i~~vIDAT-HPfA   76 (246)
T pfam02571         1 MRILILGGTTEARALAAALAAAGVV-SVVT--SLAGRTAAPRLPPLPVRVGGFGGADGLAAYLREEGIDAVIDAT-HPFA   76 (246)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCE-EEEE--CCCHHHCCCCCCCCCEEECCCCCHHHHHHHHHHCCCCEEEECC-CCCH
T ss_conf             9699997368999999999856987-9998--4755443766788508979989999999999977997999899-9968


Q ss_pred             ---HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCC
Q ss_conf             ---7489989860588067010666555201023578887653101111223440111112101242
Q gi|254780206|r   75 ---VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSM  138 (424)
Q Consensus        75 ---~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~  138 (424)
                         ..-..++.++.|||++       |+|      |.-.  .--|...+..++|.++|.+++.+.+.
T Consensus        77 ~~is~na~~a~~~~~ipyi-------R~e------Rp~~--~~~~~d~~~~v~s~~ea~~~l~~~~~  128 (246)
T pfam02571        77 AQISRNAAAACKELGVPLL-------RLE------RPAW--QPGPGDRWIYVDSLAEAAAALAELPG  128 (246)
T ss_pred             HHHHHHHHHHHHHHCCCEE-------EEC------CCCC--CCCCCCCEEEECCHHHHHHHHHHCCC
T ss_conf             9999999999998599689-------960------6212--67889877997999999998764678


No 84 
>TIGR01380 glut_syn glutathione synthase; InterPro: IPR006284   These are the glutathione synthetases found in Gram-negative bacteria. This gene does not appear to be present in genomes of Gram-positive bacteria. Glutathione synthetase has an ATP-binding domain in the COOH terminus and catalyzes the second step in the glutathione biosynthesis pathway: ATP + gamma-L-glutamyl-L-cysteine + glycine = ADP + phosphate + glutathione. Glutathione is a tripeptide that functions as a reductant in many cellular reactions. ; GO: 0004363 glutathione synthase activity, 0006750 glutathione biosynthetic process.
Probab=97.06  E-value=0.00039  Score=49.89  Aligned_cols=227  Identities=23%  Similarity=0.346  Sum_probs=126.8

Q ss_pred             HHHHHHHHHH-----H-CCCEEEECCCHH-----H-HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             8999999987-----1-897999979557-----8-74899898605880670106665552010235788876531011
Q gi|254780206|r   51 HSAIIHFCQE-----K-HIDLVVVGPELP-----L-VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA  118 (424)
Q Consensus        51 ~~~i~~~a~~-----~-~iDlvivgpE~p-----L-~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~  118 (424)
                      ...=.++.++     . +.|.|+.=-+-|     | +.-+=+.++..|+.|+ -+..+.|=.-=|.|+-.| .+.   +|
T Consensus        71 ~~~w~~~~~~~~~~L~d~~d~vlMRkDPPf~~~Y~yaT~lLe~~~~~g~~vi-N~P~~lRd~NEKl~~~~F-p~~---~p  145 (322)
T TIGR01380        71 KQDWYTLGEKVRLALKDELDVVLMRKDPPFDMEYIYATYLLELAEPTGTLVI-NSPQGLRDANEKLFALQF-PKV---IP  145 (322)
T ss_pred             CHHHHHHHHHHHHCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEE-ECCCHHHCCCHHHHHHCC-CCC---CC
T ss_conf             1278887665420113574299984750986315446778877842796798-488232246603454334-123---58


Q ss_pred             CCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHH-HHHHHHHHHHCCCCHHHHHHHHHHCCCCCE----EEE
Q ss_conf             112234401111121012420256304653430002323567-788878875144531777887752057523----442
Q gi|254780206|r  119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVD-EATSAIDRCFQQINSTVIIEEYLEGFEVSF----FAL  193 (424)
Q Consensus       119 ~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~-e~~~~~~~~~~~~~~~VliEefl~G~E~Sv----~~i  193 (424)
                      +--+-++..+...|+++++ -+|+||=+..||.||......+ .+-.-++.........|++++||+  |++-    ..+
T Consensus       146 pTLvt~~~~~ir~F~~e~~-divLKPL~g~GG~gi~Rl~~~DpN~~~i~E~~~~~g~~~~~aQ~ylp--ei~~GDKRilL  222 (322)
T TIGR01380       146 PTLVTRDKAEIRAFLAEHG-DIVLKPLDGMGGEGIFRLDPGDPNLNSILETLTQLGREPVMAQRYLP--EIKEGDKRILL  222 (322)
T ss_pred             CCCEECCHHHHHHHHHHHH-CEEECCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCEEEEEECHH--HHHHCCCEEEE
T ss_conf             8501067799999998751-25872666777843676178998556898887652671687650205--76617965999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEE
Q ss_conf             1577631035200011135665---4444434430000123443222010000089999986204623566445448985
Q gi|254780206|r  194 CDGKTAIPFTTARDHKRIHDGD---IGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT  270 (424)
Q Consensus       194 ~dG~~~~~l~~~~dyKr~~~~d---~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t  270 (424)
                      .||+   |.+.|.  -|+=.++   ..--.||-|.-.|   +++.. .+| .+.+.|.   |++.     |.+++|+  +
T Consensus       223 ~~G~---Pig~a~--~Rip~~gE~RgNlavGG~~~a~~---L~~rD-~eI-c~~~~P~---L~~r-----Gl~fvGi--D  282 (322)
T TIGR01380       223 IDGE---PIGYAV--ARIPAGGEFRGNLAVGGRGEAQE---LSERD-REI-CATVAPE---LKRR-----GLLFVGI--D  282 (322)
T ss_pred             ECCE---ECCCCE--EECCCCCCCCHHHCCCCEEEECC---CCHHH-HHH-HHHHCCC---CCCC-----CEEEEEE--E
T ss_conf             7883---500101--40278875000200288622002---66789-999-9871610---0207-----7479754--6


Q ss_pred             CCEEEEEEEEEEECCCCCEEEEECCCC-CCHHHHHHHH
Q ss_conf             570489998865147751044332654-4115666542
Q gi|254780206|r  271 EQGPYLIEYNVRFGDPECQAMMMRLES-DILEILNSCV  307 (424)
Q Consensus       271 ~~gp~viE~N~R~GDPE~q~ilp~L~~-dl~~il~~~~  307 (424)
                      ==|=|+.|+|+--  |.|-.=+.++++ ++.+.+.+.+
T Consensus       283 VIG~~LTEvNVTS--PTGi~Ei~~~~G~~~~~~~~d~~  318 (322)
T TIGR01380       283 VIGGYLTEVNVTS--PTGIREIDRQKGVNIAEQLIDAI  318 (322)
T ss_pred             EECCCCEEEECCC--CHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             7778007983146--45689887635855899999998


No 85 
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
Probab=96.95  E-value=0.0056  Score=41.52  Aligned_cols=111  Identities=23%  Similarity=0.286  Sum_probs=63.1

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHC-CCCCEEEEECCCHHHHH-CCEEEECC-CCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             958998865--8899999999858-99678999549835751-17055128-7898999999987189799997955787
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQS-PLLSELWSIPGNPGIAQ-HAQCVAID-IQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s-~~~~~v~~~pgN~g~~~-~~~~~~i~-~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      |||.|||.|  |+.|+..  +.++ +...-+.++.-|+.... ..+...+. ..|.+   ++.+..++|+|++.....+-
T Consensus         1 iki~iiG~G~~g~~~~~~--~~~~~~~~~i~ai~d~~~~~~~~~~~~~~~~~~~~~~---~~l~~~~iD~v~I~tp~~~H   75 (120)
T pfam01408         1 LRVGIVGAGKIGRRHLRA--LNESQDGAELVGVLDPDPARAEAVAESFGVPAYSDLE---ELLADPDVDAVSVATPPGLH   75 (120)
T ss_pred             CEEEEEECHHHHHHHHHH--HHHCCCCCEEEEEECCCHHHHHHHHHHHCCCEECCHH---HHHHCCCCCEEEECCCHHHH
T ss_conf             989999077999999999--9855999789999829999999999983996788699---99737788989990874618


Q ss_pred             HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             489989860588067010666555201023578887653101
Q gi|254780206|r   76 NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT  117 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt  117 (424)
                      ..++..+-+.|.++|.-..-+.-++.-+.. .+..+++|++.
T Consensus        76 ~~~~~~~l~~g~~v~~EKP~~~~~~e~~~l-~~~a~~~~~~~  116 (120)
T pfam01408        76 FELALAALEAGKHVLVEKPLATTVEEAKEL-VELAEKKGVRL  116 (120)
T ss_pred             HHHHHHHHHHCCEEEEECCCCCCHHHHHHH-HHHHHHCCCEE
T ss_conf             999999998199899968981999999999-99999829969


No 86 
>COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism]
Probab=96.84  E-value=0.025  Score=36.87  Aligned_cols=120  Identities=23%  Similarity=0.297  Sum_probs=75.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH--HHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             9589988658899999999858996789995498357--51170551287898999999987189799997955787489
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI--AQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~--~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      |+|||+|+-+-.-+|+.+|...+....+..+-|-.+.  .+....+.--..+.+.+.+|.++++||++|=.. -|.++-+
T Consensus         3 ~~ilvlGGT~Dar~la~~L~~~~~~~~~ss~t~~g~~l~~~~~~~~~~G~l~~e~l~~~l~e~~i~llIDAT-HPyAa~i   81 (257)
T COG2099           3 MRILLLGGTSDARALAKKLAAAPVDIILSSLTGYGAKLAEQIGPVRVGGFLGAEGLAAFLREEGIDLLIDAT-HPYAARI   81 (257)
T ss_pred             CEEEEEECCHHHHHHHHHHHCCCCCEEEEECCCCCCCCHHCCCCEEECCCCCHHHHHHHHHHCCCCEEEECC-CHHHHHH
T ss_conf             359998263899999998620686179997034442411105886652768878999999974988899788-7579999


Q ss_pred             ----HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             ----98986058806701066655520102357888765310111122344011111210124
Q gi|254780206|r   79 ----SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKS  137 (424)
Q Consensus        79 ----~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g  137 (424)
                          +...++.|||++       ++|      |--....   -.++..+.|.+||.+.+.+.+
T Consensus        82 S~Na~~aake~gipy~-------r~e------RP~~~~~---gd~~~~V~d~~ea~~~~~~~~  128 (257)
T COG2099          82 SQNAARAAKETGIPYL-------RLE------RPPWAPN---GDNWIEVADIEEAAEAAKQLG  128 (257)
T ss_pred             HHHHHHHHHHHCCCEE-------EEE------CCCCCCC---CCCEEEECCHHHHHHHHHCCC
T ss_conf             8999999998599679-------987------7755457---996698458999999875047


No 87 
>KOG2799 consensus
Probab=96.80  E-value=0.00033  Score=50.44  Aligned_cols=102  Identities=25%  Similarity=0.252  Sum_probs=75.6

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCC-EEEEEECCCCCCC-----------CCCCHHHHHHHHHHHHHHHCC
Q ss_conf             3578887653101111223440111112101242-0256304653430-----------002323567788878875144
Q gi|254780206|r  105 FAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSM-PIVVKADGLCAGK-----------GVVVAATVDEATSAIDRCFQQ  172 (424)
Q Consensus       105 ~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~-PvVVKp~~~agGk-----------GV~i~~~~~e~~~~~~~~~~~  172 (424)
                      ..-++|.++|+.+|.+..+.|.|||.+.++.++- -+|||+--+||||           ||.++.+.+|+++....+.+.
T Consensus        29 ~~~~ll~~~Gv~vp~g~vA~speEA~~~akklg~kdlVikAQ~lAgGRgKGtF~SglkgGV~iVf~p~Eak~va~qmiG~  108 (434)
T KOG2799          29 RSAALLRKYGINVPLGYVAKSPEEAFAIAKKLGSKDLVIKAQVLAGGRGKGTFDSGLKGGVKIVFSPQEAKAVASQMIGK  108 (434)
T ss_pred             HHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHCC
T ss_conf             89999997187888775568878999999970886459975201057666773767678637976758888889976340


Q ss_pred             ---------C---CHHHHHHHHHHC-CCCCEEEECCCCCCCCCCCCC
Q ss_conf             ---------5---317778877520-575234421577631035200
Q gi|254780206|r  173 ---------I---NSTVIIEEYLEG-FEVSFFALCDGKTAIPFTTAR  206 (424)
Q Consensus       173 ---------~---~~~VliEefl~G-~E~Sv~~i~dG~~~~~l~~~~  206 (424)
                               +   ...|.|=|...+ .|+++..+.|.++--||.++.
T Consensus       109 kLiTKQtG~~gk~c~~v~iC~Rk~~~~e~yFsil~dr~~k~pliIas  155 (434)
T KOG2799         109 KLITKQTGPAGKACSEVYICERKHTRAEYYFSILMDRHTKGPLIIAS  155 (434)
T ss_pred             EEEEECCCCCCCCCCEEEEEEECCHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             20433347888843069985101305678899987304579779982


No 88 
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane]
Probab=96.44  E-value=0.027  Score=36.60  Aligned_cols=135  Identities=16%  Similarity=0.254  Sum_probs=66.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-CCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEEC--------CC
Q ss_conf             958998865889999999985899-678999549835751170551287898999999987189799997--------95
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPL-LSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVG--------PE   71 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~-~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivg--------pE   71 (424)
                      |||||.|++|.   |.|.|.+.-. ..+|+...          +..+|+.|.+.+.++.++.+||.||-.        .|
T Consensus         1 M~iLi~G~~Gq---LG~~L~~~l~~~~~v~a~~----------~~~~Ditd~~~v~~~i~~~~PDvVIn~AAyt~vD~aE   67 (281)
T COG1091           1 MKILITGANGQ---LGTELRRALPGEFEVIATD----------RAELDITDPDAVLEVIRETRPDVVINAAAYTAVDKAE   67 (281)
T ss_pred             CCEEEECCCCH---HHHHHHHHHCCCCEEEECC----------CCCCCCCCHHHHHHHHHHHCCCEEEECCCCCCCCCCC
T ss_conf             95899769876---7999999717784399515----------7655556858999999861999899873203654133


Q ss_pred             H-HH----H-----HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCC-CCEE
Q ss_conf             5-78----7-----4899898605880670106665552010235788876531011112234401111121012-4202
Q gi|254780206|r   72 L-PL----V-----NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNK-SMPI  140 (424)
Q Consensus        72 ~-pL----~-----~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~-g~Pv  140 (424)
                      . |-    +     .-++.+..+.|.+.+-.|.+.. .-++|   ..-.++...|.|-...=.++-..+.++.+. ..-+
T Consensus        68 ~~~e~A~~vNa~~~~~lA~aa~~~ga~lVhiSTDyV-FDG~~---~~~Y~E~D~~~P~nvYG~sKl~GE~~v~~~~~~~~  143 (281)
T COG1091          68 SEPELAFAVNATGAENLARAAAEVGARLVHISTDYV-FDGEK---GGPYKETDTPNPLNVYGRSKLAGEEAVRAAGPRHL  143 (281)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCEE-ECCCC---CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             898997776779999999999971976999634457-43898---98887789999702454778978999997399879


Q ss_pred             EEEECCCCCCCC
Q ss_conf             563046534300
Q gi|254780206|r  141 VVKADGLCAGKG  152 (424)
Q Consensus       141 VVKp~~~agGkG  152 (424)
                      |++.+.+.+..|
T Consensus       144 I~Rtswv~g~~g  155 (281)
T COG1091         144 ILRTSWVYGEYG  155 (281)
T ss_pred             EEEEEEEECCCC
T ss_conf             998565545888


No 89 
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional
Probab=96.32  E-value=0.015  Score=38.40  Aligned_cols=59  Identities=20%  Similarity=0.238  Sum_probs=38.4

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             958998865889-99999998589967899954983575117055128789899999998718979999
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      |||||+|+.|.= ++|...|.....   +.+.+-+ ..     ....|.+|.+.+.++..+++||.||=
T Consensus         1 MkILvtGa~GqLG~~l~~~l~~~~~---~~~~~~~-~~-----~~~~Dit~~~~v~~~~~~~~Pd~IIN   60 (299)
T PRK09987          1 MNILLFGKTGQVGWELQRALAPLGN---LIALDVH-ST-----DYCGDFSNPEGVAETVRKIRPDVIVN   60 (299)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC---EEEEECC-CC-----CCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             9799989999789999998665098---8998526-30-----01367899999999999659999998


No 90 
>CHL00194 ycf39 Ycf39; Provisional
Probab=96.23  E-value=0.13  Score=31.67  Aligned_cols=112  Identities=21%  Similarity=0.163  Sum_probs=64.6

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEECCCHHHHH-----CCEEEECCCCCHHHHHHHHHHHCCCEEEE-C---C
Q ss_conf             958998865889-999999985899678999549835751-----17055128789899999998718979999-7---9
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSIPGNPGIAQ-----HAQCVAIDIQNHSAIIHFCQEKHIDLVVV-G---P   70 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~pgN~g~~~-----~~~~~~i~~~d~~~i~~~a~~~~iDlviv-g---p   70 (424)
                      |+|||+|.-|.= .+++.+|.+.+.  .|-|+--||.-+.     .++.+..|..|.+.+....  ..+|.||- +   |
T Consensus         1 M~ILV~GATG~lGr~vVr~Ll~~G~--~Vr~lvRnp~ka~~l~~~Gve~v~gDl~dpesl~~Al--~GvdaVi~~~~~~~   76 (319)
T CHL00194          1 MSLLVIGATGTLGRQIVRRALDEGY--QVKCLVRNLRKAAFLKEWGAELVYGDLSLPETIPPAL--EGITAIIDASTSRP   76 (319)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--CEEEEECCHHHHHHHHHCCCEEEEECCCCHHHHHHHH--CCCCEEEEECCCCC
T ss_conf             9799989985899999999996889--0899957867632342159679994278877899996--59967999456677


Q ss_pred             CHHH---------HHHHHHHHHHCCCCEE------ECCHH-HHHHHHCCHHHHHHHHHHHHH
Q ss_conf             5578---------7489989860588067------01066-655520102357888765310
Q gi|254780206|r   71 ELPL---------VNGISDALNAAGFKVF------GPSQR-AAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        71 E~pL---------~~gi~d~l~~~gi~v~------Gp~~~-aa~le~sK~~~K~~l~~~gIP  116 (424)
                      ..+.         ...+.++.+++|++-|      |..+. ...+...|.-.-+.+++.|+|
T Consensus        77 ~~~~~~~~vd~~g~~~li~AAk~aGVkr~V~lS~lga~~~~~~p~~~~K~~~E~~L~~Sgl~  138 (319)
T CHL00194         77 SDLNNAYQIDLEGKLALIEAAKAAKVKRFIFFSILNAEQYPQVPLMKIKSDIEEKLKQSGIN  138 (319)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             88620889889889999999998499889996135666688756778799999999867998


No 91 
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]
Probab=96.17  E-value=0.063  Score=33.92  Aligned_cols=142  Identities=20%  Similarity=0.181  Sum_probs=85.4

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCC-CCEEEEECCCHHHH-HCCEEEECC--CCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             958998865889-999999985899-67899954983575-117055128--7898999999987189799997955787
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPL-LSELWSIPGNPGIA-QHAQCVAID--IQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~-~~~v~~~pgN~g~~-~~~~~~~i~--~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      |||.|||.|+.- .+....+++.+. ..-+.++.-|+..+ ..++...+.  ..|.+++   .....||+|+|.....+=
T Consensus         4 irvgiiG~G~~~~~~~~~~~~~~~~~~~~vav~d~~~~~a~~~a~~~~~~~~~~~~~~l---l~~~~iD~V~Iatp~~~H   80 (342)
T COG0673           4 IRVGIIGAGGIAGKAHLPALAALGGGLELVAVVDRDPERAEAFAEEFGIAKAYTDLEEL---LADPDIDAVYIATPNALH   80 (342)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHCCCCCCCCCHHHH---HCCCCCCEEEEECCCHHH
T ss_conf             27999898767888889999738874699999649989999999981997452999999---459999889996980677


Q ss_pred             HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCC---CCCCCCHHHHHHHH--CCCCEEEEEECC
Q ss_conf             489989860588067010666555201023578887653101111---22344011111210--124202563046
Q gi|254780206|r   76 NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY---QHFSDPMKAKQYVQ--NKSMPIVVKADG  146 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~---~~~~~~~ea~~~~~--~~g~PvVVKp~~  146 (424)
                      ..++-..-++|..||+=..-+.-++.-+.. .++.+++|+...-.   +.......+++.++  .+|.+..++...
T Consensus        81 ~~~a~~AL~aGkhVl~EKPla~t~~ea~~l-~~~a~~~g~~l~v~~~~Rf~p~~~~~k~li~~g~iG~i~~~~~~~  155 (342)
T COG0673          81 AELALAALEAGKHVLCEKPLALTLEEAEEL-VELARKAGVKLMVGFNRRFDPAVQALKELIDSGALGEVVSVQASF  155 (342)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCCHHHHHHH-HHHHHHCCCEEEEEEHHHCCHHHHHHHHHHHCCCCCCEEEEEEEE
T ss_conf             999999997799699928998999999999-999997599499988465498999999998659874159999971


No 92 
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913    dTDP-4-dehydrorhamnose reductase (1.1.1.133 from EC) catalyzes the last of 4 steps in making dTDP-rhamnose, a precursor of LPS molecules such as core antigen and O-antigen.  dTDP-6-deoxy-L-mannose + NADP+ = dTDP-4-dehydro-6-deoxy-L-mannose + NADPH  ; GO: 0008831 dTDP-4-dehydrorhamnose reductase activity, 0045226 extracellular polysaccharide biosynthetic process.
Probab=96.02  E-value=0.015  Score=38.52  Aligned_cols=62  Identities=21%  Similarity=0.370  Sum_probs=44.6

Q ss_pred             EEEEECCCH---HHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             589988658---899999999858996789995498357511705512878989999999871897999
Q gi|254780206|r    2 RVLLIGSGG---REHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         2 kILviGsGg---rEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      ||||+|++|   ||  |...|.+..  ..+.|..-+.-.....+|+.+|+.|.+.+.+..++.+||.||
T Consensus         1 rilitGa~GQlG~~--L~~~l~~~g--~~~~~~~~~~~~~~~~~~~~~Dl~dP~~l~~~~r~~~Pd~vv   65 (317)
T TIGR01214         1 RILITGANGQLGRE--LVQQLSKPG--RVVVALTRSTRLKLAARWSQLDLTDPEALEELLRAIRPDAVV   65 (317)
T ss_pred             CEEEECCCCHHHHH--HHHHCCCCC--CEEEEECCCCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCEEE
T ss_conf             97887387567999--999707888--278643687776113365440622468899999852875376


No 93 
>pfam03133 TTL Tubulin-tyrosine ligase family. Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL). The true physiological function of TTL has so far not been established. Tubulin-tyrosine ligase (TTL) catalyses the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness. On the other hand, 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypep
Probab=95.90  E-value=0.0098  Score=39.76  Aligned_cols=41  Identities=17%  Similarity=0.472  Sum_probs=31.4

Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             20256304653430002323567788878875144531777887752
Q gi|254780206|r  138 MPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLE  184 (424)
Q Consensus       138 ~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~  184 (424)
                      --.++||+..+.|+|+.+..+.++......      .++.||++||+
T Consensus        67 ~~wI~KP~~~~~G~GI~l~~~~~~i~~~~~------~~~~VvQkYI~  107 (291)
T pfam03133        67 NTWIVKPSASARGRGIRITNDLSQILKQIQ------SRPLVVQKYIE  107 (291)
T ss_pred             CEEEEEECCCCCCCCEEEECCHHHHHHHHC------CCCEEEEECCC
T ss_conf             769991177689899698379999766523------79889752057


No 94 
>PRK11579 putative oxidoreductase; Provisional
Probab=95.73  E-value=0.16  Score=30.93  Aligned_cols=137  Identities=19%  Similarity=0.211  Sum_probs=77.0

Q ss_pred             CEEEEECCC--HHH-HHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEEC-CCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             958998865--889-9999999858996789995498357511705512-878989999999871897999979557874
Q gi|254780206|r    1 MRVLLIGSG--GRE-HALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAI-DIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         1 MkILviGsG--grE-hAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i-~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      |||.|||-|  |+. |+  ..+.+.+.+.-+.++..|+.-.. ++...+ -..|.+++   ..+..||.|+|.....+-.
T Consensus         5 irvgiiG~G~~~~~~h~--~~~~~~~~~~l~av~d~~~~~~~-a~~~~~~~~~~~~~l---l~~~~id~V~i~tp~~~H~   78 (346)
T PRK11579          5 IRVGLIGYGYASKTFHA--PLIAGTPGLELAAVSSSDETKVK-ADWPTVTVVSEPKHL---FNDPNIDLIVIPTPNDTHF   78 (346)
T ss_pred             CEEEEECCCHHHHHHHH--HHHHCCCCEEEEEEECCCHHHHH-CCCCCCCEECCHHHH---HCCCCCCEEEECCCCHHHH
T ss_conf             75999936299999999--99962999199999798999995-025899538999999---4599999999979967899


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC--CC-CCCHHHHHHHH--CCCCEEEEEE
Q ss_conf             899898605880670106665552010235788876531011112--23-44011111210--1242025630
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ--HF-SDPMKAKQYVQ--NKSMPIVVKA  144 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~--~~-~~~~ea~~~~~--~~g~PvVVKp  144 (424)
                      -++-..-++|..||.=..-+.-++.-+.. -+..++.|++..-+.  .| .....+++.++  .+|-+.-+..
T Consensus        79 ~~~~~al~aGkhv~~EKP~a~~~~~a~~l-~~~a~~~g~~l~v~~~~R~~~~~~~~~~~i~~G~lG~i~~~~~  150 (346)
T PRK11579         79 PLAKAALEAGKHVVVDKPFTVTLSQAREL-DALAKSLGRVLSVFHNRRWDSDFLTLKGLLAEGVLGEVAYFES  150 (346)
T ss_pred             HHHHHHHHCCCCEEECCCCCCCHHHHHHH-HHHHHHCCCEEEEEEEECCCHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             99999998799489538767879999999-9999872967999655318989999877875799785389998


No 95 
>PRK08057 cobalt-precorrin-6x reductase; Reviewed
Probab=95.66  E-value=0.22  Score=29.94  Aligned_cols=120  Identities=21%  Similarity=0.226  Sum_probs=59.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHH---
Q ss_conf             95899886588999999998589967899954983575117055128789899999998718979999795578748---
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNG---   77 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~g---   77 (424)
                      .||||+|+=+=-..|+..|...+.+..+...-..+.. .......--..|.+.+.+|+++++|++||=. .-|.+.-   
T Consensus         2 ~~IlilgGT~Egr~la~~L~~~~~~~s~ag~~~~~~~-~~~~i~~G~~~~~~~l~~~l~~~~i~~VIDA-THPfA~~is~   79 (241)
T PRK08057          2 PRILLLGGTSEARALARALAPDDTVTSLAGRTLKPAD-LPGPVRVGGFGGAEGLAAYLREEGIDLVVDA-THPYAAQISA   79 (241)
T ss_pred             CEEEEEECHHHHHHHHHHHHCCCEEEEEEEECCCCCC-CCCCEEECCCCCHHHHHHHHHHCCCCEEEEC-CCCCHHHHHH
T ss_conf             6599996708999999997489989998530255656-8876798888999999999996799899989-9970899999


Q ss_pred             -HHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             -998986058806701066655520102357888765310111122344011111210124
Q gi|254780206|r   78 -ISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKS  137 (424)
Q Consensus        78 -i~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g  137 (424)
                       ..++.++.|||++       |+|+...        .--+...+..++|.++|.+.+...+
T Consensus        80 ~a~~a~~~~~ipyl-------R~eRp~~--------~~~~~d~~~~v~s~~ea~~~l~~~~  125 (241)
T PRK08057         80 NAAAACRALGIPYL-------RLERPPW--------QPQPGDDWIEVDDIAAAAEALAPFG  125 (241)
T ss_pred             HHHHHHHHHCCEEE-------EEECCCC--------CCCCCCCEEEECCHHHHHHHHHHCC
T ss_conf             99999998697079-------9967865--------6788877899799999999876438


No 96 
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=95.54  E-value=0.25  Score=29.64  Aligned_cols=88  Identities=23%  Similarity=0.218  Sum_probs=63.1

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH-HH--------CCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHH
Q ss_conf             89988658899999999858996789995498357-51--------1705512878989999999871897999979557
Q gi|254780206|r    3 VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI-AQ--------HAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELP   73 (424)
Q Consensus         3 ILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~-~~--------~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~p   73 (424)
                      |||||+|.--.++++.|.++..+.+|.++.-|..- ..        -.+.+.+|..|.+++.+++++.  |+||-.--..
T Consensus         1 IlvlGaG~vG~~~~~~L~~~~~~~~i~vad~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~l~~~~~~~--diVv~~~p~~   78 (384)
T pfam03435         1 VLIIGAGGVGQGVAPLLARHGDVDEITVADRSLEKAQALAAPKLGLRFIAIAVDADNYEALAALLKEG--DLVINLAPPF   78 (384)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCC--CEEEECCCHH
T ss_conf             98989778799999999728998869999898899898775236985389995778999999987128--9999998434


Q ss_pred             HHHHHHHHHHHCCCCEEEC
Q ss_conf             8748998986058806701
Q gi|254780206|r   74 LVNGISDALNAAGFKVFGP   92 (424)
Q Consensus        74 L~~gi~d~l~~~gi~v~Gp   92 (424)
                      +...++..+-+.|..++-.
T Consensus        79 ~~~~i~~~c~~~g~~yvd~   97 (384)
T pfam03435        79 LSLTVLKACIETGVHYVDT   97 (384)
T ss_pred             HCHHHHHHHHHCCCCEEEC
T ss_conf             1699999999739975753


No 97 
>pfam02629 CoA_binding CoA binding domain. This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.
Probab=95.46  E-value=0.11  Score=32.25  Aligned_cols=85  Identities=19%  Similarity=0.190  Sum_probs=55.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEE-EECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHH
Q ss_conf             589988658899999999858996789995498357511705-5128789899999998718979999795578748998
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC-VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISD   80 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~-~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d   80 (424)
                      ||+|+|-|+..+|+..-..++.....+-+++=||..  ..+. ..+.+.  +.+.++++++++|.+++.-..+-+..+++
T Consensus         5 ~v~liG~g~lG~al~~~~~~~~~~~i~~vfdv~p~~--~G~~i~gipv~--~~l~~~~~~~~idiaii~VP~~~a~~~~~   80 (96)
T pfam02629         5 KVAVIGASGLGIQGLYHFIQLLGYGIKMVFGVNPRK--GGTEVGGIPVY--KSVDELEEDTGVDVAVITVPAPFAQEAID   80 (96)
T ss_pred             EEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCCCC--CCCEECCEEEE--CCHHHHHHCCCCCEEEEEECHHHHHHHHH
T ss_conf             499999898278887768877148618998069242--77588899843--10877741558878999947899899999


Q ss_pred             HHHHCCCCEE
Q ss_conf             9860588067
Q gi|254780206|r   81 ALNAAGFKVF   90 (424)
Q Consensus        81 ~l~~~gi~v~   90 (424)
                      .+-+.|++.+
T Consensus        81 ~~v~~GIk~i   90 (96)
T pfam02629        81 ELVDAGIKGI   90 (96)
T ss_pred             HHHHCCCCEE
T ss_conf             9998699899


No 98 
>KOG1447 consensus
Probab=95.44  E-value=0.016  Score=38.24  Aligned_cols=180  Identities=20%  Similarity=0.214  Sum_probs=96.7

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE-EEEEECCCCCCCC-----------CCCHHHHHHHHHHHHHHHCC
Q ss_conf             35788876531011112234401111121012420-2563046534300-----------02323567788878875144
Q gi|254780206|r  105 FAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP-IVVKADGLCAGKG-----------VVVAATVDEATSAIDRCFQQ  172 (424)
Q Consensus       105 ~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P-vVVKp~~~agGkG-----------V~i~~~~~e~~~~~~~~~~~  172 (424)
                      -+|++|.++|+..-+|.+.++..++.+...+++.| +|||+.-++||||           |.+..+.+++.+..+...+.
T Consensus        26 QSK~~l~k~Gv~vQ~F~Va~n~kea~E~~k~f~~~EyVvKAQILAGGRGKG~F~nG~KGGVhiTk~k~~vl~l~~qMIG~  105 (412)
T KOG1447          26 QSKEILSKNGVRVQRFFVADNAKEALEAAKRFNAKEYVVKAQILAGGRGKGVFNNGLKGGVHITKDKNVVLQLAKQMIGY  105 (412)
T ss_pred             HHHHHHHHCCEEEEEEEEECCCHHHHHHHHHCCCCCEEEEEEEEECCCCCCEECCCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             66788986490589999706707789999854992237764431067655424477654068744874999999998745


Q ss_pred             C-------CH-----HHHHHHHHH-CCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--EE---ECCCCCCC
Q ss_conf             5-------31-----777887752-0575234421577631035200011135665444443443--00---00123443
Q gi|254780206|r  173 I-------NS-----TVIIEEYLE-GFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMG--AC---SPALGMSQ  234 (424)
Q Consensus       173 ~-------~~-----~VliEefl~-G~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMG--a~---~p~~~~~~  234 (424)
                      .       .+     +|.|-|-++ -.|--+-.+.|.+.-=|..            .+...|||-  ++   +|-..+  
T Consensus       106 rL~TKQTpkeGv~VnKVMvAe~~dI~RETYLaiLmDRe~NGPVl------------vaSP~GGmDIEaVAe~tPE~If--  171 (412)
T KOG1447         106 RLATKQTPKEGVKVNKVMVAEALDISRETYLAILMDRECNGPVL------------VASPQGGMDIEAVAESTPELIF--  171 (412)
T ss_pred             HHHHCCCCCCCEEEEEEEEEECCCCCHHEEEEEEECCCCCCCEE------------EECCCCCCCHHHHHHHCHHHHC--
T ss_conf             33204488556265558873003611240014355145689779------------8569988659998653957651--


Q ss_pred             CCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEE--E-------ECCEEEEEEEEEEECCCCCEEEEECCCCCC
Q ss_conf             2220100000899999862046235664454489--8-------557048999886514775104433265441
Q gi|254780206|r  235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLM--I-------TEQGPYLIEYNVRFGDPECQAMMMRLESDI  299 (424)
Q Consensus       235 ~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m--~-------t~~gp~viE~N~R~GDPE~q~ilp~L~~dl  299 (424)
                      ...-+|.+.|-+-+.-.+. +.+.|.|.|-.+.-  +       ..-...-+|+|+---.||.|++.---+-+|
T Consensus       172 k~piDI~~gi~esq~l~~A-k~L~F~G~l~~~aA~eI~kLY~LF~avDAtQvEiNPl~ET~~G~V~cvDAK~NF  244 (412)
T KOG1447         172 KEPIDIFEGIKESQALRMA-KNLGFVGPLKSQAADEITKLYNLFLAVDATQVEINPLGETPEGQVVCVDAKINF  244 (412)
T ss_pred             CCCCHHCCCCCHHHHHHHH-HHCCCCCCHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCCCEEEEEEEECCC
T ss_conf             4462013688668899999-844666707778999999999999651212787325665898608998501067


No 99 
>TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.
Probab=95.20  E-value=0.31  Score=28.89  Aligned_cols=88  Identities=23%  Similarity=0.315  Sum_probs=51.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCC-EEE-EECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEEC-C--CHHHHH
Q ss_conf             5899886588999999998589967-899-9549835751170551287898999999987189799997-9--557874
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLS-ELW-SIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVG-P--ELPLVN   76 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~-~v~-~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivg-p--E~pL~~   76 (424)
                      +|||||+|.....++..+.+.+... ++. +.+.++.-......++ -..+.+++.++++++++|-|++. |  +.....
T Consensus       130 rvLIIG~g~~~~~l~~~l~~~~~~G~~vvG~vdd~~~~~~~~~~~p-vlg~~~~l~~~i~~~~ideViia~~~~~~~~~~  208 (451)
T TIGR03023       130 RVLIVGAGELGRRLAERLARNPELGYRVVGFFDDRPDARTGVRGVP-VLGKLDDLEELIREGEVDEVYIALPLAAEKRIL  208 (451)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCC-CCCCHHHHHHHHHHCCCCEEEEECCCCCHHHHH
T ss_conf             4999968689999999997194368489999838854444457997-369899999999967998899954835568999


Q ss_pred             HHHHHHHHCCCCEE
Q ss_conf             89989860588067
Q gi|254780206|r   77 GISDALNAAGFKVF   90 (424)
Q Consensus        77 gi~d~l~~~gi~v~   90 (424)
                      .+.+.++..|+.+.
T Consensus       209 ~li~~~~~~~v~v~  222 (451)
T TIGR03023       209 ELLDALEDLTVDVR  222 (451)
T ss_pred             HHHHHHHHCCCEEE
T ss_conf             99999864598799


No 100
>TIGR01435 glu_cys_lig_rel putative glutamate--cysteine ligase/putative amino acid ligase; InterPro: IPR006335   This entry represents a family with an N-terminal region similar to proteobacterial glutamate-cysteine ligase (gamma-glutamylcysteine synthetase). The C-terminal region is homologous to cyanophycin synthetase of cyanobacteria, and (shown by PSI-BLAST) to D-alanine-D-alanine ligases. Cyanophycin is a storage molecule composed of arginine, aspartic acid, and some glutamic acid. Members of this family are found in Listeria and Enterococcus, Gram-positive lineages in which glutathione is produced , and in proteobacterium Pasteurella multocida.; GO: 0004357 glutamate-cysteine ligase activity, 0006750 glutathione biosynthetic process.
Probab=95.06  E-value=0.037  Score=35.58  Aligned_cols=99  Identities=26%  Similarity=0.334  Sum_probs=77.6

Q ss_pred             HHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEE-EEEECCCCCCCCCCCHH----HHHHHHHHHHHHHCCC
Q ss_conf             520102357888765310111122344011111210124202-56304653430002323----5677888788751445
Q gi|254780206|r   99 LESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPI-VVKADGLCAGKGVVVAA----TVDEATSAIDRCFQQI  173 (424)
Q Consensus        99 le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~Pv-VVKp~~~agGkGV~i~~----~~~e~~~~~~~~~~~~  173 (424)
                      +..+|..+|.++.++|...|....|++...+.+....+.-.. |+||....-|-|..+..    +.++..+++..+|.. 
T Consensus       487 ~~~~~~~~~~~~~~~g~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~g~g~~~~~~~~~~~~d~~~~~~~~~~~-  565 (754)
T TIGR01435       487 LLENKVVTKKVLAEAGFNVPGGDEFSSLALALEAFLLFENKAFVVKPKSTNYGLGTTIFKEGFTNLEDFAEALRNAFKE-  565 (754)
T ss_pred             EECCHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCEEECCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHH-
T ss_conf             0011257788887604557665304678888888876413300332354444331234430221056789999876420-


Q ss_pred             CHHHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             3177788775205752344215776
Q gi|254780206|r  174 NSTVIIEEYLEGFEVSFFALCDGKT  198 (424)
Q Consensus       174 ~~~VliEefl~G~E~Sv~~i~dG~~  198 (424)
                      +..+++++|+.|.|+.++.+-|...
T Consensus       566 d~~~~~~~~~~g~~~~~~~~~~~~~  590 (754)
T TIGR01435       566 DSEVLVEEFLPGTEYRFFLLGDEVE  590 (754)
T ss_pred             HHHHHHHHHCCCCCEEEEEECCHHH
T ss_conf             0134333311576216776354156


No 101
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase. Certain closely related transferase enzymes such as Sinorhizobium ExoY and Lactococcus EpsD lack the N-terminal domain and are not found by this model.
Probab=94.93  E-value=0.37  Score=28.37  Aligned_cols=88  Identities=17%  Similarity=0.236  Sum_probs=54.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCC-EE--EEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECC---CHHHH
Q ss_conf             5899886588999999998589967-89--995498357511705512878989999999871897999979---55787
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLS-EL--WSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGP---ELPLV   75 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~-~v--~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgp---E~pL~   75 (424)
                      +|||||+|.+-..++..+.+.+... .+  ++.+.+ ........++ -.-+.+++.++++++++|-|++..   +.+..
T Consensus       127 rvlIIG~g~~~~~l~~~l~~~~~~g~~vvG~~dd~~-~~~~~~~~~p-~lg~~~~l~~~i~~~~ideViIa~p~~~~~~~  204 (445)
T TIGR03025       127 RVLIVGTGELAEELAAALSRNPDLGYRVVGFVDDRP-EDRVEVAGLP-VLGKLDDLVELVRAHRVDEVIIALPLSEEARI  204 (445)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCCEEEEEEECCCC-CCCCCCCCCC-CCCCHHHHHHHHHHCCCCEEEEECCCCCHHHH
T ss_conf             399990848999999999828468848999977875-4445567886-01889999999997699889996586776899


Q ss_pred             HHHHHHHHHCCCCEEE
Q ss_conf             4899898605880670
Q gi|254780206|r   76 NGISDALNAAGFKVFG   91 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~G   91 (424)
                      ..+.+.++..|+.+.-
T Consensus       205 ~~~l~~~~~~~v~v~~  220 (445)
T TIGR03025       205 LELLLQLSDLGVDVRL  220 (445)
T ss_pred             HHHHHHHHHCCCEEEE
T ss_conf             9999998755978999


No 102
>KOG3895 consensus
Probab=94.72  E-value=0.15  Score=31.17  Aligned_cols=221  Identities=15%  Similarity=0.211  Sum_probs=108.1

Q ss_pred             HHHHHCCCEEEECCCHHHHH------HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHH----HH---HHCCCCCCC
Q ss_conf             99871897999979557874------899898605880670106665552010235788876----53---101111223
Q gi|254780206|r   57 FCQEKHIDLVVVGPELPLVN------GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTK----YG---IPTATYQHF  123 (424)
Q Consensus        57 ~a~~~~iDlvivgpE~pL~~------gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~----~g---IPt~~~~~~  123 (424)
                      .++..++|+|+++.-+.-++      -++-.|..+|||.+- +-.++--.-||-|-+.-|.+    .|   +|-..-..+
T Consensus       150 v~RsfkPdfVlirqhA~~mA~~~d~rslvig~qyagiP~vN-Sl~SvynFcdkpwvf~Qlvki~~slG~e~fPli~qt~y  228 (488)
T KOG3895         150 VVRSFKPDFVLIRQHAFSMALNEDYRSLVIGLQYAGIPSVN-SLTSVYNFCDKPWVFAQLVKITKSLGPEKFPLIEQTFY  228 (488)
T ss_pred             EEEECCCCEEEECCCCHHHCCCCCHHHHHHHHHHCCCCCCC-HHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCCEEEC
T ss_conf             54312677788705301010131068999988763786420-26789886145689999999987518544554400106


Q ss_pred             CCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC-CCCEEEECCCCCCCCC
Q ss_conf             440111112101242025630465343000232356778887887514453177788775205-7523442157763103
Q gi|254780206|r  124 SDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGF-EVSFFALCDGKTAIPF  202 (424)
Q Consensus       124 ~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~-E~Sv~~i~dG~~~~~l  202 (424)
                      -+   -+..+..-.||+|||-..-.+|.|-..++|.+|+.+.- ....-....+-.|-|++.. .+-++-|  |.+|...
T Consensus       229 Pn---HK~m~s~~tyPvVVkvghahsGmGKiKV~Nh~dfqDi~-svval~~Tyat~epFiDaKYDiriQKI--G~nYKay  302 (488)
T KOG3895         229 PN---HKEMLSQPTYPVVVKVGHAHSGMGKIKVENHEDFQDIA-SVVALTKTYATAEPFIDAKYDIRIQKI--GHNYKAY  302 (488)
T ss_pred             CC---CHHHCCCCCCCEEEEECCCCCCCCEEEECCHHHHHHHH-HHHHHHHHHHCCCCCCCCCCEEEHHHH--HHHHHHH
T ss_conf             87---44221488776799825433565325523415567699-999988623200234343220015654--0468888


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCCCCEEE-ECCHHHHHHHHHHHCCCEEEEE---EEEEEEEECCE-EEEE
Q ss_conf             52000111356654444434430000123443222010-0000899999862046235664---45448985570-4899
Q gi|254780206|r  203 TTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV-IQKIILPTIEGMQKEQNPFQGV---LFAGLMITEQG-PYLI  277 (424)
Q Consensus       203 ~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~~~~~~~~i-~~~i~~~~~~~l~~~~~~y~G~---l~~~~m~t~~g-p~vi  277 (424)
                      .-     +--.++---|||.            ...++| +.+--+.++++.-..    .|-   .-+.....++| -||+
T Consensus       303 mR-----tsIsgnWKtNtGS------------amLEQIamseRyklwvdtcse~----fGgldICav~alhsKdGrd~i~  361 (488)
T KOG3895         303 MR-----TSISGNWKTNTGS------------AMLEQIAMSERYKLWVDTCSEM----FGGLDICAVKALHSKDGRDYII  361 (488)
T ss_pred             HH-----HHHCCCCCCCCHH------------HHHHHHHHHHHHHHHHHHHHHH----CCCCCEEEEEEEECCCCHHHEE
T ss_conf             66-----5312675457208------------9999998778899999989976----2883246654210565502324


Q ss_pred             EEEEEECCCCCEEEEECCCC----C---CHHHHHHHHHCCCCC
Q ss_conf             98865147751044332654----4---115666542013333
Q gi|254780206|r  278 EYNVRFGDPECQAMMMRLES----D---ILEILNSCVHGNLHN  313 (424)
Q Consensus       278 E~N~R~GDPE~q~ilp~L~~----d---l~~il~~~~~g~L~~  313 (424)
                      |+|-        ..||++..    |   ..+++.+-....|..
T Consensus       362 eV~d--------~smpliGeh~eeDrql~~~Lvvskmaq~l~~  396 (488)
T KOG3895         362 EVMD--------SSMPLIGEHQEEDRQLISELVVSKMAQLLTR  396 (488)
T ss_pred             EECC--------CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             3123--------5432224224678999999999976530589


No 103
>PRK07578 short chain dehydrogenase; Provisional
Probab=94.43  E-value=0.27  Score=29.31  Aligned_cols=58  Identities=24%  Similarity=0.406  Sum_probs=39.2

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHH-CCCEEE
Q ss_conf             958998865-8899999999858996789995498357511705512878989999999871-897999
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEK-HIDLVV   67 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~-~iDlvi   67 (424)
                      |||||.|.. |--.|++.+|.+..   +|+.+-.+.+      .+..|.+|.+.+.++.++. ++|.+|
T Consensus         1 MrVlVTGas~GIG~aia~~la~~~---~vv~~~r~~~------~~~~Dvtd~~~v~~~~~~~G~iD~lV   60 (199)
T PRK07578          1 MKILVIGASGTIGRAVVAELSARH---EVITAGRSSG------DVQVDITDPASIRALFEKVGKVDAVV   60 (199)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCC---CEEEEECCCC------CEEEECCCHHHHHHHHHHHCCCCEEE
T ss_conf             979999987489999999996799---9899836867------75685889999999999629998999


No 104
>COG2344 AT-rich DNA-binding protein [General function prediction only]
Probab=94.39  E-value=0.41  Score=28.00  Aligned_cols=42  Identities=14%  Similarity=0.330  Sum_probs=15.6

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCC
Q ss_conf             878989999999871897999979557874899898605880
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFK   88 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~   88 (424)
                      .+.|.+.+.++++++.+|.++..-.+--+..++|.|.++|++
T Consensus       131 ~V~~~d~le~~v~~~dv~iaiLtVPa~~AQ~vad~Lv~aGVk  172 (211)
T COG2344         131 PVYDLDDLEKFVKKNDVEIAILTVPAEHAQEVADRLVKAGVK  172 (211)
T ss_pred             EEECHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHCCCC
T ss_conf             455268888898861761899973489899999999983873


No 105
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane]
Probab=94.17  E-value=0.054  Score=34.38  Aligned_cols=97  Identities=18%  Similarity=0.113  Sum_probs=66.5

Q ss_pred             HHHCCHHHHHHHHHHHHHCCCCCCCCCCH-HHHHHHHCCCCEEEEEECCCCCCCCCCCHHH----HHHHHHHHHHHHCCC
Q ss_conf             52010235788876531011112234401-1111210124202563046534300023235----677888788751445
Q gi|254780206|r   99 LESSKSFAKKFCTKYGIPTATYQHFSDPM-KAKQYVQNKSMPIVVKADGLCAGKGVVVAAT----VDEATSAIDRCFQQI  173 (424)
Q Consensus        99 le~sK~~~K~~l~~~gIPt~~~~~~~~~~-ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~----~~e~~~~~~~~~~~~  173 (424)
                      +..+|..+|..+.+.+++.|.-.-+.-.+ ....+++-+++|+|+||...+++.++.+...    .+.+..+...++...
T Consensus        48 ~~~~~~~~~~~~~~~~vvfp~lhG~~gEDg~iqg~le~~giPyvg~gv~~Sa~~mdk~~~K~~~~~~g~~~a~~~~~~~~  127 (317)
T COG1181          48 WMLDKEVTKRVLQKADVVFPVLHGPYGEDGTIQGLLELLGIPYVGKGVLASAGAMDKIVTKRLFKAEGLPVAPYVALTRD  127 (317)
T ss_pred             EEECCCHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHCCCEEECCHHHHHHCCCHHHHHHHHHHCCCCCCHHHHHHCC
T ss_conf             78503101222026987787155888887069999997099876076445332350999988998678651235675334


Q ss_pred             C-HHHHHHHHHHCCCCCEEEECC
Q ss_conf             3-177788775205752344215
Q gi|254780206|r  174 N-STVIIEEYLEGFEVSFFALCD  195 (424)
Q Consensus       174 ~-~~VliEefl~G~E~Sv~~i~d  195 (424)
                      . ..+++|++..|.++-+++.-+
T Consensus       128 ~~~~~~~e~~~~~l~~p~~Vkp~  150 (317)
T COG1181         128 EYSSVIVEEVEEGLGFPLFVKPA  150 (317)
T ss_pred             CCHHHHHHHHHCCCCCCEEEECC
T ss_conf             52047888774146887899858


No 106
>TIGR02482 PFKA_ATP 6-phosphofructokinase; InterPro: IPR012828    6-phosphofructokinase (2.7.1.11 from EC) catalyses the addition of phosphate from ATP to fructose 6-phosphate to give fructose 1,6-bisphosphate. This represents a key control step in glycolysis. This entry contains bacterial ATP-dependent 6-phosphofructokinases, which lack a beta-hairpin loop present in IPR012829 from INTERPRO family members. IPR012829 from INTERPRO contains members that are ATP-dependent as well as members that are pyrophosphate-dependent. IPR011183 from INTERPRO represents the pyrophosphate-dependent phosphofructokinase, diphosphate--fructose-6-phosphate 1-phosphotransferase (2.7.1.90 from EC).; GO: 0003872 6-phosphofructokinase activity, 0005524 ATP binding, 0006002 fructose 6-phosphate metabolic process, 0006096 glycolysis.
Probab=93.75  E-value=0.6  Score=26.83  Aligned_cols=146  Identities=14%  Similarity=0.239  Sum_probs=80.0

Q ss_pred             HHHHHHHHHHCCC-EEEECCCHHHHHHHHHHHHHCC-CCEEE-CCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             9999999871897-9999795578748998986058-80670-1066655520102357888765310111122344011
Q gi|254780206|r   52 SAIIHFCQEKHID-LVVVGPELPLVNGISDALNAAG-FKVFG-PSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMK  128 (424)
Q Consensus        52 ~~i~~~a~~~~iD-lvivgpE~pL~~gi~d~l~~~g-i~v~G-p~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~e  128 (424)
                      +.-++.-|++.|| |||+|-+=.+. | +..|.+.| +||+| |.-    |--|=.++ ++  --|+=|+==.+++..+.
T Consensus        81 ~kA~~nLK~~GI~~LVViGGDGSy~-G-A~~L~~~gg~~~iGlPGT----IDNDI~~T-Dy--TIGfDTALNTi~~avdK  151 (302)
T TIGR02482        81 EKAVENLKKLGIEALVVIGGDGSYT-G-AQKLYEEGGIPVIGLPGT----IDNDIQGT-DY--TIGFDTALNTILDAVDK  151 (302)
T ss_pred             HHHHHHHHHHCCCEEEEECCCHHHH-H-HHHHHHHCCCCEEEECCC----CCCCCCCC-CH--HHHHHHHHHHHHHHHHH
T ss_conf             9999998874886689986844068-8-999997179847874585----02566643-22--55666674379987765


Q ss_pred             HHHHHHCCCCEEEEEEC-----------CCCCCC-CCCCH---HHHHHHHHHHHHHHCC-CCHH--HHHHHHHHCCCCCE
Q ss_conf             11121012420256304-----------653430-00232---3567788878875144-5317--77887752057523
Q gi|254780206|r  129 AKQYVQNKSMPIVVKAD-----------GLCAGK-GVVVA---ATVDEATSAIDRCFQQ-INST--VIIEEYLEGFEVSF  190 (424)
Q Consensus       129 a~~~~~~~g~PvVVKp~-----------~~agGk-GV~i~---~~~~e~~~~~~~~~~~-~~~~--VliEefl~G~E~Sv  190 (424)
                      +++-+.++..-+||===           ++|+|- ...+.   .+.+|+.+.+.+-+.. ..+.  +++|+++.|.=+.+
T Consensus       152 iRDTA~SHeR~f~iEVMGR~aGdLAl~aaiAtGAE~i~~pE~~~~~~~l~~~~k~~~~~~k~~SiI~~ae~~~~g~~~e~  231 (302)
T TIGR02482       152 IRDTATSHERAFVIEVMGRHAGDLALYAAIATGAEIIIIPEFDLDIEELIERIKEQREAGKKNSIIIVAEGNILGNAKEV  231 (302)
T ss_pred             HHCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCHHHH
T ss_conf             42130121656899950785578999998864010211588888989999999999860899618999951014776788


Q ss_pred             ----E-EECC-CCCCCCCCCCC
Q ss_conf             ----4-4215-77631035200
Q gi|254780206|r  191 ----F-ALCD-GKTAIPFTTAR  206 (424)
Q Consensus       191 ----~-~i~d-G~~~~~l~~~~  206 (424)
                          . =-+. -.++.+|..+|
T Consensus       232 A~~iene~~g~~tR~~vLGH~Q  253 (302)
T TIGR02482       232 AKKIENEKTGIETRVTVLGHTQ  253 (302)
T ss_pred             HHHHHCCCCCCEEEEEEEEEEC
T ss_conf             8763047898428999975664


No 107
>pfam06849 DUF1246 Protein of unknown function (DUF1246). This family represents the N-terminus of a number of hypothetical archaeal proteins of unknown function.
Probab=93.75  E-value=0.62  Score=26.71  Aligned_cols=112  Identities=14%  Similarity=0.200  Sum_probs=61.4

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHH---CCCEEEECCCHHHH
Q ss_conf             899886588999999998589967899954983575----11705512878989999999871---89799997955787
Q gi|254780206|r    3 VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEK---HIDLVVVGPELPLV   75 (424)
Q Consensus         3 ILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~---~iDlvivgpE~pL~   75 (424)
                      |.++||-.-=+ |..-.++.+.-+-++|-.|...+-    ..++.+.+  .++.++++-..+.   +-+.++| |--.++
T Consensus         1 I~tl~SHSALq-Il~GAK~EGF~Tv~vc~~gr~~~Y~~f~~~De~iv~--d~f~di~~~~~q~~L~~~N~I~I-PhgSfv   76 (124)
T pfam06849         1 IATLGSHSALQ-ILDGAKDEGFRTVAVCQKGREKFYRRFPFVDEFIVV--DKFKDILDEEVQQKLRENNAIFI-PHGSFV   76 (124)
T ss_pred             CCCCCCCHHHH-HHHHHHHCCCCEEEEEECCCCCHHHHCCCCCEEEEE--CCHHHHHHHHHHHHHHHCCEEEE-CCCCEE
T ss_conf             93121303989-972388739957899817975213326867379995--65899872999999998897997-488846


Q ss_pred             H--HHHHHHH-HCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCC
Q ss_conf             4--8998986-0588067010666555201023578887653101111
Q gi|254780206|r   76 N--GISDALN-AAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY  120 (424)
Q Consensus        76 ~--gi~d~l~-~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~  120 (424)
                      +  |. |.++ +..+|+|| ++..-+.|+++..-+++|+++|||.|+-
T Consensus        77 ~Y~G~-~~ie~~~~VP~FG-NR~lLrwEseR~~~~~lLe~Agi~~Pk~  122 (124)
T pfam06849        77 AYVGY-DRVENEFKVPIFG-NRNLLRWESERDKERKLLEKAGIRYPKK  122 (124)
T ss_pred             EEECH-HHHHHCCCCCEEC-CHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             76558-9986027887004-7888887653677999999769999835


No 108
>pfam11379 DUF3182 Protein of unknown function (DUF3182). This family of proteins with unknown function appears to be restricted to Proteobacteria.
Probab=93.59  E-value=0.044  Score=35.04  Aligned_cols=94  Identities=19%  Similarity=0.189  Sum_probs=63.4

Q ss_pred             HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCC--CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCC--CCHH
Q ss_conf             010235788876531011112234401111121012--420256304653430002323567788878875144--5317
Q gi|254780206|r  101 SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNK--SMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ--INST  176 (424)
Q Consensus       101 ~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~--g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~--~~~~  176 (424)
                      ||..|+.    +..=-+-+..++-|.++|..+...+  +-|+=+||...+||+|..++.+.+++..++...-..  ....
T Consensus       102 Ws~~F~~----~v~~~vLpG~tvFs~~DAr~Aa~~Ll~~G~VRlK~~~a~gG~GQ~vv~d~~~Le~~L~a~~~~~l~~~G  177 (355)
T pfam11379       102 WSRAFAA----RVRDAVLPGYTVFSLEDARDAAARLLKGGPVRLKPPRACGGRGQQVVADADALDAALAALDDRELAAHG  177 (355)
T ss_pred             CCHHHHH----HHHHHCCCCCCCCCHHHHHHHHHHHHCCCCEEECCCCCCCCCCCEEECCHHHHHHHHHCCCHHHHHHCC
T ss_conf             4799999----876210387322267889999999853797255056223788855743899999998727988898668


Q ss_pred             HHHHHHHHCC-CCCE-EEECCCCC
Q ss_conf             7788775205-7523-44215776
Q gi|254780206|r  177 VIIEEYLEGF-EVSF-FALCDGKT  198 (424)
Q Consensus       177 VliEefl~G~-E~Sv-~~i~dG~~  198 (424)
                      +++||-|+.+ -+|| ++.++|-.
T Consensus       178 lVLE~~L~~~~TySVGqv~v~g~~  201 (355)
T pfam11379       178 LVLEEDLDQPTTYSVGQVRVAGLL  201 (355)
T ss_pred             EEEECCCCCCCEEEEEEEEECCEE
T ss_conf             687402577722555559998899


No 109
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=93.54  E-value=0.4  Score=28.15  Aligned_cols=91  Identities=22%  Similarity=0.289  Sum_probs=51.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHC-C-EEE-ECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             589988658899999999858996789995498357511-7-055-1287898999999987189799997955787489
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH-A-QCV-AIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~-~-~~~-~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      ||||+|-|----|++.-|.+...  +|++...++..... . ... .+...+...  .+   ...|++|+.|-.|...-.
T Consensus        14 ~V~V~GlG~sG~a~a~~L~~~G~--~v~~~D~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~d~vV~SPGI~~~~p~   86 (487)
T PRK03369         14 PVLVAGAGVTGRAVLAALTRFGA--RPTVCDDDPDALRPHAERGVATVSSSDAVQ--QI---ADYALVVTSPGFPPTAPV   86 (487)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCHHHHHHHHCCCCEECCCCCHH--HH---CCCCEEEECCCCCCCCHH
T ss_conf             89999156838999999997869--799998982577999865994863762265--64---677889989957998999


Q ss_pred             HHHHHHCCCCEEECCHHHHHH
Q ss_conf             989860588067010666555
Q gi|254780206|r   79 SDALNAAGFKVFGPSQRAAKL   99 (424)
Q Consensus        79 ~d~l~~~gi~v~Gp~~~aa~l   99 (424)
                      ....++.|+|+++=...+.++
T Consensus        87 l~~a~~~gi~i~~eieL~~~~  107 (487)
T PRK03369         87 LAAAAAAGVPIWGDVELAWRL  107 (487)
T ss_pred             HHHHHHCCCCEEEHHHHHHHH
T ss_conf             999998899076599999998


No 110
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=93.52  E-value=0.59  Score=26.90  Aligned_cols=94  Identities=20%  Similarity=0.231  Sum_probs=50.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCC--H-HHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHH
Q ss_conf             9589988658899999999858996789995498--3-575117055128789899999998718979999795578748
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGN--P-GIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNG   77 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN--~-g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~g   77 (424)
                      =||||+|-|----|.+..|.+...-..|++...+  + ....+.+.+.+......  .++.  .+.|+||+.|-.|+..-
T Consensus         8 KkvlV~GlG~sG~s~a~~L~~~~~~~~v~~~D~~~~~~~~~~l~~~~~~~~g~~~--~~~l--~~~d~vV~SPGI~~~~p   83 (438)
T PRK04663          8 KNVVVVGLGITGLSVVKHLRKTQPQLTVKVIDTRETPPGQEQLPEDVELHSGGWN--QDWL--AEADLVVTNPGIALATP   83 (438)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEECCCC--HHHH--CCCCEEEECCCCCCCCH
T ss_conf             7499990678589999999966998469996398893688762069769727889--6783--68999998997699898


Q ss_pred             HHHHHHHCCCCEEECCHHHHH
Q ss_conf             998986058806701066655
Q gi|254780206|r   78 ISDALNAAGFKVFGPSQRAAK   98 (424)
Q Consensus        78 i~d~l~~~gi~v~Gp~~~aa~   98 (424)
                      ......+.|+|+++--.-.++
T Consensus        84 ~~~~a~~~~i~i~~eiel~~~  104 (438)
T PRK04663         84 EIQPVLAKGIPVVGDIELFAW  104 (438)
T ss_pred             HHHHHHHCCCCEECHHHHHHH
T ss_conf             999999869937038899976


No 111
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=93.50  E-value=0.4  Score=28.14  Aligned_cols=91  Identities=20%  Similarity=0.207  Sum_probs=51.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH-CCEE---EECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHH
Q ss_conf             58998865889999999985899678999549835751-1705---5128789899999998718979999795578748
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ-HAQC---VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNG   77 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~-~~~~---~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~g   77 (424)
                      ||||+|-|.---|++.-|.+...  +|++...++.... ..+.   ..+...+...   .  -...|++|+.|-.|...-
T Consensus        19 kvlV~GlG~SG~s~a~~L~~~G~--~v~~~D~~~~~~~~~~~~~~~~~~~~~~~~~---~--~~~~d~vV~SPGI~~~~p   91 (476)
T PRK00141         19 RVLVAGAGVSGLGIAKMLSELGC--DVVVADDNETQRHMLIEVVDVADISTAQASD---A--LDSYSIVVTSPGWRPDSP   91 (476)
T ss_pred             CEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCCHHHHHHHHCCCCEECCCCHHH---H--HCCCCEEEECCCCCCCCH
T ss_conf             88999227889999999997899--7999989987035788747985651553065---6--468999998997899799


Q ss_pred             HHHHHHHCCCCEEECCHHHHHH
Q ss_conf             9989860588067010666555
Q gi|254780206|r   78 ISDALNAAGFKVFGPSQRAAKL   99 (424)
Q Consensus        78 i~d~l~~~gi~v~Gp~~~aa~l   99 (424)
                      +.....+.|+|+++--..+.++
T Consensus        92 ~l~~a~~~gi~viseiel~~~~  113 (476)
T PRK00141         92 LLVDAQSAGLEVIGDVELAWRL  113 (476)
T ss_pred             HHHHHHHCCCCEEEHHHHHHHH
T ss_conf             9999998799577199999986


No 112
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional
Probab=93.43  E-value=0.72  Score=26.26  Aligned_cols=66  Identities=20%  Similarity=0.281  Sum_probs=43.3

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEE-----CCCHHH-HHC--C---EEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             958998865889-9999999858996789995-----498357-511--7---05512878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSI-----PGNPGI-AQH--A---QCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~-----pgN~g~-~~~--~---~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |||||.|+.|.= ..|+..|.+... ..++..     .+|... ...  .   .....|+.|.+.+.++.++.++|.||
T Consensus         1 MkILVTGg~GFIGs~l~~~Ll~~~~-~~v~~vd~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~l~~~~~~~~~D~Vi   78 (352)
T PRK10084          1 MKILVTGGAGFIGSAVVRHIINNTQ-DSVVNVDKLTYAGNLESLADVSDSERYVFEHADICDRAELDRIFAQHQPDAVM   78 (352)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCC-CEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHCCCEEE
T ss_conf             9799975100899999999997799-88999847987677888887630897179985678999999999973999999


No 113
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=93.17  E-value=0.34  Score=28.65  Aligned_cols=84  Identities=26%  Similarity=0.377  Sum_probs=49.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHH----
Q ss_conf             5899886588999999998589967899954983575117055128789899999998718979999795578748----
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNG----   77 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~g----   77 (424)
                      ||+|+|-|+---|.+.-|.+..  .+|++...||..........+...|...    ..-...|++|+.|-.|+..-    
T Consensus        11 ~v~v~GlG~sG~s~a~~L~~~G--~~V~~~D~~~~~~~~~~~~g~~~~~~~~----~~~~~~~~iV~SPGIp~~~p~~~~   84 (457)
T PRK01390         11 TVALFGLGGSGLATARALKAGG--AEVIAWDDNPDSVAKAAAAGIATADLRT----ADWSQFAALVLSPGVPLTHPKPHW   84 (457)
T ss_pred             EEEEEEECHHHHHHHHHHHHCC--CEEEEEECCCHHHHHHHHCCCCCCCCCC----CCCCCCCEEEECCCCCCCCCCCHH
T ss_conf             8999943699999999999789--9799993992066899875983145541----232038789999988865667319


Q ss_pred             HHHHHHHCCCCEEE
Q ss_conf             99898605880670
Q gi|254780206|r   78 ISDALNAAGFKVFG   91 (424)
Q Consensus        78 i~d~l~~~gi~v~G   91 (424)
                      ++...++.|+|+++
T Consensus        85 ~v~~a~~~gi~v~s   98 (457)
T PRK01390         85 TVDLARAAGVEVIG   98 (457)
T ss_pred             HHHHHHHCCCEEEE
T ss_conf             99999985991860


No 114
>PRK10675 UDP-galactose-4-epimerase; Provisional
Probab=93.07  E-value=0.74  Score=26.17  Aligned_cols=65  Identities=23%  Similarity=0.332  Sum_probs=45.3

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEEC----CCHH----HHHC----CEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             958998865889-99999998589967899954----9835----7511----705512878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSIP----GNPG----IAQH----AQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~p----gN~g----~~~~----~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |||||-|+-|.= ..|+..|.+...  +|.+..    +...    ...+    .+.+..|+.|.+.+.+..++.++|.||
T Consensus         1 MkvLVTGg~GFIGs~l~~~Ll~~g~--~V~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~~~~~~~~~~~d~V~   78 (338)
T PRK10675          1 MRVLVTGGSGYIGSHTCVQLLQNGH--DVVILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVI   78 (338)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCCCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEE
T ss_conf             9199989876799999999997849--89999889887376788888614788759983279989999999865999999


No 115
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional
Probab=93.01  E-value=0.83  Score=25.82  Aligned_cols=107  Identities=19%  Similarity=0.156  Sum_probs=64.3

Q ss_pred             EEEEECCCHHH-HHHHHHHHHCCCCCEEEEEC--CCHHHHHCC-EEEEC-CCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             58998865889-99999998589967899954--983575117-05512-878989999999871897999979557874
Q gi|254780206|r    2 RVLLIGSGGRE-HALAWKIAQSPLLSELWSIP--GNPGIAQHA-QCVAI-DIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         2 kILviGsGgrE-hAl~~~l~~s~~~~~v~~~p--gN~g~~~~~-~~~~i-~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      ||.+||-||-- -|||.-|.+...  .|....  .++.+..+. .-+.+ ...+.+.+      .++|++|++|-.|...
T Consensus        10 ~ih~iGigG~GmsalA~~l~~~G~--~V~gsD~~~~~~~~~L~~~Gi~v~~g~~~~~l------~~~d~vV~Sp~I~~~~   81 (459)
T PRK00421         10 RIHFVGIGGIGMSGLAEVLLNLGY--KVSGSDLKESAVTQRLLELGAIIFIGHDAENI------KGADVVVVSSAIKPDN   81 (459)
T ss_pred             EEEEEEECHHHHHHHHHHHHHCCC--EEEEECCCCCHHHHHHHHCCCEEECCCCHHHC------CCCCEEEECCCCCCCC
T ss_conf             899998668889999999996899--39998898997899999787999779897987------9999999899859989


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCH---------------HHHHHHHHHHHH
Q ss_conf             8998986058806701066655520102---------------357888765310
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKS---------------FAKKFCTKYGIP  116 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~---------------~~K~~l~~~gIP  116 (424)
                      -.....++.|||+++=..-.+++...|.               +.-.+|+..|++
T Consensus        82 p~~~~a~~~gi~v~~~~e~l~~~~~~~~~IaVtGTnGKTTtT~ll~~il~~~g~~  136 (459)
T PRK00421         82 PELVAARELGIPVVRRAEMLAELMRLRTSIAVAGTHGKTTTTSLLAHVLAEAGLD  136 (459)
T ss_pred             HHHHHHHHCCCCEEEHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHCCCC
T ss_conf             9999999879979889999999982596499977888611899999999976998


No 116
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=92.95  E-value=0.49  Score=27.49  Aligned_cols=86  Identities=20%  Similarity=0.204  Sum_probs=49.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHH
Q ss_conf             58998865889999999985899678999549835751170551287898999999987189799997955787489989
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDA   81 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~   81 (424)
                      ||||+|-|----|.++-|.+...  .|++...+.......+.......+  ....+.  .++|++|+.|-.|+..-+...
T Consensus         5 kvlV~GlG~SG~s~a~~L~~~g~--~v~~~D~~~~~~~~~~~~~~~~~~--~~~~~~--~~~d~vv~SPGi~~~~p~~~~   78 (418)
T PRK00683          5 RVVVLGLGVTGKSVARFLAQKGV--YVIGVDNSLEALQSCPYIHERYLE--GAEEFP--EQVDLVVRSPGIKPYHPWVEA   78 (418)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCC--EEEEECCCHHHHHHCCHHHHHCCC--CHHHCC--CCCCEEEECCCCCCCCHHHHH
T ss_conf             69998088879999999997829--899982981454546145554056--233242--349899989985998899999


Q ss_pred             HHHCCCCEEECC
Q ss_conf             860588067010
Q gi|254780206|r   82 LNAAGFKVFGPS   93 (424)
Q Consensus        82 l~~~gi~v~Gp~   93 (424)
                      .++.|+|+++--
T Consensus        79 a~~~~i~i~sei   90 (418)
T PRK00683         79 AVALKIPVVTDI   90 (418)
T ss_pred             HHHCCCCCCCHH
T ss_conf             998699754079


No 117
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
Probab=92.94  E-value=0.85  Score=25.75  Aligned_cols=24  Identities=42%  Similarity=0.684  Sum_probs=20.8

Q ss_pred             CEEEEECCCHHHH-----HHHHHHHHCCC
Q ss_conf             9589988658899-----99999985899
Q gi|254780206|r    1 MRVLLIGSGGREH-----ALAWKIAQSPL   24 (424)
Q Consensus         1 MkILviGsGgrEh-----Al~~~l~~s~~   24 (424)
                      ||||++..|++-|     +|+++|.+.+.
T Consensus         1 Mril~~~~~~~GH~~P~l~lA~~L~~rGh   29 (401)
T cd03784           1 MRVLITTIGSRGDVQPLVALAWALRAAGH   29 (401)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             97999879857589999999999998899


No 118
>PRK01641 leuD isopropylmalate isomerase small subunit; Provisional
Probab=92.83  E-value=0.24  Score=29.77  Aligned_cols=21  Identities=14%  Similarity=0.154  Sum_probs=10.0

Q ss_pred             CCCHHHHHHHHCCCCEEEEEE
Q ss_conf             440111112101242025630
Q gi|254780206|r  124 SDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus       124 ~~~~ea~~~~~~~g~PvVVKp  144 (424)
                      +|.|.|-.++..+|+-+||=|
T Consensus        81 SSREhAvwAL~d~Gir~VIA~  101 (201)
T PRK01641         81 SSREHAPWALADYGFRVVIAP  101 (201)
T ss_pred             CCHHHHHHHHHHCCCCEEEEC
T ss_conf             508899999998599899972


No 119
>PRK08300 acetaldehyde dehydrogenase; Validated
Probab=92.72  E-value=0.91  Score=25.55  Aligned_cols=90  Identities=23%  Similarity=0.297  Sum_probs=57.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEC---CCHHHHHCCE-EEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             95899886588999999998589967899954---9835751170-5512878989999999871897999979557874
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIP---GNPGIAQHAQ-CVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~p---gN~g~~~~~~-~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      +|+-|||||---.-|..|+.+|+..+-++++-   .-.|...... -+.....-++.+++..+...+|+||=...+---.
T Consensus         5 ~~vAIiGsGnIGtDLm~Ki~Rs~~le~~~~vG~dp~S~GL~rA~~lGv~ts~~GId~ll~~~~~~~idiVFDATSA~aH~   84 (298)
T PRK08300          5 IKVAIIGSGNIGTDLMIKILRSPHLEPVAMVGIDPESDGLARARRLGVATTAEGIDGLLAHPEFDDIDIVFDATSAGAHV   84 (298)
T ss_pred             CEEEEECCCCHHHHHHHHHHCCCCEEEEEEEECCCCCHHHHHHHHCCCCCCCCCHHHHHHCCCCCCCCEEEECCCHHHHH
T ss_conf             34999888833899999986577610699980598984999999849966376799996183356878899789806689


Q ss_pred             HHHHHHHHCCCCEE
Q ss_conf             89989860588067
Q gi|254780206|r   77 GISDALNAAGFKVF   90 (424)
Q Consensus        77 gi~d~l~~~gi~v~   90 (424)
                      --...|++.|+.++
T Consensus        85 ~h~~~l~~~g~~~I   98 (298)
T PRK08300         85 ENAAKLRELGVRVI   98 (298)
T ss_pred             HHHHHHHHCCCEEE
T ss_conf             99999997398799


No 120
>PRK09009 C factor cell-cell signaling protein; Provisional
Probab=92.65  E-value=0.93  Score=25.48  Aligned_cols=67  Identities=16%  Similarity=0.358  Sum_probs=42.0

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECC--CHHH-HHCCEEEECCCCCHHHHHHHHHHH-CCCEEE
Q ss_conf             958998865-889999999985899678999549--8357-511705512878989999999871-897999
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPG--NPGI-AQHAQCVAIDIQNHSAIIHFCQEK-HIDLVV   67 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pg--N~g~-~~~~~~~~i~~~d~~~i~~~a~~~-~iDlvi   67 (424)
                      |||||.|+. |--.|++++|.+......++..-.  .+.. ......+..|.+|.+.+.+++++. ++|..|
T Consensus         1 mnVLITGas~GIG~aia~~l~~~~~~~~v~~~~~~~~~~~~~~~v~~~~~Dvt~~~~i~~~~~~~~~iD~li   72 (235)
T PRK09009          1 MNILIVGGSGGIGKAMVKQLLETYPDATVHATYRHHKPDFRHDNVQWHALDVTDEAEIKQLSEQFTQLDWLI   72 (235)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEE
T ss_conf             979997556399999999998569980999973776544457983899874799999999998708778999


No 121
>PRK07765 para-aminobenzoate synthase component II; Provisional
Probab=92.60  E-value=0.94  Score=25.44  Aligned_cols=76  Identities=24%  Similarity=0.217  Sum_probs=44.5

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHH
Q ss_conf             958998865-88999999998589967899954983575117055128789899999998718979999--795578748
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNG   77 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~g   77 (424)
                      ||||||-++ ...|=|++.|++-..  .+-+.+             .|..+...+..+  ..++|.+|.  ||..|-.+|
T Consensus         1 MrILiIDn~DSFT~ni~~~lr~lg~--~v~V~~-------------~d~~~~~~~~~~--~~~~dgIILSpGPg~P~~~~   63 (221)
T PRK07765          1 MRILVVDNYDSFVFNLVQYLGQLGV--EAEVWR-------------NDDVRLADEAAV--AAGFDGVLLSPGPGTPERAG   63 (221)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCC--EEEEEE-------------CCCCCHHHHHHH--HCCCCEEEECCCCCCHHHCC
T ss_conf             9799993889339999999987799--189998-------------998998899876--34899899969999801167


Q ss_pred             ----HHHHHHHCCCCEEECC
Q ss_conf             ----9989860588067010
Q gi|254780206|r   78 ----ISDALNAAGFKVFGPS   93 (424)
Q Consensus        78 ----i~d~l~~~gi~v~Gp~   93 (424)
                          +...+...++|++|-.
T Consensus        64 ~~~~~i~~~~~~~iPILGIC   83 (221)
T PRK07765         64 ASIDMVRACAAAGTPLLGVC   83 (221)
T ss_pred             CCHHHHHHHHCCCCCEEEEE
T ss_conf             24889987532599889870


No 122
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional
Probab=92.49  E-value=0.97  Score=25.34  Aligned_cols=88  Identities=8%  Similarity=0.113  Sum_probs=55.1

Q ss_pred             EEEEECCC---HHHHHHHHHHHHCCCC-CEEEEECCC------HHHHHCCEEEECCCCC---------HHHHHHHHHHHC
Q ss_conf             58998865---8899999999858996-789995498------3575117055128789---------899999998718
Q gi|254780206|r    2 RVLLIGSG---GREHALAWKIAQSPLL-SELWSIPGN------PGIAQHAQCVAIDIQN---------HSAIIHFCQEKH   62 (424)
Q Consensus         2 kILviGsG---grEhAl~~~l~~s~~~-~~v~~~pgN------~g~~~~~~~~~i~~~d---------~~~i~~~a~~~~   62 (424)
                      +|++||+|   +--+.++++|++.... ..++-+...      .-+......+.+-+.|         .+.+.++.++.+
T Consensus       100 ~vv~VgGGvG~Ap~~piakalk~~Gn~v~~I~Gar~k~~vilede~~~~~d~~~itTDDGS~G~kG~VT~~L~~ll~~~~  179 (760)
T PRK12778        100 TVVCAGGGVGVAPMLPIVQALKAAGNRVITVLAGRSKELIILEKEMRESSDEVIIMTDDGSYGRKGLVTEGVEEVIKREK  179 (760)
T ss_pred             EEEEEECCEEHHHHHHHHHHHHHCCCEEEEEEECCCHHHEEHHHHHHHHCCEEEEECCCCCCCCCCEECHHHHHHHHCCC
T ss_conf             39999586968987999999998699599998426633403599999743869998589999727456677999974889


Q ss_pred             CCEEE-ECCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             97999-97955787489989860588067
Q gi|254780206|r   63 IDLVV-VGPELPLVNGISDALNAAGFKVF   90 (424)
Q Consensus        63 iDlvi-vgpE~pL~~gi~d~l~~~gi~v~   90 (424)
                      +|.|+ +||. |+..-+++.-+..|||++
T Consensus       180 ~D~v~aiGP~-~MMk~v~~~t~~~~i~t~  207 (760)
T PRK12778        180 VNKCFAIGPA-IMMKFVCLLTKKYEIPTI  207 (760)
T ss_pred             CCEEEEECCH-HHHHHHHHHHCCCCCCEE
T ss_conf             8789997978-999999987260589748


No 123
>TIGR02477 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotransferase; InterPro: IPR011183    Diphosphate--fructose-6-phosphate 1-phosphotransferase catalyses the addition of phosphate from diphosphate (PPi) to fructose 6-phosphate to give fructose 1,6-bisphosphate (2.7.1.90 from EC). The enzyme is also known as pyrophosphate-dependent phosphofructokinase. The usage of PPi-dependent enzymes in glycolysis presumably frees up ATP for other processes . IPR012828 from INTERPRO represents the ATP-dependent 6-phosphofructokinase enzyme contained within Phosphofructokinase. This entry contains primarily bacterial, plant alpha, and plant beta sequences. These may be dimeric nonallosteric enzymes (bacteria) or allosteric heterotetramers (plants) .   For additional information please see , , , .; GO: 0005524 ATP binding, 0047334 diphosphate-fructose-6-phosphate 1-phosphotransferase activity, 0006096 glycolysis, 0005945 6-phosphofructokinase complex.
Probab=92.33  E-value=0.67  Score=26.47  Aligned_cols=94  Identities=21%  Similarity=0.350  Sum_probs=63.7

Q ss_pred             CEEEEECCCHHH---H----HHHHHHHHCCCCCEEEEECCCH-HHH----------HCCE-------------EEECC-C
Q ss_conf             958998865889---9----9999998589967899954983-575----------1170-------------55128-7
Q gi|254780206|r    1 MRVLLIGSGGRE---H----ALAWKIAQSPLLSELWSIPGNP-GIA----------QHAQ-------------CVAID-I   48 (424)
Q Consensus         1 MkILviGsGgrE---h----Al~~~l~~s~~~~~v~~~pgN~-g~~----------~~~~-------------~~~i~-~   48 (424)
                      |||.||=|||-.   |    -|=.+|++-....++|=.-++| |..          .+.+             +-.|. .
T Consensus        75 l~~GviLSGGqAPGGHNVi~GLFD~lk~~np~SkLyGF~~Gp~GL~~~~~~elT~~~i~~YRN~GGFD~iGSGRtKI~T~  154 (566)
T TIGR02477        75 LKVGVILSGGQAPGGHNVISGLFDALKKLNPESKLYGFLGGPEGLLDNNYVELTKELIDEYRNTGGFDIIGSGRTKIETE  154 (566)
T ss_pred             CEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEECHHHHHCCCCCCCEEEECCCCCCCCCH
T ss_conf             56889875798977114677789999973776720010207444315871576378872227887742001685455688


Q ss_pred             CCHHHHHHHHHHHCCC-EEEECCCHHH--HHHHHHHHHHCC--CCEEECCH
Q ss_conf             8989999999871897-9999795578--748998986058--80670106
Q gi|254780206|r   49 QNHSAIIHFCQEKHID-LVVVGPELPL--VNGISDALNAAG--FKVFGPSQ   94 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iD-lvivgpE~pL--~~gi~d~l~~~g--i~v~Gp~~   94 (424)
                      .+++..++.|++++.| |||||-++.-  +|=||+.|.+++  ++|+|-+|
T Consensus       155 Eq~~~al~~~k~l~LdgLVIIGGDdSNTnAA~LAEyF~~~~~~t~viGVPK  205 (566)
T TIGR02477       155 EQFAKALETAKKLKLDGLVIIGGDDSNTNAALLAEYFAKKGLKTQVIGVPK  205 (566)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             899999999876089648997479867999999999997389922786402


No 124
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=92.24  E-value=0.74  Score=26.17  Aligned_cols=91  Identities=14%  Similarity=0.211  Sum_probs=51.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH---HCCE---EEECCCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             5899886588999999998589967899954983575---1170---551287898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA---QHAQ---CVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~---~~~~---~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      ||+|+|-|+---+.+.-|.+..  .+|++...|+...   .+.+   .+.+..-..+.    ....++|++|+.|-.|..
T Consensus         7 ~v~viGlG~sG~s~a~~L~~~G--~~v~~~D~~~~~~~~~~~~~~~~~i~~~~g~~~~----~~~~~~d~vV~SPgI~~~   80 (445)
T PRK04308          7 KILVAGLGGTGISMIAYLRKNG--AEVAAYDAELKAERVAQIGKMFDGLVFYTGRLKD----ALDNGFDILALSPGISER   80 (445)
T ss_pred             EEEEEEECHHHHHHHHHHHHCC--CEEEEEECCCCCCHHHHHHHCCCCCEEEECCCHH----HHCCCCCEEEECCCCCCC
T ss_conf             8999998999999999999789--9199997999953189997436996899378636----501599999989953899


Q ss_pred             HHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             48998986058806701066655
Q gi|254780206|r   76 NGISDALNAAGFKVFGPSQRAAK   98 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~~~aa~   98 (424)
                      .-....+++.|+|+++-..-.++
T Consensus        81 ~p~l~~a~~~gi~i~~~~el~~~  103 (445)
T PRK04308         81 QPDIEAFKQNGGRVLGDIELLAD  103 (445)
T ss_pred             CHHHHHHHHCCCCEECHHHHHHH
T ss_conf             99999999759957159999999


No 125
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=92.12  E-value=1.1  Score=25.03  Aligned_cols=89  Identities=17%  Similarity=0.249  Sum_probs=51.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCH-----HHHHC-CEEEECCC-CCHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             5899886588999999998589967899954983-----57511-70551287-89899999998718979999795578
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNP-----GIAQH-AQCVAIDI-QNHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~-----g~~~~-~~~~~i~~-~d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      ||||+|-|+---+.|.-|.+...  +|++..+++     ....+ .+.+.+.. .+...+    .+..+|+||+.|-.|.
T Consensus        11 ~i~viGlG~sG~s~a~~L~~~G~--~V~~~D~~~~~~~~~~~~l~~~gi~~~~g~~~~~~----~~~~~d~vV~SPgI~~   84 (450)
T PRK02472         11 KVLVLGLAKSGYAAAKLLHKLGA--NVTVNDGKPFSENPAAQELLEEGIKVICGSHPLEL----LDENFDLMVKNPGIPY   84 (450)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCCCCCHHHHHHHHCCCEEEECCCHHHH----CCCCCCEEEECCCCCC
T ss_conf             89999778999999999998869--89998488665798999999679989978880786----0578879998998799


Q ss_pred             HHHHHHHHHHCCCCEEECCHHH
Q ss_conf             7489989860588067010666
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRA   96 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~a   96 (424)
                      ..-+.....+.|+|+++-...+
T Consensus        85 ~~p~~~~a~~~~i~v~~~~el~  106 (450)
T PRK02472         85 DNPMVEEALEKGIPIITEVELA  106 (450)
T ss_pred             CCHHHHHHHHCCCCEEEHHHHH
T ss_conf             9999999998699674387888


No 126
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]
Probab=92.02  E-value=0.64  Score=26.64  Aligned_cols=115  Identities=21%  Similarity=0.292  Sum_probs=65.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH----H--CCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             95899886588999999998589967899954983575----1--17055128789899999998718979999795578
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA----Q--HAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~----~--~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      |||+|+|=|.---|.+.-|.+-.  ..|++...++...    .  ..+.+.+..-...  .  -.....|+||.-|-.|+
T Consensus         8 ~kv~V~GLG~sG~a~a~~L~~~G--~~v~v~D~~~~~~~~~~~~~~~~~i~~~~g~~~--~--~~~~~~d~vV~SPGi~~   81 (448)
T COG0771           8 KKVLVLGLGKSGLAAARFLLKLG--AEVTVSDDRPAPEGLAAQPLLLEGIEVELGSHD--D--EDLAEFDLVVKSPGIPP   81 (448)
T ss_pred             CEEEEEECCCCCHHHHHHHHHCC--CEEEEECCCCCCCCHHHHHHHCCCCEEECCCCC--H--HCCCCCCEEEECCCCCC
T ss_conf             97999926651099999999779--869998389876532344442037223137641--1--00134778998999999


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHH---------HC--CH----HHHHHHHHHHHHCCCCC
Q ss_conf             74899898605880670106665552---------01--02----35788876531011112
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAKLE---------SS--KS----FAKKFCTKYGIPTATYQ  121 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~le---------~s--K~----~~K~~l~~~gIPt~~~~  121 (424)
                      ..-++....+.|++++|--..+.++.         ++  |.    +.-.++++.|.++.-.-
T Consensus        82 ~~p~v~~A~~~gi~i~~dieL~~r~~~~~p~vaITGTNGKTTTTsli~~~l~~~G~~~~lgG  143 (448)
T COG0771          82 THPLVEAAKAAGIEIIGDIELFYRLSGEAPIVAITGTNGKTTTTSLIAHLLKAAGLDALLGG  143 (448)
T ss_pred             CCHHHHHHHHCCCCEEEHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEECC
T ss_conf             88899999986993774888898744899989997999628899999999985599832135


No 127
>TIGR00715 precor6x_red precorrin-6x reductase; InterPro: IPR003723   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CobK and CbiJ precorrin-6x reductase (1.3.1.54 from EC). In the aerobic pathway, CobK catalyses the reduction of the macrocycle of precorrin-6X to produce precorrin-6Y; while in the anaerobic pathway CbiJ catalyses the reduction of the macrocycle of cobalt-precorrin-6X into cobalt-precorrin-6Y , .; GO: 0016994 precorrin-6A reductase activity, 0009236 cobalamin biosynthetic process.
Probab=91.54  E-value=1.2  Score=24.60  Aligned_cols=65  Identities=25%  Similarity=0.305  Sum_probs=46.6

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEECC---CHHHHHC-CEEEECCCCCHHH-HHHHHHHHCCCEEE
Q ss_conf             958998865--889999999985899678999549---8357511-7055128789899-99999871897999
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIPG---NPGIAQH-AQCVAIDIQNHSA-IIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~pg---N~g~~~~-~~~~~i~~~d~~~-i~~~a~~~~iDlvi   67 (424)
                      |+||++|+=  +|  +|+.+|...+.+.-++.+-+   |+-.... +..+.+-..|.++ |.+|.++++||.+|
T Consensus         1 ~~vll~GGT~dsr--~~~~~L~~~~~~~i~~t~tt~~~~~l~~~~~a~~v~~gaL~~~EGL~~~l~~~~i~~~v   72 (260)
T TIGR00715         1 MSVLLMGGTKDSR--AIAKKLRALGDVEILVTVTTEEGKKLLEISQASKVVTGALDKDEGLRELLKEESIDILV   72 (260)
T ss_pred             CEEEEEECCHHHH--HHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHCCCCEEE
T ss_conf             9689971777899--99974037875899987415776300100377715875748887537888644963898


No 128
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane]
Probab=91.40  E-value=1.3  Score=24.49  Aligned_cols=64  Identities=22%  Similarity=0.327  Sum_probs=45.4

Q ss_pred             CEEEEECCCHH--HHHHHHHHHHCCCCCEEEEEC----CCHHHHHC--CEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             95899886588--999999998589967899954----98357511--705512878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGR--EHALAWKIAQSPLLSELWSIP----GNPGIAQH--AQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgr--EhAl~~~l~~s~~~~~v~~~p----gN~g~~~~--~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |+|||.|+-|-  -|. ++.|.+...  +|.+..    |+.....-  .+.+..|+.|.+.+.++-.+++||.||
T Consensus         1 ~~iLVtGGAGYIGSHt-v~~Ll~~G~--~vvV~DNL~~g~~~~v~~~~~~f~~gDi~D~~~L~~vf~~~~idaVi   72 (329)
T COG1087           1 MKVLVTGGAGYIGSHT-VRQLLKTGH--EVVVLDNLSNGHKIALLKLQFKFYEGDLLDRALLTAVFEENKIDAVV   72 (329)
T ss_pred             CEEEEECCCCHHHHHH-HHHHHHCCC--EEEEEECCCCCCHHHHHHCCCCEEEECCCCHHHHHHHHHHCCCCEEE
T ss_conf             9299965865468999-999997898--48999568878888860204856883343199999999864998899


No 129
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional
Probab=91.07  E-value=1.4  Score=24.27  Aligned_cols=44  Identities=18%  Similarity=0.291  Sum_probs=19.1

Q ss_pred             CCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCE
Q ss_conf             28789899999998718979999795578748998986058806
Q gi|254780206|r   46 IDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKV   89 (424)
Q Consensus        46 i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v   89 (424)
                      +.+.+.+.+.+++++++|+..|+.-.+.-+..++|.|-+.||+-
T Consensus       130 i~V~~i~~L~~~i~~~~i~iaIiaVP~~~AQ~vad~Lv~aGIk~  173 (211)
T PRK05472        130 IPVYHIDELEEVIKENDIEIAILTVPAEAAQEVADRLVEAGIKG  173 (211)
T ss_pred             EEEECHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHHHHHCCEE
T ss_conf             38734999999999819938999557688999999999819839


No 130
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=91.04  E-value=0.5  Score=27.44  Aligned_cols=83  Identities=22%  Similarity=0.232  Sum_probs=45.4

Q ss_pred             EEEEECCC--HHHHHHHHHHHHCCCCCEEEEECCCHHH----HHCCEE-EECCCC-CHHHHHHHHHHHCCCEEEECCCHH
Q ss_conf             58998865--8899999999858996789995498357----511705-512878-989999999871897999979557
Q gi|254780206|r    2 RVLLIGSG--GREHALAWKIAQSPLLSELWSIPGNPGI----AQHAQC-VAIDIQ-NHSAIIHFCQEKHIDLVVVGPELP   73 (424)
Q Consensus         2 kILviGsG--grEhAl~~~l~~s~~~~~v~~~pgN~g~----~~~~~~-~~i~~~-d~~~i~~~a~~~~iDlvivgpE~p   73 (424)
                      ||||+|-|  |+  |.+..|.+......+ ....|...    ...... ..+... +.+.      -...|++|+.|-.|
T Consensus        10 kv~V~GlG~sG~--aaa~~L~~~g~~~~v-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------l~~~d~vv~SPGi~   80 (468)
T PRK04690         10 RVALWGWGREGR--AAYRALRAQLPAQPL-TVFCNAEEVREVGALADAALLVETEASAQR------LAAFEVVVKSPGIS   80 (468)
T ss_pred             EEEEEEECHHHH--HHHHHHHHCCCEEEE-EECCCCCCCHHHHHHCCCCCEEECCCCHHH------HHCCCEEEECCCCC
T ss_conf             799983478799--999999966990499-972883246466762045756746778557------61488999899579


Q ss_pred             HHHHHHHHHHHCCCCEEECC
Q ss_conf             87489989860588067010
Q gi|254780206|r   74 LVNGISDALNAAGFKVFGPS   93 (424)
Q Consensus        74 L~~gi~d~l~~~gi~v~Gp~   93 (424)
                      ...-+...+.+.|++++|-.
T Consensus        81 ~~~p~~~~a~~~~i~i~~ei  100 (468)
T PRK04690         81 PYRPEALAAAAQGTPFIGGT  100 (468)
T ss_pred             CCCHHHHHHHHCCCCEEEHH
T ss_conf             86899999998799488689


No 131
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=91.01  E-value=1.3  Score=24.35  Aligned_cols=85  Identities=18%  Similarity=0.182  Sum_probs=49.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCH---HHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             5899886588999999998589967899954983---5751170551287898999999987189799997955787489
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNP---GIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~---g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      ||+|+|-|.---|.+.-|.+..  .+|++...+.   ....+.+.+.+..-...  .++  -...|++|+.|-.|+..-+
T Consensus         8 ~v~V~GlG~sG~s~~~~L~~~G--~~v~~~D~~~~~~~~~~l~~~~~~~~g~~~--~~~--~~~~d~vV~SPGI~~~~p~   81 (438)
T PRK03806          8 NVVIIGLGLTGLSCVDFFLARG--VTPRVMDTRMTPPGLDKLPENVERHTGSLN--DEW--LLAADLIVASPGIALAHPS   81 (438)
T ss_pred             EEEEEEECHHHHHHHHHHHHCC--CEEEEEECCCCCHHHHHHHCCCCEEECCCC--HHH--HCCCCEEEECCCCCCCCHH
T ss_conf             8999945788899999999789--969999899990057886458846657779--668--0679999989978998989


Q ss_pred             HHHHHHCCCCEEEC
Q ss_conf             98986058806701
Q gi|254780206|r   79 SDALNAAGFKVFGP   92 (424)
Q Consensus        79 ~d~l~~~gi~v~Gp   92 (424)
                      ...+.+.|+|+++-
T Consensus        82 ~~~a~~~~i~i~se   95 (438)
T PRK03806         82 LSAAADAGVEIVGD   95 (438)
T ss_pred             HHHHHHCCCCEEEH
T ss_conf             99999879947769


No 132
>PRK10206 putative dehydrogenase; Provisional
Probab=90.99  E-value=1.4  Score=24.22  Aligned_cols=135  Identities=17%  Similarity=0.168  Sum_probs=70.4

Q ss_pred             EEEEECCC--HHH-HHHHHHHHHCCCCCEEEE-ECCCHHHHHCCEEEE-C-CCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             58998865--889-999999985899678999-549835751170551-2-87898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSG--GRE-HALAWKIAQSPLLSELWS-IPGNPGIAQHAQCVA-I-DIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsG--grE-hAl~~~l~~s~~~~~v~~-~pgN~g~~~~~~~~~-i-~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      ||-|||.|  |+. |+-.  |.+.+....+.+ ...++.....+...+ + -..|+++++   .+..||+|++.....+-
T Consensus         4 rvaiiG~G~~~~~fH~P~--i~~~~~~~~v~~v~~~~~~~~~~a~~~~~~~~~~~~~~ll---~~~~id~V~i~tP~~~H   78 (345)
T PRK10206          4 NCAFIGFGKSTTRYHLPY--VLNRKDSWHVAHIFRRHAKPEEQAPIYSHIHFTSDLDEVL---NDPDVKLVVVCTHADSH   78 (345)
T ss_pred             EEEEECCCHHHHHHHHHH--HHCCCCCEEEEEEECCCHHHHHHHHHCCCCCEECCHHHHH---CCCCCCEEEECCCCHHH
T ss_conf             799992649999998999--9638995799999788761888887769981228999995---49999999987995789


Q ss_pred             HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCC--C-CCCHHHHHHHH--CCCCEEEE
Q ss_conf             48998986058806701066655520102357888765310111122--3-44011111210--12420256
Q gi|254780206|r   76 NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQH--F-SDPMKAKQYVQ--NKSMPIVV  142 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~--~-~~~~ea~~~~~--~~g~PvVV  142 (424)
                      ..++-..-++|..|+.-..-+.-++.-+.. -++.++.|++-..|..  | .+...+++.++  .+|-..-+
T Consensus        79 ~~~a~~al~aGkhV~~EKP~~~~~~ea~~l-~~~a~~~g~~l~v~~nrR~~~~~~~~k~~i~~G~lG~v~~~  149 (345)
T PRK10206         79 FEYAKRALEAGKNVLVEKPFTPTLAQAKEL-FALAKSKGLTVTPYQNRRFDSCFLTAKKAIESGKLGEIVEV  149 (345)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCHHHHHHH-HHHHHHCCCEEEEEEECCCCHHHHHHHHHHHCCCCCCEEEE
T ss_conf             999999997899289803664989999999-99999709979998720179499999998665877770999


No 133
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=90.82  E-value=1.4  Score=24.11  Aligned_cols=86  Identities=21%  Similarity=0.389  Sum_probs=57.1

Q ss_pred             EEEEECCC---HHHHHHHHHHHHCCCCCEEEEECC--C-------HHHHHCCEEEECCCCC---------HHHHHHHHHH
Q ss_conf             58998865---889999999985899678999549--8-------3575117055128789---------8999999987
Q gi|254780206|r    2 RVLLIGSG---GREHALAWKIAQSPLLSELWSIPG--N-------PGIAQHAQCVAIDIQN---------HSAIIHFCQE   60 (424)
Q Consensus         2 kILviGsG---grEhAl~~~l~~s~~~~~v~~~pg--N-------~g~~~~~~~~~i~~~d---------~~~i~~~a~~   60 (424)
                      +|++||+|   +--|-++++|.+...  +|...-|  |       ..+....+.+.+-..|         .+.+.++.++
T Consensus       101 ~Vv~VgGGvGiApv~PiakaLke~GN--~V~~IiGaR~kdlvilede~~~~sdel~i~TDDGS~G~kG~VTd~L~elle~  178 (993)
T PRK12775        101 HVVFVGGGLGVAPIFPQLRAFKEAGA--RTTAIMGFRNKDLVFWEDKFREYADDLIICTDDGSYGEPGFVTAALKRVCEK  178 (993)
T ss_pred             EEEEEECCEEHHHHHHHHHHHHHCCC--EEEEEEECCCCCCEEHHHHHHHHCCCEEEECCCCCCCCCCEEHHHHHHHHHC
T ss_conf             39999087743023899999998599--0899984266002334999986468389976899987564206999999866


Q ss_pred             HCCCEEE-ECCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             1897999-97955787489989860588067
Q gi|254780206|r   61 KHIDLVV-VGPELPLVNGISDALNAAGFKVF   90 (424)
Q Consensus        61 ~~iDlvi-vgpE~pL~~gi~d~l~~~gi~v~   90 (424)
                      .++|+|+ +|| .++..-+++.-+..|||.+
T Consensus       179 ~k~D~V~aIGP-~~MMK~vs~~Tk~ygIpT~  208 (993)
T PRK12775        179 QKPDKVVAIGP-MPMMHACVETTRPFGVKTM  208 (993)
T ss_pred             CCCCEEEEECC-HHHHHHHHHHHCCCCCCEE
T ss_conf             89888999898-8999999987252599758


No 134
>pfam08886 GshA Glutamate-cysteine ligase. This is a rare family of glutamate--cysteine ligases, demonstrated first in Thiobacillus ferrooxidans and present in a few other Proteobacteria. It is the first of two enzymes for glutathione biosynthesis. It is also called gamma-glutamylcysteine synthetase.
Probab=90.79  E-value=0.58  Score=26.96  Aligned_cols=101  Identities=24%  Similarity=0.332  Sum_probs=51.9

Q ss_pred             CCCEEEECCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHHHCCH--------HHHHHHHHHHHH----CCCCCCCCCCH-
Q ss_conf             8979999795578748998986058-806701066655520102--------357888765310----11112234401-
Q gi|254780206|r   62 HIDLVVVGPELPLVNGISDALNAAG-FKVFGPSQRAAKLESSKS--------FAKKFCTKYGIP----TATYQHFSDPM-  127 (424)
Q Consensus        62 ~iDlvivgpE~pL~~gi~d~l~~~g-i~v~Gp~~~aa~le~sK~--------~~K~~l~~~gIP----t~~~~~~~~~~-  127 (424)
                      .+|+++.--+  |++|+-+.|+... -+++ |+..+-+--+.|+        .+++|.+-.+|-    +|.|..+.+.+ 
T Consensus       152 ~Pc~ILLNND--LS~GiP~iL~~l~~Q~il-Ppl~~GW~~RrKS~HF~~Y~~v~~eF~~l~~IDpWli~p~f~~c~~idf  228 (404)
T pfam08886       152 DPCLILLNND--LSSGIPEILQGLHEQYLL-PPLHAGWANRRKSNHFSAYDEVAKEFAKLIGIDPWLINPLFSSCGGVDF  228 (404)
T ss_pred             CCCEEEECCC--CCCCCCHHHHCCCCCCCC-CCCCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCCCCCCC
T ss_conf             8757997475--443683566064655055-9845674410122678999999999999749991113535023076267


Q ss_pred             -----------HHHHHHHC-------CC---CE-EEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             -----------11112101-------24---20-25630465343000232356778887
Q gi|254780206|r  128 -----------KAKQYVQN-------KS---MP-IVVKADGLCAGKGVVVAATVDEATSA  165 (424)
Q Consensus       128 -----------ea~~~~~~-------~g---~P-vVVKp~~~agGkGV~i~~~~~e~~~~  165 (424)
                                 ++.+.+.+       .|   -| ++||+|...-|.||..+++-+|....
T Consensus       229 ~~~~g~~~La~~Vd~lL~kI~~KY~eygI~ekPfV~VKad~GTYGMGIm~v~~~~ei~~L  288 (404)
T pfam08886       229 HDREGEECLAEKVDALLAKIREKYKEYGIKEKPFVFVKADAGTYGMGIMTVRSGDEVLAL  288 (404)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCEEEEECCHHHHHHH
T ss_conf             744369999999999999999999970999884599967899877337995599999886


No 135
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR006268   These sequences are one of at least three types of phospho-2-dehydro-3-deoxyheptonate aldolase (DAHP synthase). This enzyme catalyzes the first of 7 steps in the biosynthesis of chorismate, that last common precursor of all three aromatic amino acids and of PABA, ubiquinone and menaquinone. Some members of this family, including an experimentally characterised member from Bacillus subtilis, are bifunctional, with a chorismate mutase domain N-terminal to this region. The member of this family from Synechocystis PCC 6803, CcmA, was shown to be essential for carboxysome formation. However, no other candidate for this enzyme is present in that species, chorismate biosynthesis does occur, other species having this protein lack carboxysomes but appear to make chorismate, and a requirement of CcmA for carboxysome formation does not prohibit a role in chorismate biosynthesis.; GO: 0016832 aldehyde-lyase activity, 0009073 aromatic amino acid family biosynthetic process.
Probab=90.53  E-value=0.74  Score=26.17  Aligned_cols=78  Identities=21%  Similarity=0.227  Sum_probs=49.8

Q ss_pred             CCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-CHH-HHHHHHHHCCCCCE-EEE---
Q ss_conf             122344011111210124202563046534300023235677888788751445-317-77887752057523-442---
Q gi|254780206|r  120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NST-VIIEEYLEGFEVSF-FAL---  193 (424)
Q Consensus       120 ~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-~~~-VliEefl~G~E~Sv-~~i---  193 (424)
                      .+...|. ++++.+-+.+-||.+|-       |+  ..+.+|.+.|.|+++.+. +.. ||+|.=|-+.|-|- +++   
T Consensus       116 ARNmQNF-~LL~~vG~~~KPVLLKR-------G~--~aTi~EwL~AAEYIl~~GsN~~ViLCERGIRTfE~~TR~TLD~s  185 (262)
T TIGR01361       116 ARNMQNF-ELLKEVGKQGKPVLLKR-------GM--GATIEEWLEAAEYILSEGSNGNVILCERGIRTFEKSTRNTLDLS  185 (262)
T ss_pred             CCCCCCH-HHHHHHHHCCCCEEEEC-------CC--CHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHH
T ss_conf             5412256-99999722379755307-------72--15899999999999846889954899758567630024533378


Q ss_pred             --CCCCCCCCCCCCCC
Q ss_conf             --15776310352000
Q gi|254780206|r  194 --CDGKTAIPFTTARD  207 (424)
Q Consensus       194 --~dG~~~~~l~~~~d  207 (424)
                        .-=+....||++=|
T Consensus       186 aV~~~K~~tHLPi~VD  201 (262)
T TIGR01361       186 AVPLLKKETHLPIIVD  201 (262)
T ss_pred             HHHHHHHCCCCCEEEC
T ss_conf             9999986058987871


No 136
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1. Aos1 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. Aos1 contains part of the adenylation domain.
Probab=90.50  E-value=1.5  Score=23.92  Aligned_cols=112  Identities=16%  Similarity=0.116  Sum_probs=65.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCC-HHHHHCCEEEECCCC-----CHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             9589988658899999999858996789995498-357511705512878-----9899999998718979999795578
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGN-PGIAQHAQCVAIDIQ-----NHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN-~g~~~~~~~~~i~~~-----d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      .||||+|-||--..++.-|..+. +.++.++.+. -....+..++..+..     -.+...+..++.+++.-|..-...+
T Consensus        22 s~VlvvG~GGLG~~v~~~La~aG-vg~i~ivD~d~v~~snL~RQ~l~~~~diG~~Ka~~a~~~l~~lNp~v~i~~~~~~~  100 (197)
T cd01492          22 ARILLIGLKGLGAEIAKNLVLSG-IGSLTILDDRTVTEEDLGAQFLIPAEDLGQNRAEASLERLRALNPRVKVSVDTDDI  100 (197)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCCCCHHHCCCCEECCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             95999887889999999999837-98699998991877773978603233478885999999999738997289870458


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             74899898605880670106665552010235788876531011
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA  118 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~  118 (424)
                      ..--.+.++...+-+.+.....+|     ..--+.|.++|+|--
T Consensus       101 ~~~~~~~i~~~D~Vvd~~dn~~~r-----~~iN~~c~~~~iplI  139 (197)
T cd01492         101 SEKPEEFFSQFDVVVATELSRAEL-----VKINELCRKLGVKFY  139 (197)
T ss_pred             CHHHHHHHHCCCEEEECCCCHHHH-----HHHHHHHHHCCCCEE
T ss_conf             576899982899999999999999-----999999998199789


No 137
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann
Probab=89.88  E-value=0.67  Score=26.47  Aligned_cols=34  Identities=24%  Similarity=0.474  Sum_probs=28.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             58998865889999999985899678999549835
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG   36 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g   36 (424)
                      +|||||+||-..|++++|.+.. +.+++++.-|..
T Consensus        21 ~vlIlGaGGaarai~~aL~~~g-~~~I~i~nR~~~   54 (155)
T cd01065          21 KVLILGAGGAARAVAYALAELG-AAKIVIVNRTLE   54 (155)
T ss_pred             EEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCHH
T ss_conf             9999867589999999999719-982288608999


No 138
>pfam01902 ATP_bind_4 ATP-binding region. This family of proteins probably binds ATP. This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N terminus.In some members of this family, this domain is associated with pfam01042.
Probab=89.70  E-value=1.8  Score=23.48  Aligned_cols=134  Identities=19%  Similarity=0.268  Sum_probs=79.3

Q ss_pred             CEEEEECCCHHH--HHHHHHHHHCCCCCEEE-EECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE---CCCHHH
Q ss_conf             958998865889--99999998589967899-954983575117055128789899999998718979999---795578
Q gi|254780206|r    1 MRVLLIGSGGRE--HALAWKIAQSPLLSELW-SIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV---GPELPL   74 (424)
Q Consensus         1 MkILviGsGgrE--hAl~~~l~~s~~~~~v~-~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv---gpE~pL   74 (424)
                      ||+.++=|||.-  +||-+++++ ..+..+. +.|.|+      +.+.......+-+...|+...+.++.+   |.+.--
T Consensus         1 MK~~~l~SGGKDS~~Al~~a~~~-~~v~~L~t~~~~~~------ds~~~H~~~~~l~~~qA~algiPl~~~~~~~~~e~~   73 (219)
T pfam01902         1 MKVAALYSGGKDSNYALYWALKE-IEVPYLVSMKSENK------ESYMFHEPNLHLTKLLAEALGIPIIKLYTKGEEEKE   73 (219)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHC-CCCEEEEEEEECCC------CCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCHHHH
T ss_conf             93999972869999999999871-98379999963799------810261578899999999759968999679861799


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH--CCCCCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             748998986058806701066655520102357888765310--11112234401111121012420256304
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP--TATYQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP--t~~~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                      ...+...+++.|+..+.-.  +..++.-|.+-.++|.+.|+-  +|-|.  .+.+++..-+-..||-.+|...
T Consensus        74 ~~~L~~~l~~~~i~~vv~G--dI~s~~qr~~~e~~c~~lgl~~~~PLW~--~d~~~ll~e~i~~Gf~aiIv~v  142 (219)
T pfam01902        74 VEDLAGFLESLDVDALVAG--AIYSEYQKSRIESVCRELGLKPFAPLWG--RDPRKLAEEIVREGFEVAIVAV  142 (219)
T ss_pred             HHHHHHHHHHCCCCEEEEC--CCCCHHHHHHHHHHHHHCCCEEEECCCC--CCHHHHHHHHHHCCCEEEEEEE
T ss_conf             9999999987598699998--6036889999999999729889710348--9999999999987994999998


No 139
>pfam00899 ThiF ThiF family. This family contains a repeated domain in ubiquitin activating enzyme E1 and members of the bacterial ThiF/MoeB/HesA family.
Probab=89.66  E-value=1.8  Score=23.46  Aligned_cols=109  Identities=19%  Similarity=0.239  Sum_probs=54.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHCCEE-----EECCCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             5899886588999999998589967899954-98357511705-----51287898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP-GNPGIAQHAQC-----VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~~~~-----~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      ||||+|-||--..+++.|.++. +.++.++. +.-....+..+     ..+-..-.+.+.+..++.+++.-+..-...+.
T Consensus         3 kVlivG~GglG~~~~~~La~~G-vg~i~lvD~D~ve~sNL~Rq~l~~~~diG~~Ka~~~~~~l~~~np~~~i~~~~~~i~   81 (134)
T pfam00899         3 RVLVVGAGGLGSPAAEYLARAG-VGKLTLVDFDTVELSNLNRQILFTESDIGKPKAEVAKERLRAINPDVEVEAYPERLT   81 (134)
T ss_pred             EEEEECCCHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCCCCEEECCHHHCCCEEHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             8999898889999999999938-974999989567632227224233646688107999999997789958999925679


Q ss_pred             -HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             -48998986058806701066655520102357888765310
Q gi|254780206|r   76 -NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        76 -~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP  116 (424)
                       .-+.+.+....+=+-+-...     ..|.+.-+++.++++|
T Consensus        82 ~~~~~~~~~~~DvVi~~~Dn~-----~~r~~ln~~c~~~~ip  118 (134)
T pfam00899        82 PENLEELLKGADLVVDALDNF-----AARYLLNDACVKRGIP  118 (134)
T ss_pred             HHHHHHCCCCCCEEEECCCCH-----HHHHHHHHHHHHCCCC
T ss_conf             778764264488999998999-----9999999999985998


No 140
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional
Probab=89.58  E-value=1.8  Score=23.41  Aligned_cols=84  Identities=17%  Similarity=0.111  Sum_probs=52.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCC-EEE--EECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEEC---CCHHHH
Q ss_conf             5899886588999999998589967-899--9549835751170551287898999999987189799997---955787
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLS-ELW--SIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVG---PELPLV   75 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~-~v~--~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivg---pE~pL~   75 (424)
                      +|+|+|+|-.-..++..++++|... ++.  +....++.    ..++ -.-+.+++.+++++++||-|++.   .+.+-.
T Consensus       146 ~v~IvG~~~~~~~l~~~i~~~p~~G~~vvG~~dd~~~~~----~~~~-~lG~~~~l~~~~~~~~id~V~ialp~~~~~~i  220 (464)
T PRK10124        146 MVAVAGDLPAGQMLLESFRNQPWLGFEVVGVYHDPKPGG----VSND-WAGNLQQLVEDAKAGKIHNVYIAMSMCDGARV  220 (464)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCC----CCCC-CCCCHHHHHHHHHHCCCCEEEEECCCCHHHHH
T ss_conf             899983888999999999729667966999966887666----7899-87899999999986899989996682368899


Q ss_pred             HHHHHHHHHCCCCEE
Q ss_conf             489989860588067
Q gi|254780206|r   76 NGISDALNAAGFKVF   90 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~   90 (424)
                      ..+.+.|+..++.+.
T Consensus       221 ~~lv~~l~~~~v~v~  235 (464)
T PRK10124        221 KKLVHQLADTTCSVL  235 (464)
T ss_pred             HHHHHHHHHCCCEEE
T ss_conf             999999961895599


No 141
>PRK05562 precorrin-2 dehydrogenase; Provisional
Probab=89.57  E-value=1.3  Score=24.46  Aligned_cols=48  Identities=15%  Similarity=0.190  Sum_probs=24.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCE
Q ss_conf             95899886588999999998589967899954983575117055128789899999998718979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDL   65 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDl   65 (424)
                      |||||||+|--..-=+..|.+....-. .++|                .-.+++.+++++.++.+
T Consensus        25 lkvLVVGGG~VA~RKi~~Ll~agA~Vt-VVSP----------------~~~~el~~L~~~~~I~~   72 (222)
T PRK05562         25 IKVLVIGGGKAAFIKGKTFLKKGCYVE-ILSK----------------EFSKEFLDLKKYGNLKL   72 (222)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEE-EECC----------------CCCHHHHHHHHCCCEEE
T ss_conf             669999987999999999987899899-9878----------------66889999997598699


No 142
>TIGR03013 EpsB_2 sugar transferase, PEP-CTERM system associated. Members of this protein family belong to the family of bacterial sugar transferases (pfam02397). Nearly all are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria (notable exceptions appear to include Magnetococcus sp. MC-1 and Myxococcus xanthus DK 1622 ). These genes are generally found near one or more of the PrsK, PrsR or PrsT genes that have been related to the PEP-CTERM system by phylogenetic profiling methods. The nature of the sugar transferase reaction catalyzed by members of this clade is unknown and may conceivably be variable with respect to substrate by species. These proteins are homologs of the EpsB protien found in Methylobacillus sp. strain 12S, which is also associated with a PEP-CTERM system, but of a distinct type. A name which appears attached to a number of genes (by transitive annotation) in this family is "undecapre
Probab=89.46  E-value=1.8  Score=23.36  Aligned_cols=64  Identities=23%  Similarity=0.416  Sum_probs=36.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCC-EEE--E-ECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             5899886588999999998589967-899--9-549835751170551287898999999987189799997
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLS-ELW--S-IPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~-~v~--~-~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      ||+|||+|.+...++..+.+.+... ++.  + .++++..  .....  -..+.+.+.+++.++++|-|++.
T Consensus       126 rvliiG~~~~a~~l~~~l~~~~~~g~~v~G~~~~~~~~~~--~~~~~--~i~~~~~l~~~~~~~~ideV~ia  193 (442)
T TIGR03013       126 RILVLGTGPRAREIARLRRSSDRRGHEIVGFVPLPDEPAY--VPSEH--VIENGDGLVEYVLRHRIDEIVIA  193 (442)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCC--CCCCC--CCCCHHHHHHHHHHCCCCEEEEE
T ss_conf             6999977199999999986197798189999967986334--67666--57877899999996899999996


No 143
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=89.35  E-value=0.79  Score=25.97  Aligned_cols=83  Identities=22%  Similarity=0.298  Sum_probs=46.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHH--H-HH---CC-EEEEC-CCCCHHHHHHHHHHHCCCEEEECCCH-
Q ss_conf             58998865889999999985899678999549835--7-51---17-05512-87898999999987189799997955-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG--I-AQ---HA-QCVAI-DIQNHSAIIHFCQEKHIDLVVVGPEL-   72 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g--~-~~---~~-~~~~i-~~~d~~~i~~~a~~~~iDlvivgpE~-   72 (424)
                      ||||+|-|.---|++.-|.+...  +|++...++.  . ..   .. ....+ ...+.+ +     -.++|+||+.|-. 
T Consensus         9 ~vlV~GlG~sG~a~a~~L~~~G~--~V~~~D~~~~~~~~~~l~~~~~~~~~~~g~~~~~-~-----~~~~d~vV~SPGI~   80 (501)
T PRK02006          9 MVLVLGLGESGLAMARWCARHGC--RLRVADTREAPPNLAALQAEGIDAEFVGGAFDPA-L-----LDGVELVALSPGLS   80 (501)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCCCCCHHHHHHCCCCCEEECCCCCHH-H-----HCCCCEEEECCEEC
T ss_conf             39998336889999999997898--4999989999861999986089818977889867-8-----46899999899008


Q ss_pred             ---HHHHHHHHHHHHCCCCEEEC
Q ss_conf             ---78748998986058806701
Q gi|254780206|r   73 ---PLVNGISDALNAAGFKVFGP   92 (424)
Q Consensus        73 ---pL~~gi~d~l~~~gi~v~Gp   92 (424)
                         |...-+....++.|+||++=
T Consensus        81 p~~p~~~~~l~~A~~~gi~i~~e  103 (501)
T PRK02006         81 PLEPALAALLAAARERGIPVWGE  103 (501)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEH
T ss_conf             88854319999999879958768


No 144
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain. This Pfam entry contains the following members: N-acetyl-glutamine semialdehyde dehydrogenase (AgrC) Aspartate-semialdehyde dehydrogenase
Probab=89.29  E-value=1.2  Score=24.68  Aligned_cols=82  Identities=21%  Similarity=0.290  Sum_probs=49.1

Q ss_pred             EEEEEC-CC--HHHHHHHHHHHHCCCCCEEEEE-C-CCHHHHHC--C------EEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             589988-65--8899999999858996789995-4-98357511--7------055128789899999998718979999
Q gi|254780206|r    2 RVLLIG-SG--GREHALAWKIAQSPLLSELWSI-P-GNPGIAQH--A------QCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         2 kILviG-sG--grEhAl~~~l~~s~~~~~v~~~-p-gN~g~~~~--~------~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      ||.||| +|  |.|  |.+-|.+.|.++-+++. . ...|...-  .      ....+...+.      ..-.++|++|.
T Consensus         1 kvaIiGatGyvG~e--LirlL~~hp~~~i~~l~~s~~saG~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~Dvvf~   72 (121)
T pfam01118         1 KVAIVGATGYVGQE--LLRLLAEHPPLELVALVASSRSAGKKVAFAGPWLTGGVDLLLEDVDP------EDLKDVDIVFF   72 (121)
T ss_pred             CEEEECCCHHHHHH--HHHHHHCCCCCCCEEEEEECCCCCCCHHHHCCCCCCCCCCEEEECCH------HHHCCCCEEEE
T ss_conf             99998936199999--99999718875513788505658960144165424666644775897------78538989998


Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             79557874899898605880670
Q gi|254780206|r   69 GPELPLVNGISDALNAAGFKVFG   91 (424)
Q Consensus        69 gpE~pL~~gi~d~l~~~gi~v~G   91 (424)
                      .-....+..++..|.+.|++||-
T Consensus        73 alp~~~s~~~~~~~~~~g~~VID   95 (121)
T pfam01118        73 ALPAGVSKELAPKLLEAGAVVID   95 (121)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             38768999999998715989987


No 145
>PRK08507 prephenate dehydrogenase; Validated
Probab=89.27  E-value=1.9  Score=23.26  Aligned_cols=64  Identities=20%  Similarity=0.286  Sum_probs=41.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEE-ECCC-CCHHHHHHHHHHHCCCEEEECC
Q ss_conf             95899886588999999998589967899954983575117055-1287-8989999999871897999979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCV-AIDI-QNHSAIIHFCQEKHIDLVVVGP   70 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~-~i~~-~d~~~i~~~a~~~~iDlvivgp   70 (424)
                      |||+|||-|=---.|+.+|++.....+|+-..-|+.+...+... .+|. .+.+.+      .+.|+||+.-
T Consensus         1 M~I~IiGlGLiGgSla~alk~~~~~~~V~g~d~~~~~~~~A~~~g~id~~~~~~~i------~~aDlVila~   66 (275)
T PRK08507          1 MKIGIIGLGLMGGSLGLALKENKLISCVYGYDHNEEHEKDALDLGLVDEIVEFEEI------KECDVIFLAI   66 (275)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCCCCCCHHHC------CCCCEEEEEC
T ss_conf             98999900878999999999509986799995999999999986998610673123------6579899917


No 146
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=88.80  E-value=2  Score=23.04  Aligned_cols=91  Identities=10%  Similarity=0.109  Sum_probs=49.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH------HHC-CEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             589988658899999999858996789995498357------511-7055128789899999998718979999795578
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI------AQH-AQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~------~~~-~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      ||+|+|-|.---|++.-|.+...  +|.+...+..-      ..+ ...+.+..-+.  -.+..  .++|+||+.|-.|.
T Consensus        16 kv~i~GlG~sG~a~a~~L~~~g~--~v~~~D~~~~~~~~~~~~~l~~~gi~~~~g~~--~~~~~--~~~d~vv~SPgI~~   89 (458)
T PRK01710         16 KVAVVGIGVSNIPLIKFLVKLGA--KVTAFDKKSEEELGEISLELKEKGVNLELGEN--YLDKL--TGFDVIFKTPSMRI   89 (458)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCCHHHHHHHHHHHHCCCEEEECCC--HHHHC--CCCCEEEECCCCCC
T ss_conf             69999787889999999997889--79999898843148999999857998995784--05423--78888998998799


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             748998986058806701066655
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAK   98 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~   98 (424)
                      ..-......+.|+++.+--....+
T Consensus        90 ~~p~~~~a~~~gi~v~~e~el~~~  113 (458)
T PRK01710         90 DSPELVKAKEEGAYITSEMEEFIK  113 (458)
T ss_pred             CCHHHHHHHHCCCCEECHHHHHHH
T ss_conf             899999999879937409999986


No 147
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed
Probab=88.67  E-value=2.1  Score=22.98  Aligned_cols=113  Identities=21%  Similarity=0.405  Sum_probs=66.3

Q ss_pred             CEEEEECCC--HHHHH--HHHHHHH-CCCCCEEEEECCCHHHHHCCEEEECCCCCH-------------------HHHHH
Q ss_conf             958998865--88999--9999985-899678999549835751170551287898-------------------99999
Q gi|254780206|r    1 MRVLLIGSG--GREHA--LAWKIAQ-SPLLSELWSIPGNPGIAQHAQCVAIDIQNH-------------------SAIIH   56 (424)
Q Consensus         1 MkILviGsG--grEhA--l~~~l~~-s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~-------------------~~i~~   56 (424)
                      |||+|+-+=  |=-||  |..+|++ .+.+ +++ .-|-+.|...+-...+|+++.                   ..+.+
T Consensus         2 mkifi~aGE~SGD~~ga~li~~Lk~~~~~~-~~~-GiGG~~M~~~G~~~l~d~~~l~vmG~~evl~~~~~~~~~~~~~~~   79 (382)
T PRK00025          2 LRIAIVAGEVSGDLLGAGLIRALKAQAPNL-EFV-GIGGPRMEAAGFESLFDMEELAVMGLVEVLPRLPRLLKIRKELKR   79 (382)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCC-EEE-EECCHHHHHCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             489999068418899999999998319896-799-988299997699544775783130199999779999999999999


Q ss_pred             HHHHHCCCEEEE-C-CCHHHHHHHHHHHHHC--CCCEE---ECCH------HHHHHH--HCCH-----HHHHHHHHHHHH
Q ss_conf             998718979999-7-9557874899898605--88067---0106------665552--0102-----357888765310
Q gi|254780206|r   57 FCQEKHIDLVVV-G-PELPLVNGISDALNAA--GFKVF---GPSQ------RAAKLE--SSKS-----FAKKFCTKYGIP  116 (424)
Q Consensus        57 ~a~~~~iDlviv-g-pE~pL~~gi~d~l~~~--gi~v~---Gp~~------~aa~le--~sK~-----~~K~~l~~~gIP  116 (424)
                      .+++++||.+|. . |+  ..--++..+++.  |+|++   .|+-      ++-.+.  -|+.     |-.++++++|++
T Consensus        80 ~i~~~~Pd~vi~ID~pg--Fnlrlak~lkk~~~~ipvi~yv~PqvWAWr~~R~k~~~~~~D~ll~ifPFE~~~f~~~g~~  157 (382)
T PRK00025         80 LLLAEPPDVFILIDAPD--FNLRLAKKLKKALPGIPIIHYVSPSVWAWRPGRAKKIAKATDHVLAILPFEAAFYDKLGVP  157 (382)
T ss_pred             HHHHCCCCEEEEECCCH--HHHHHHHHHHHHCCCCCEEEEECCHHHHCCCCHHHHHHHHHHHHHCCCCCCHHHHHHCCCC
T ss_conf             99864999999977830--6599999999716999889994715654064189999999987610876568999865998


Q ss_pred             C
Q ss_conf             1
Q gi|254780206|r  117 T  117 (424)
Q Consensus       117 t  117 (424)
                      +
T Consensus       158 ~  158 (382)
T PRK00025        158 V  158 (382)
T ss_pred             C
T ss_conf             1


No 148
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins. This family includes classical ubiquitin-activating enzymes E1, ubiquitin-like (ubl) activating enzymes and other mechanistic homologes, like MoeB, Thif1 and others. The common reaction mechanism catalyzed by MoeB, ThiF and the E1 enzymes begins with a nucleophilic attack of the C-terminal carboxylate of MoaD, ThiS and ubiquitin, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS.
Probab=88.62  E-value=2.1  Score=22.95  Aligned_cols=113  Identities=18%  Similarity=0.248  Sum_probs=59.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHCCEE-----EECCCCCHHHHHHHHHHHCCCEEEECCCHHH-
Q ss_conf             5899886588999999998589967899954-98357511705-----5128789899999998718979999795578-
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP-GNPGIAQHAQC-----VAIDIQNHSAIIHFCQEKHIDLVVVGPELPL-   74 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~~~~-----~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL-   74 (424)
                      ||||+|-||--..+++.|.+++- .++.++. +.-....+..+     ..+-..-.+...+..++.+++.-+..-...+ 
T Consensus         1 kVlivG~GglG~~va~~L~~~Gv-~~i~ivD~D~v~~~Nl~Rq~~~~~~dvG~~Ka~~a~~~l~~~np~v~i~~~~~~~~   79 (143)
T cd01483           1 RVLLVGLGGLGSEIALNLARSGV-GKITLIDFDTVELSNLNRQFLARQADIGKPKAEVAARRLNELNPGVNVTAVPEGIS   79 (143)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCHHHHCCHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             99999979899999999999379-71999978987500146422589889492248999999985689838999945689


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCC
Q ss_conf             7489989860588067010666555201023578887653101111
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY  120 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~  120 (424)
                      ..-..+.++...+-+-+-...     .+|...-+++.++++|.-..
T Consensus        80 ~~~~~~~~~~~dvvi~~~D~~-----~~r~~l~~~~~~~~ip~i~~  120 (143)
T cd01483          80 EDNLDDFLDGVDLVIDAIDNI-----AVRRALNRACKELGIPVIDA  120 (143)
T ss_pred             HHHHHHHHCCCCEEEECCCCH-----HHHHHHHHHHHHCCCCEEEE
T ss_conf             646999975999999877999-----99999999999869988996


No 149
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase   A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (), spermine synthase () and putrescine N-methyltransferase () .   The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity.
Probab=88.44  E-value=0.47  Score=27.59  Aligned_cols=65  Identities=26%  Similarity=0.415  Sum_probs=34.9

Q ss_pred             EEEEECCC-H---HHHHHHHHHHHCCCCCEEEEE--------------CCCH-HHHHCCEEEECCCCCH-HHHHHH---H
Q ss_conf             58998865-8---899999999858996789995--------------4983-5751170551287898-999999---9
Q gi|254780206|r    2 RVLLIGSG-G---REHALAWKIAQSPLLSELWSI--------------PGNP-GIAQHAQCVAIDIQNH-SAIIHF---C   58 (424)
Q Consensus         2 kILviGsG-g---rEhAl~~~l~~s~~~~~v~~~--------------pgN~-g~~~~~~~~~i~~~d~-~~i~~~---a   58 (424)
                      ||||||+| |   ||=      .|=+.|+++.++              |.-. | +.-.+++.+.+.|- +-|.+.   -
T Consensus        78 ~VLvIGGGDGG~lREV------~KH~sVE~~~lVdID~~VI~~srkyLP~~~~g-~~dderv~~~i~DG~~fl~~~Gasd  150 (284)
T TIGR00417        78 KVLVIGGGDGGVLREV------VKHKSVEKATLVDIDEKVIELSRKYLPKLAAG-SFDDERVDLAIDDGFKFLRDTGASD  150 (284)
T ss_pred             EEEEEECCCCCEEEEE------EECCCCCEEEEEECCHHHHHHHHHHCHHHHCC-CCCCCEEEEEECCCHHHHHHCCCCC
T ss_conf             4789963888468788------75598167999972747899988826121056-6588803589825179897615222


Q ss_pred             HHHCCCEEEECCCHH
Q ss_conf             871897999979557
Q gi|254780206|r   59 QEKHIDLVVVGPELP   73 (424)
Q Consensus        59 ~~~~iDlvivgpE~p   73 (424)
                      -+++-|.+|+-+.+|
T Consensus       151 v~~~fDVIIvDstDP  165 (284)
T TIGR00417       151 VEKKFDVIIVDSTDP  165 (284)
T ss_pred             CCCCCCEEEEECCCC
T ss_conf             212144799727789


No 150
>cd07894 Adenylation_RNA_ligase The Adenylation domain of RNA circularization protein, which catalyzes the circularization of RNA molecules in an ATP-dependent reaction, comprises the enzyme's catalytic unit. RNA circularization protein is capable of circularizing RNA molecules in an ATP-dependent reaction. RNA circularization may protect RNA from exonuclease activity. This model comprises the adenylation domain, the minimal catalytic unit that is common to all members of the ATP-dependent DNA ligase family, and the carboxy-terminal extension of RNA circularization protein that serves as a dimerization module. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation of nicked nucleic acid substrates using the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. The adenylation domain binds ATP and contains many active site residues.
Probab=88.02  E-value=0.29  Score=29.12  Aligned_cols=114  Identities=21%  Similarity=0.313  Sum_probs=59.8

Q ss_pred             HHHHHHCCCEEEE----CCCHHHHHHHHHHHHHCCCCEEECCHH-HHHHHHCCHHHHHHHHHHHHHCCCC-CCCC--CCH
Q ss_conf             9998718979999----795578748998986058806701066-6555201023578887653101111-2234--401
Q gi|254780206|r   56 HFCQEKHIDLVVV----GPELPLVNGISDALNAAGFKVFGPSQR-AAKLESSKSFAKKFCTKYGIPTATY-QHFS--DPM  127 (424)
Q Consensus        56 ~~a~~~~iDlviv----gpE~pL~~gi~d~l~~~gi~v~Gp~~~-aa~le~sK~~~K~~l~~~gIPt~~~-~~~~--~~~  127 (424)
                      +|-+ ..+|++++    |||.|-+.+-...-+..++-+|---.. +.+.-.-+.. .+++++||+|+++. ..|+  +.+
T Consensus        94 ~fF~-d~P~lvLCgE~~GpeNPYv~~~~p~~edi~ffvFDi~~k~t~~~Lpv~er-~~L~e~Yglp~V~~fg~~~~~~~~  171 (340)
T cd07894          94 EFFD-DYPDLMLCGEVVGPENPYVPYDYPVAEDVGFFVFDIRKKNTGKPLPVEER-RELLEEYGLPHVRLFGTFTVDEVE  171 (340)
T ss_pred             HHHH-HCCCCEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCHHHH-HHHHHHCCCCCCCCCCEECHHHHH
T ss_conf             7786-58986899986068999978999875773189998668798985799999-999997399976441278399999


Q ss_pred             HHHHHHHCC---CC-EEEEEE-CC-CCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             111121012---42-025630-46-5343000232356778887887514
Q gi|254780206|r  128 KAKQYVQNK---SM-PIVVKA-DG-LCAGKGVVVAATVDEATSAIDRCFQ  171 (424)
Q Consensus       128 ea~~~~~~~---g~-PvVVKp-~~-~agGkGV~i~~~~~e~~~~~~~~~~  171 (424)
                      ++.+.+.++   |. =+|+|. ++ ..--|=++-..+..|+..+....|.
T Consensus       172 ~l~eiI~~L~~egrEGVVlKdp~~~~~~lKYtT~~~n~~Di~~~~~~~~d  221 (340)
T cd07894         172 ELKEIIRELDKEGREGVVLKDPDMRVPPLKYTTSSSNISDIRYAFRYPFD  221 (340)
T ss_pred             HHHHHHHHHHHCCCCEEEECCCCCCCCCCEEECCCCCHHHHHHHHHHHCC
T ss_conf             99999998735488318974866667851552376675889999863021


No 151
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional
Probab=88.01  E-value=2.3  Score=22.69  Aligned_cols=66  Identities=20%  Similarity=0.207  Sum_probs=42.4

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEECC-----CHHH-HH--C---CEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             958998865889-999999985899678999549-----8357-51--1---705512878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSIPG-----NPGI-AQ--H---AQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~pg-----N~g~-~~--~---~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      -||||.|+.|.= ..|++.|.+... ..++++..     |.-. ..  .   ...+..|..|.+.+.++.+++++|.|+
T Consensus         2 KkILVTGg~GFIGs~Lv~~Ll~~~~-~~v~~~d~~~~~~~~~~~~~~~~~~~~~~~~~Di~d~~~l~~~~~~~~pD~Vi   79 (355)
T PRK10217          2 RKILITGGAGFIGSALVRYIINETS-DAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDICDRAELARVFTEYQPDCVM   79 (355)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCC-CEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEE
T ss_conf             9699937875799999999997699-88999828987652544445412787169980058899999999861998899


No 152
>PRK07417 arogenate dehydrogenase; Reviewed
Probab=88.00  E-value=2.3  Score=22.68  Aligned_cols=62  Identities=18%  Similarity=0.234  Sum_probs=37.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEE-ECCC--CCHHHHHHHHHHHCCCEEEECC
Q ss_conf             95899886588999999998589967899954983575117055-1287--8989999999871897999979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCV-AIDI--QNHSAIIHFCQEKHIDLVVVGP   70 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~-~i~~--~d~~~i~~~a~~~~iDlvivgp   70 (424)
                      |||+|||-|=---.||.+|++..  .+|+-..-|+.+...+... .+|.  .+.+.    +  .+.|+||++.
T Consensus         2 mkI~IiGlGLIGgSla~al~~~~--~~V~g~d~~~~~~~~A~~~g~id~~~~~~~~----~--~~aDliila~   66 (280)
T PRK07417          2 MNIGIVGLGLIGGSLGLDLRSLG--HTVYGVSRRESTCERAIERGLVDEASTDLSL----L--KDCDLVILAL   66 (280)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHCCCCCEECCCHHH----H--CCCCEEEECC
T ss_conf             78999931857999999999689--9799997999999999986997520278746----0--5799899879


No 153
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed
Probab=87.68  E-value=2.4  Score=22.55  Aligned_cols=59  Identities=15%  Similarity=0.247  Sum_probs=34.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-CCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEE
Q ss_conf             958998865889999999985899-678999549835751170551287898999999987189799
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPL-LSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLV   66 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~-~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlv   66 (424)
                      |||+..|+.-.-+...++|.++.. +..|++.|..+.- . .+.  +   -...+.+||+++++.+.
T Consensus         1 mkI~f~Gt~~fs~~~L~~L~~~~~~i~~Vvt~pdk~~g-R-~~k--~---~~~~v~~~a~~~~i~~~   60 (309)
T PRK00005          1 MRIVFMGTPEFAVPSLKALLESGHEVVAVVTQPDRPAG-R-GKK--L---TPSPVKQLALEHGIPVL   60 (309)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCCCC-C-CCC--C---CCCHHHHHHHHCCCCEE
T ss_conf             98999889889999999999789947999929998668-9-997--9---89989999998699388


No 154
>PRK08340 glucose-1-dehydrogenase; Provisional
Probab=87.50  E-value=2.4  Score=22.48  Aligned_cols=65  Identities=18%  Similarity=0.249  Sum_probs=41.7

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHH-----H---CC--EEEECCCCCHHHHHHHHHH-----HCCC
Q ss_conf             958998865-88999999998589967899954983575-----1---17--0551287898999999987-----1897
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIA-----Q---HA--QCVAIDIQNHSAIIHFCQE-----KHID   64 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~-----~---~~--~~~~i~~~d~~~i~~~a~~-----~~iD   64 (424)
                      |||||-|++ |--.|+|++|.+...  +|++.--|..-.     +   ..  ..+..|..|.+.+.+++++     -++|
T Consensus         1 mnVlITGas~GIG~aiA~~la~~Ga--~V~i~~r~~~~l~~~~~~l~~~g~~~~~~~Dv~~~~~v~~~v~~~~~~~G~iD   78 (259)
T PRK08340          1 MNVLVTASSRGIGFNVARELLKKGA--RVVISSRNEENLEKALKELKELGEVYAIKADLSDKDDLKNLVKEAWELLGGID   78 (259)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCC
T ss_conf             9899975877899999999998799--99999799899999999987418879999636998999999999999859988


Q ss_pred             EEE
Q ss_conf             999
Q gi|254780206|r   65 LVV   67 (424)
Q Consensus        65 lvi   67 (424)
                      ..|
T Consensus        79 ~LV   81 (259)
T PRK08340         79 ALV   81 (259)
T ss_pred             EEE
T ss_conf             899


No 155
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=87.44  E-value=2.4  Score=22.45  Aligned_cols=86  Identities=20%  Similarity=0.302  Sum_probs=50.1

Q ss_pred             EEEECCCHH-HHHHHHHHHHCCCCCEEEEECCCHHH---H----HCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CC--
Q ss_conf             899886588-99999999858996789995498357---5----117055128789899999998718979999--79--
Q gi|254780206|r    3 VLLIGSGGR-EHALAWKIAQSPLLSELWSIPGNPGI---A----QHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GP--   70 (424)
Q Consensus         3 ILviGsGgr-EhAl~~~l~~s~~~~~v~~~pgN~g~---~----~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gp--   70 (424)
                      |||.|.-|. -.+++.+|.+...  +|.+.--|+..   .    .-.+.+..|..|.+.+.+..+  .+|.|+.  ++  
T Consensus         1 IlV~GatG~iG~~vv~~L~~~g~--~Vr~l~R~~~~~~~~~l~~~gve~v~gD~~d~~sl~~al~--gvd~v~~~~~~~~   76 (232)
T pfam05368         1 ILVFGATGYQGGSVVRASLKAGH--PVRALVRDPKSELAKSLKAAGVELVEGDLDDHESLVEALK--GVDVVFSVTGFWL   76 (232)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCC--CEEEEECCCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHC--CCCEEEEECCCCC
T ss_conf             09989682899999999985899--3899971873665666641798899906888789999967--9988999158874


Q ss_pred             CH--HHHHHHHHHHHHCCCCEEEC
Q ss_conf             55--78748998986058806701
Q gi|254780206|r   71 EL--PLVNGISDALNAAGFKVFGP   92 (424)
Q Consensus        71 E~--pL~~gi~d~l~~~gi~v~Gp   92 (424)
                      +.  ....-+.|+..+.|++-|=+
T Consensus        77 ~~~~~~~~~~~~AA~~aGVk~~V~  100 (232)
T pfam05368        77 SKEIEDGKKLADAAKEAGVKHFIP  100 (232)
T ss_pred             CHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             177999999999999739983455


No 156
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=87.39  E-value=2.4  Score=22.44  Aligned_cols=89  Identities=18%  Similarity=0.230  Sum_probs=48.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHH------HHHCC-EEEECCC-CCHHHHHHHHHHHCCCEEEECCCH
Q ss_conf             958998865889999999985899678999549835------75117-0551287-898999999987189799997955
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG------IAQHA-QCVAIDI-QNHSAIIHFCQEKHIDLVVVGPEL   72 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g------~~~~~-~~~~i~~-~d~~~i~~~a~~~~iDlvivgpE~   72 (424)
                      |||+|+|-|.---|.+.-|.+...  +|++..+++.      ...+. .-+.+.. .+.+.+.     ..+|++|+.|-.
T Consensus        15 k~v~V~GlG~sG~s~a~~L~~~G~--~v~~~D~~~~~~~~~~~~~l~~~g~~~~~g~~~~~~~-----~~~d~vV~SPGI   87 (481)
T PRK01438         15 LRVVVAGLGVSGFPAADALHELGA--SVTVVADGDDDRSRERAALLEVLGATVRLGDGETTLP-----EGTELVVTSPGW   87 (481)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCCCCCHHHHHHHHHCCCEEEECCCHHHHH-----CCCCEEEECCCC
T ss_conf             989999575889999999996799--8999979987448689998885498899688756662-----489999989978


Q ss_pred             HHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             787489989860588067010666
Q gi|254780206|r   73 PLVNGISDALNAAGFKVFGPSQRA   96 (424)
Q Consensus        73 pL~~gi~d~l~~~gi~v~Gp~~~a   96 (424)
                      |...-+....++.|+|+++=-.-+
T Consensus        88 ~~~~p~~~~a~~~gi~i~~eiel~  111 (481)
T PRK01438         88 RPTHPLLAAAAEAGIPVWGDVELA  111 (481)
T ss_pred             CCCCHHHHHHHHCCCCEECHHHHH
T ss_conf             998999999998699386189999


No 157
>PRK05752 uroporphyrinogen-III synthase; Validated
Probab=87.13  E-value=2.5  Score=22.34  Aligned_cols=30  Identities=30%  Similarity=0.335  Sum_probs=23.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             95899886588999999998589967899954
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      ++|||---.+...+|+.+|.+.+.  .++..|
T Consensus         4 ~rVLVTRP~~qa~~L~~~L~~~G~--~~~~~P   33 (255)
T PRK05752          4 WRLLLTRPAEDCAALAASLAEAGI--HSSSLP   33 (255)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCC--CEEECC
T ss_conf             789980977889999999997799--789728


No 158
>pfam02750 Synapsin_C Synapsin, ATP binding domain. Ca dependent ATP binding in this ATP grasp fold. Function unknown.
Probab=87.07  E-value=1.8  Score=23.37  Aligned_cols=145  Identities=13%  Similarity=0.184  Sum_probs=74.2

Q ss_pred             HHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC-CCCE
Q ss_conf             653101111223440111112101242025630465343000232356778887887514453177788775205-7523
Q gi|254780206|r  112 KYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGF-EVSF  190 (424)
Q Consensus       112 ~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~-E~Sv  190 (424)
                      +.+.|-..-..+.|..+   .+..-.||+|||--...+|-|-..++|..+..+...-++ -.+.-+-.|-|++.. .+.+
T Consensus        28 ~e~FPLIeQtyypn~ke---m~~~~~fPvVvKvGhah~G~GKvkven~~~fqD~~s~va-~~~~y~T~EPfid~kyDiri  103 (203)
T pfam02750        28 AEKFPLIEQTYYPNHKE---MLTTPTFPVVVKIGHAHSGMGKVKVDNHHDFQDIASVVA-LTKTYATTEPFIDSKYDIRV  103 (203)
T ss_pred             CCCCCCCEEECCCCHHH---HCCCCCCCEEEEECCCCCCEEEEEECCHHHHHHHHHHHH-HCCCEEEECCCCCCCEEEEE
T ss_conf             66677530002698777---425889888999754156235899607778888875772-13635886145454255885


Q ss_pred             EEECCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCEEECCCCCCCCCCEEEECCHHHHHHHHHHHC--CCEEEEEEEEEE
Q ss_conf             442157763103520001113-56654444434430000123443222010000089999986204--623566445448
Q gi|254780206|r  191 FALCDGKTAIPFTTARDHKRI-HDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIEGMQKE--QNPFQGVLFAGL  267 (424)
Q Consensus       191 ~~i~dG~~~~~l~~~~dyKr~-~~~d~GpnTGGMGa~~p~~~~~~~~~~~i~~~i~~~~~~~l~~~--~~~y~G~l~~~~  267 (424)
                      +-|  |.++..+      .|. -.++=--|||-+       .+    .+-.+.+--+.+++...+.  |++   +.-++.
T Consensus       104 QKI--G~~ykay------~R~sISgnWK~NtGSa-------mL----Eqi~mteryK~WvD~~S~lFGGLd---Icav~a  161 (203)
T pfam02750       104 QKI--GNNYKAY------MRTSISGNWKANTGSA-------ML----EQIAMSERYKLWVDTCSEMFGGLD---ICAVEA  161 (203)
T ss_pred             EEH--HHHHHHH------EECCCCCCCCCCCCHH-------HH----HHHHHHHHHHHHHHHHHHHCCCCE---EEEEEE
T ss_conf             200--0044766------1220037854470378-------88----650236899999999998738930---799987


Q ss_pred             EEECCE-EEEEEEEEE
Q ss_conf             985570-489998865
Q gi|254780206|r  268 MITEQG-PYLIEYNVR  282 (424)
Q Consensus       268 m~t~~g-p~viE~N~R  282 (424)
                      +..++| -|++|+|--
T Consensus       162 i~~KdGkeyIiEvnds  177 (203)
T pfam02750       162 LHGKDGRDYIIEVMDS  177 (203)
T ss_pred             EECCCCCEEEEEECCC
T ss_conf             7768887568996265


No 159
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only]
Probab=86.99  E-value=2.6  Score=22.28  Aligned_cols=135  Identities=20%  Similarity=0.259  Sum_probs=81.7

Q ss_pred             CEEEEECCCHHH--HHHHHHHHHCCCCCEEEE-ECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE---CCCHHH
Q ss_conf             958998865889--999999985899678999-54983575117055128789899999998718979999---795578
Q gi|254780206|r    1 MRVLLIGSGGRE--HALAWKIAQSPLLSELWS-IPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV---GPELPL   74 (424)
Q Consensus         1 MkILviGsGgrE--hAl~~~l~~s~~~~~v~~-~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv---gpE~pL   74 (424)
                      ||+.++=|||.-  +|+-|++.+...+..+.+ .|.|+      +..-...-|.+.+...|+--.+.++..   |.++-=
T Consensus         1 mk~~aL~SGGKDS~~Al~~a~~~G~eV~~Ll~~~p~~~------dS~m~H~~n~~~~~~~Ae~~gi~l~~~~~~g~~e~e   74 (223)
T COG2102           1 MKVIALYSGGKDSFYALYLALEEGHEVVYLLTVKPENG------DSYMFHTPNLELAELQAEAMGIPLVTFDTSGEEERE   74 (223)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHCCCEEEEEEEEECCCC------CEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCHHH
T ss_conf             96899981671889999999975983689999815998------704422225679999987448835998347630556


Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH--CCCCCCCCCCHHHHHHHHCCCCEE-EEEEC
Q ss_conf             748998986058806701066655520102357888765310--111122344011111210124202-56304
Q gi|254780206|r   75 VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP--TATYQHFSDPMKAKQYVQNKSMPI-VVKAD  145 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP--t~~~~~~~~~~ea~~~~~~~g~Pv-VVKp~  145 (424)
                      +.-+.+.|+..++-.+...  +.-.+--|.+...++.+.|+.  +|-|.  .|.++.....-+.||-+ ||+-+
T Consensus        75 ve~L~~~l~~l~~d~iv~G--aI~s~yqk~rve~lc~~lGl~~~~PLWg--~d~~ell~e~~~~Gf~~~Iv~Vs  144 (223)
T COG2102          75 VEELKEALRRLKVDGIVAG--AIASEYQKERVERLCEELGLKVYAPLWG--RDPEELLEEMVEAGFEAIIVAVS  144 (223)
T ss_pred             HHHHHHHHHHCCCCEEEEC--HHHHHHHHHHHHHHHHHHCCEEEECCCC--CCHHHHHHHHHHCCCEEEEEEEE
T ss_conf             9999999973763379973--4330999999999999729788512517--89899999999739859999984


No 160
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237   This family of conserved hypothetical proteins has no known function. Homologous proteins related to MJ0570 of Methanococcus jannaschii include both the apparent orthologs in the family, the much longer protein YLR143W from Saccharomyces cerevisiae (Baker's yeast), and second homologous proteins from Archaeoglobus fulgidus and Pyrococcus horikoshii that appear to represent a second orthologous group..
Probab=86.52  E-value=2.2  Score=22.79  Aligned_cols=134  Identities=22%  Similarity=0.276  Sum_probs=72.2

Q ss_pred             CEEEEECCCHHH--HHHHHHHHHCCCCCEE-EEECCCHHHH-HCCEEEECCCCCHHHHHHHHHHHCCCE---EEECCCHH
Q ss_conf             958998865889--9999999858996789-9954983575-117055128789899999998718979---99979557
Q gi|254780206|r    1 MRVLLIGSGGRE--HALAWKIAQSPLLSEL-WSIPGNPGIA-QHAQCVAIDIQNHSAIIHFCQEKHIDL---VVVGPELP   73 (424)
Q Consensus         1 MkILviGsGgrE--hAl~~~l~~s~~~~~v-~~~pgN~g~~-~~~~~~~i~~~d~~~i~~~a~~~~iDl---vivgpE~p   73 (424)
                      ||+-|+=|||.-  .||-|+|++...|..+ =+.|.|+-.- .+.  .++.+++     =.|+...|=|   =+-|-|+-
T Consensus         1 MkvAvLySGGKDS~~ALy~al~eG~eV~~LV~v~seN~eSyMfH~--pN~Hl~~-----l~AEavGiPL~klyt~GeeEk   73 (227)
T TIGR00289         1 MKVAVLYSGGKDSILALYKALEEGFEVKYLVGVISENEESYMFHV--PNVHLTD-----LVAEAVGIPLIKLYTSGEEEK   73 (227)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCEEEC--HHHHHHH-----HHHHHCCCCHHHHHCCCCCCC
T ss_conf             906898518713689999998628854785100028898620534--2578999-----999761766256302786521


Q ss_pred             HHHHHH---HHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH-CCCCCCCCCC-HHHHHHHHCCCCEEEEEEC
Q ss_conf             874899---8986058806701066655520102357888765310-1111223440-1111121012420256304
Q gi|254780206|r   74 LVNGIS---DALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP-TATYQHFSDP-MKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        74 L~~gi~---d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP-t~~~~~~~~~-~ea~~~~~~~g~PvVVKp~  145 (424)
                      =+..++   ..|.+.|+--+...+-.+  +--|..--.+|++.|+. .|+-+. .|. +-....++ .+|.+.|=..
T Consensus        74 EVedLag~l~~lderGvea~~~Ga~~S--~YQK~Rid~vCrelGlks~APLW~-~dPle~~~~~V~-e~F~v~iv~V  146 (227)
T TIGR00289        74 EVEDLAGQLEELDERGVEAVVIGAIES--EYQKSRIDKVCRELGLKSIAPLWH-KDPLEYLLEEVA-EKFEVIIVSV  146 (227)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECCEEC--CHHHHHHHHHHHHHCCHHCCCCCC-CCHHHHHHHHHH-CCCEEEEEEE
T ss_conf             176662155445530545478853410--112335778877714100276013-481799999862-3360899999


No 161
>pfam00551 Formyl_trans_N Formyl transferase. This family includes the following members. Glycinamide ribonucleotide transformylase catalyses the third step in de novo purine biosynthesis, the transfer of a formyl group to 5'-phosphoribosylglycinamide. Formyltetrahydrofolate deformylase produces formate from formyl- tetrahydrofolate. Methionyl-tRNA formyltransferase transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA. Inclusion of the following members is supported by PSI-blast. HOXX_BRAJA (P31907) contains a related domain of unknown function. PRTH_PORGI (P46071) contains a related domain of unknown function. Y09P_MYCTU (Q50721) contains a related domain of unknown function.
Probab=86.39  E-value=2.7  Score=22.07  Aligned_cols=68  Identities=15%  Similarity=0.172  Sum_probs=40.0

Q ss_pred             CEEEEE--CCCHHHHHHHHHHHHCCCC-CEEEEECCCHH--HHHC-----CEEEECCCCC-------HHHHHHHHHHHCC
Q ss_conf             958998--8658899999999858996-78999549835--7511-----7055128789-------8999999987189
Q gi|254780206|r    1 MRVLLI--GSGGREHALAWKIAQSPLL-SELWSIPGNPG--IAQH-----AQCVAIDIQN-------HSAIIHFCQEKHI   63 (424)
Q Consensus         1 MkILvi--GsGgrEhAl~~~l~~s~~~-~~v~~~pgN~g--~~~~-----~~~~~i~~~d-------~~~i~~~a~~~~i   63 (424)
                      |||.|+  |+|.--.||..++.+.... +-+.+...|+.  -...     .....++..+       -++++++.+++++
T Consensus         1 mkiavl~SG~Gsnl~~Il~a~~~~~l~~~I~~Visn~~~~~~~~~a~~~~ip~~~~~~~~~~~r~~~~~~~~~~l~~~~~   80 (181)
T pfam00551         1 MKIAVLISGTGSNLQALLDALRKGGHEVEIVAVVTNKDKAAGLERAEQAGIPVEVFEHKNFTPRSQFDSELADSLAALAP   80 (181)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             98999990796659999999981999988999995895728888999859998980677899834618999999997499


Q ss_pred             CEEEE
Q ss_conf             79999
Q gi|254780206|r   64 DLVVV   68 (424)
Q Consensus        64 Dlviv   68 (424)
                      |+++.
T Consensus        81 Dliv~   85 (181)
T pfam00551        81 DLIVL   85 (181)
T ss_pred             CEEEE
T ss_conf             99998


No 162
>PRK05693 short chain dehydrogenase; Provisional
Probab=86.32  E-value=2.8  Score=22.04  Aligned_cols=65  Identities=23%  Similarity=0.396  Sum_probs=40.7

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEECCCHHH-HH----CCEEEECCCCCHHHHHHHHHH-----HCCCEEE
Q ss_conf             958998865--8899999999858996789995498357-51----170551287898999999987-----1897999
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIPGNPGI-AQ----HAQCVAIDIQNHSAIIHFCQE-----KHIDLVV   67 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~pgN~g~-~~----~~~~~~i~~~d~~~i~~~a~~-----~~iDlvi   67 (424)
                      |||-+|=++  |--.|++.+|.+...  +|+..--|..- ..    ....+..|.+|.+++.+++++     -++|..|
T Consensus         1 MKvvlITGassGIG~alA~~la~~G~--~V~~~~R~~~~l~~l~~~~~~~~~~Dvtd~~~i~~~~~~~~~~~g~iDiLV   77 (274)
T PRK05693          1 MPVVLITGCSSGIGRALADAFKAAGY--EVWATARKAEDVEALAAAGFTAVQLDVNDGAALARLAEELEAEHQGLDVLI   77 (274)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99899948885899999999998799--999997999999999848991899846998999999999999729976899


No 163
>PRK00994 F420-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional
Probab=86.26  E-value=1.7  Score=23.49  Aligned_cols=80  Identities=21%  Similarity=0.350  Sum_probs=46.5

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEE-CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             8789899999998718979999-795578748998986058806701066655520102357888765310111122344
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVV-GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSD  125 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlviv-gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~  125 (424)
                      ++.+.+.+..-.+++++|++|+ +|- |            +.|  ||+           -+|+++++.|||+---...-.
T Consensus        44 ~pe~~~~v~~~~~~~~pDf~i~isPN-~------------a~P--GP~-----------~ARE~l~~~~iP~IvI~D~p~   97 (276)
T PRK00994         44 GPEEVERVVKKMKEWKPDFIIVISPN-P------------AAP--GPT-----------KAREILSAAGIPCIVIGDAPG   97 (276)
T ss_pred             CHHHHHHHHHHHHHHCCCEEEEECCC-C------------CCC--CCH-----------HHHHHHHHCCCCEEEECCCCC
T ss_conf             97899999999884089989997899-8------------899--956-----------799999756998899748853


Q ss_pred             CHHHHHHHHC--CCCEEEEEECCCCCCCCCC
Q ss_conf             0111112101--2420256304653430002
Q gi|254780206|r  126 PMKAKQYVQN--KSMPIVVKADGLCAGKGVV  154 (424)
Q Consensus       126 ~~ea~~~~~~--~g~PvVVKp~~~agGkGV~  154 (424)
                      .. .++.+++  +|| ++||+|-+-|-|--+
T Consensus        98 ~k-~kd~l~~~g~GY-Iivk~D~MIGARREF  126 (276)
T PRK00994         98 KK-KKDAMEEQGFGY-IIVKADPMIGARREF  126 (276)
T ss_pred             HH-HHHHHHHCCCCE-EEEECCCCCCHHHHC
T ss_conf             31-488998649847-998367544312320


No 164
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH; InterPro: IPR011909   Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system .    Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond.   Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed  that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro.    NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterised by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase .; GO: 0006118 electron transport, 0045454 cell redox homeostasis.
Probab=85.88  E-value=0.48  Score=27.55  Aligned_cols=37  Identities=24%  Similarity=0.499  Sum_probs=31.3

Q ss_pred             HHHHHHHHHHHHCCCCCC--CCCCHHHHHHHHCCCC---EEEEEE
Q ss_conf             357888765310111122--3440111112101242---025630
Q gi|254780206|r  105 FAKKFCTKYGIPTATYQH--FSDPMKAKQYVQNKSM---PIVVKA  144 (424)
Q Consensus       105 ~~K~~l~~~gIPt~~~~~--~~~~~ea~~~~~~~g~---PvVVKp  144 (424)
                      .+|++|.++||+   |..  ++...|+.+++.++||   |||++-
T Consensus        14 mTKk~L~~~~i~---Fe~inid~~pea~d~vk~lGF~~~PVi~~~   55 (72)
T TIGR02194        14 MTKKALEEHGIA---FEEINIDEQPEAVDYVKALGFRQVPVIVAE   55 (72)
T ss_pred             HHHHHHHHCCCC---EEEEECCCCHHHHHHHHHCCCEECCEEEEC
T ss_conf             577667637996---157635888437899987486307626767


No 165
>PRK07502 cyclohexadienyl dehydrogenase; Validated
Probab=85.79  E-value=2.9  Score=21.86  Aligned_cols=66  Identities=26%  Similarity=0.230  Sum_probs=40.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEE-CCCCCHHHHHHHHHHHCCCEEEECC
Q ss_conf             58998865889999999985899678999549835751170551-2878989999999871897999979
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQEKHIDLVVVGP   70 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~-i~~~d~~~i~~~a~~~~iDlvivgp   70 (424)
                      ||+|||-|=---.||.+|++.....+|+...-|+.+...+.... +|.. .+.+.+.+  ...|+||+.-
T Consensus         8 ~I~IiGlGLIGgSlA~alk~~~~~~~I~g~d~~~~~l~~A~~~g~id~~-~~~~~e~~--~~~DlIilat   74 (307)
T PRK07502          8 RVALIGLGLIGSSLARAIRRQGLAGEIVGAARSAETRARARELGLGDRV-TTSAAEAV--KGADLVILCV   74 (307)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCCHH-CCCHHHHH--CCCCEEEEEC
T ss_conf             6899927879999999998549985799984999999999986997511-27776640--4589799917


No 166
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed
Probab=85.22  E-value=1.8  Score=23.33  Aligned_cols=21  Identities=0%  Similarity=-0.175  Sum_probs=10.1

Q ss_pred             CCCCCHHHHHHHHHHHCCCEE
Q ss_conf             287898999999987189799
Q gi|254780206|r   46 IDIQNHSAIIHFCQEKHIDLV   66 (424)
Q Consensus        46 i~~~d~~~i~~~a~~~~iDlv   66 (424)
                      ++..+++..++..+..++...
T Consensus        42 v~~~~l~~~i~~l~~~~~~G~   62 (275)
T PRK00258         42 VPLDDLEDAVRGFFALGGKGA   62 (275)
T ss_pred             CCHHHHHHHHHHHHHCCCCEE
T ss_conf             888899999997776698779


No 167
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated
Probab=84.92  E-value=3.2  Score=21.58  Aligned_cols=31  Identities=29%  Similarity=0.472  Sum_probs=25.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             9589988658899999999858996789995
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSI   31 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~   31 (424)
                      |||.|||+|+---|||+.|.+...-..+|.-
T Consensus         2 mkI~ViGaGawGtAlA~~la~n~~~V~lw~r   32 (325)
T PRK00094          2 MKIAVLGAGSWGTALAILLARNGHDVVLWGR   32 (325)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             8899989899999999999978997899983


No 168
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). Members of this protein family are acetaldehyde dehydrogenase (acetylating), EC 1.2.1.10. This enzyme oxidizes acetaldehyde, using NAD(+), and attaches coenzyme A (CoA), yielding acetyl-CoA. It occurs as a late step in the meta-cleavage pathways of a variety of compounds, including catechol, biphenyl, toluene, salicylate, etc.
Probab=84.88  E-value=3.2  Score=21.57  Aligned_cols=88  Identities=20%  Similarity=0.271  Sum_probs=54.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEC---CCHHHHHCCE-EEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             95899886588999999998589967899954---9835751170-5512878989999999871897999979557874
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIP---GNPGIAQHAQ-CVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~p---gN~g~~~~~~-~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      +|+-|||||---.-|..|+.+|+..+-++++-   .-.|.....+ .+.....-++.+++   ...+|+||=...+.--.
T Consensus         2 ~~vAIiGsGnIGtDLm~Ki~rS~~le~~~~vG~dp~S~GL~rA~~lGv~~s~~Gid~ll~---~~~idiVFDATSA~aH~   78 (285)
T TIGR03215         2 VKVAIIGSGNIGTDLMYKLLRSEHLEMVAMVGIDPESDGLARARELGVKTSAEGVDGLLA---NPDIDIVFDATSAKAHA   78 (285)
T ss_pred             CEEEEECCCCHHHHHHHHHHCCCCCCEEEEEECCCCCHHHHHHHHCCCCCCCCCHHHHHH---CCCCCEEEECCCHHHHH
T ss_conf             369998998338999999866787216999824889828999998499663768898960---99978899669846799


Q ss_pred             HHHHHHHHCCCCEEE
Q ss_conf             899898605880670
Q gi|254780206|r   77 GISDALNAAGFKVFG   91 (424)
Q Consensus        77 gi~d~l~~~gi~v~G   91 (424)
                      --+..|++.|+.++-
T Consensus        79 ~h~~~l~~~g~~~ID   93 (285)
T TIGR03215        79 RHARLLAELGKIVID   93 (285)
T ss_pred             HHHHHHHHCCCEEEE
T ss_conf             999999975997997


No 169
>PRK06732 phosphopantothenate--cysteine ligase; Validated
Probab=84.86  E-value=2  Score=23.00  Aligned_cols=73  Identities=19%  Similarity=0.274  Sum_probs=43.5

Q ss_pred             CEEEEECCCHHH-----------------HHHHHHHHHCCCCCEEEEECCCHHHHH-CCEE-EECCCCCHHHHHHHHHHH
Q ss_conf             958998865889-----------------999999985899678999549835751-1705-512878989999999871
Q gi|254780206|r    1 MRVLLIGSGGRE-----------------HALAWKIAQSPLLSELWSIPGNPGIAQ-HAQC-VAIDIQNHSAIIHFCQEK   61 (424)
Q Consensus         1 MkILviGsGgrE-----------------hAl~~~l~~s~~~~~v~~~pgN~g~~~-~~~~-~~i~~~d~~~i~~~a~~~   61 (424)
                      |||||-++|-||                 +|||..+.+-+.  +|.+.-|...... ...+ -.+.....+++.+.+++.
T Consensus         1 ~kvLITaG~T~E~ID~VR~IsN~SSGk~G~aiA~~~~~~Ga--~Vtli~g~~~~~p~~~~~~~~i~v~ta~em~~~~~~~   78 (228)
T PRK06732          1 MKILITSGGTTEPIDAVRGITNHSTGQLGKIIAETFLQAGH--EVTLVTTKTAVKPEPHPNLSIIEIENVDDLLATLKPL   78 (228)
T ss_pred             CEEEEECCCCCCCCCCCCEECCCCHHHHHHHHHHHHHHCCC--EEEEEECCCCCCCCCCCCEEEEEECCHHHHHHHHHHH
T ss_conf             98999578876676884476767814999999999997899--8999956775688988985899945899999999974


Q ss_pred             --CCCEEEECCCHHHHHHHHHH
Q ss_conf             --89799997955787489989
Q gi|254780206|r   62 --HIDLVVVGPELPLVNGISDA   81 (424)
Q Consensus        62 --~iDlvivgpE~pL~~gi~d~   81 (424)
                        +.|.+|-      ++.++|+
T Consensus        79 ~~~~D~~I~------aAAVsDy   94 (228)
T PRK06732         79 VPHHDVLIH------SMAVSDY   94 (228)
T ss_pred             CCCCCEEEE------EEEECCC
T ss_conf             789999999------3181015


No 170
>cd01423 MGS_CPS_I_III Methylglyoxal synthase-like domain found in pyr1 and URA1-like carbamoyl phosphate synthetases (CPS), including ammonia-dependent CPS Type I, and glutamine-dependent CPS Type III. These are multidomain proteins, in which MGS is the C-terminal domain.
Probab=84.67  E-value=1.9  Score=23.19  Aligned_cols=62  Identities=24%  Similarity=0.371  Sum_probs=30.4

Q ss_pred             EEEE-ECCCHHHHH--HHHHHHHCCCCCEEEEECCCHHHHHC-----CEEEEC------CCCCHHHHHHHHHHHCCCEEE
Q ss_conf             5899-886588999--99999858996789995498357511-----705512------878989999999871897999
Q gi|254780206|r    2 RVLL-IGSGGREHA--LAWKIAQSPLLSELWSIPGNPGIAQH-----AQCVAI------DIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         2 kILv-iGsGgrEhA--l~~~l~~s~~~~~v~~~pgN~g~~~~-----~~~~~i------~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      +||+ |++--++.+  +++.|.+  .-.++|..+|   |+..     .++..+      ...+...++++.++.+||+||
T Consensus         2 nVliSv~d~dK~~~l~~a~~l~~--lGf~l~AT~G---Ta~~l~~~Gi~~~~v~k~~e~~~~~~p~i~d~i~~g~i~lVI   76 (116)
T cd01423           2 GILISIGSYSKPELLPTAQKLSK--LGYKLYATEG---TADFLLENGIPVTPVAWPSEEPQNDKPSLRELLAEGKIDLVI   76 (116)
T ss_pred             EEEEEEEHHHHHHHHHHHHHHHH--CCCEEEEEHH---HHHHHHHCCCCCEEEEEECCCCCCCCCCHHHHHHCCCEEEEE
T ss_conf             29999402038999999999998--7999998418---999999869965798786246789996699999769868999


Q ss_pred             E
Q ss_conf             9
Q gi|254780206|r   68 V   68 (424)
Q Consensus        68 v   68 (424)
                      =
T Consensus        77 N   77 (116)
T cd01423          77 N   77 (116)
T ss_pred             E
T ss_conf             8


No 171
>KOG1209 consensus
Probab=84.65  E-value=3.3  Score=21.50  Aligned_cols=58  Identities=24%  Similarity=0.318  Sum_probs=37.5

Q ss_pred             EEEEEC--CCHHHHHHHHHHHHCCCCCEEEE-ECCCHHHHHC-----CEEEECCCCCHHHHHHHHHHH
Q ss_conf             589988--65889999999985899678999-5498357511-----705512878989999999871
Q gi|254780206|r    2 RVLLIG--SGGREHALAWKIAQSPLLSELWS-IPGNPGIAQH-----AQCVAIDIQNHSAIIHFCQEK   61 (424)
Q Consensus         2 kILviG--sGgrEhAl~~~l~~s~~~~~v~~-~pgN~g~~~~-----~~~~~i~~~d~~~i~~~a~~~   61 (424)
                      +|||.|  +||.-|||+..+.+..-  .||. +..-.-|.++     .+..-.|..+.+++.++-.+.
T Consensus         9 ~VlItgcs~GGIG~ala~ef~~~G~--~V~AtaR~~e~M~~L~~~~gl~~~kLDV~~~~~V~~v~~ev   74 (289)
T KOG1209           9 KVLITGCSSGGIGYALAKEFARNGY--LVYATARRLEPMAQLAIQFGLKPYKLDVSKPEEVVTVSGEV   74 (289)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCE--EEEEECCCCCHHHHHHHHHCCEEEEECCCCHHHHHHHHHHH
T ss_conf             5999605776534999999986781--99997022460766788609705870568727789988888


No 172
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2; InterPro: IPR011179   This group represents the bacterial and archaeal isopentenyl-diphosphate delta-isomerase (IPP isomerase). IPP isomerase catalyses the interconversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), and is a key enzyme in the biosynthesis of isoprenoids via the mevalonate pathway. The bacterial and archaeal IPP isomerase (type 2 enzyme) differs from that found in eukaryotes (type 1 enzyme), and requires NADPH, magnesium, and FMN for activity , .; GO: 0004452 isopentenyl-diphosphate delta-isomerase activity, 0010181 FMN binding, 0008299 isoprenoid biosynthetic process, 0005737 cytoplasm.
Probab=84.59  E-value=2.3  Score=22.67  Aligned_cols=139  Identities=21%  Similarity=0.247  Sum_probs=72.8

Q ss_pred             EEEECCCCCHHHHHHHHHHHCCCEEE---ECCCHHH----------HHHHHHHHHHC----CCCEEECCHHHHHHHHCCH
Q ss_conf             05512878989999999871897999---9795578----------74899898605----8806701066655520102
Q gi|254780206|r   42 QCVAIDIQNHSAIIHFCQEKHIDLVV---VGPELPL----------VNGISDALNAA----GFKVFGPSQRAAKLESSKS  104 (424)
Q Consensus        42 ~~~~i~~~d~~~i~~~a~~~~iDlvi---vgpE~pL----------~~gi~d~l~~~----gi~v~Gp~~~aa~le~sK~  104 (424)
                      +..-+.--+...=-+.+++.+|+.-+   +|.+.+.          +.-++|.+++.    ++.   |-+|+.|-|+|+.
T Consensus        95 qraal~~P~~~~tF~~vR~~aP~~~l~AN~GA~q~~~~~~~~g~~~~~~aid~i~AdAL~iHlN---~~QE~vqpEGDr~  171 (349)
T TIGR02151        95 QRAALKDPEVAETFEVVREEAPNGPLIANIGAPQLVEGGKKYGVEEAQEAIDMIEADALAIHLN---VLQELVQPEGDRN  171 (349)
T ss_pred             HHHHHCCCHHHHHHHHHHHHCCCCCEEECCCHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHH---HHCCCCCCCCCHH
T ss_conf             2221127124666999997679833787178788740653448899999998751013355432---3302557999701


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHH---HH--CCCC--HHH
Q ss_conf             3578887653101111223440111112101242025630465343000232356778887887---51--4453--177
Q gi|254780206|r  105 FAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR---CF--QQIN--STV  177 (424)
Q Consensus       105 ~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~---~~--~~~~--~~V  177 (424)
                      |.+.++.+.                .+....+..|||||=.|    -|+.    ++.++...+-   ++  ...+  +-+
T Consensus       172 F~~G~l~~i----------------~~~~~~~~vPVIvKEvG----~G~S----~e~a~~L~~~Gv~aiDv~G~GGTswa  227 (349)
T TIGR02151       172 FSKGWLEKI----------------AEICSAVSVPVIVKEVG----FGIS----KEVAKLLADAGVKAIDVSGAGGTSWA  227 (349)
T ss_pred             HHHHHHHHH----------------HHHHHHCCCCEEEEECC----CCCC----HHHHHHHHHCCEEEEEECCCCCCCHH
T ss_conf             565389999----------------99996528987998215----7998----89999998789008870787675599


Q ss_pred             HHHHHHHCCC----C--CEEEECC-CC-CCCCCCCCCC
Q ss_conf             7887752057----5--2344215-77-6310352000
Q gi|254780206|r  178 IIEEYLEGFE----V--SFFALCD-GK-TAIPFTTARD  207 (424)
Q Consensus       178 liEefl~G~E----~--Sv~~i~d-G~-~~~~l~~~~d  207 (424)
                      -||.+=-..+    +  .-..|.| |- +.-.|--+|+
T Consensus       228 ~vE~~Rr~~~~~~~~~r~a~~f~~WGipT~~sL~~~~~  265 (349)
T TIGR02151       228 AVENYRRAKESNQKYERLASAFSDWGIPTAASLLEVRS  265 (349)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             99988751575235788877774148866899999864


No 173
>PRK00758 GMP synthase subunit A; Validated
Probab=84.19  E-value=3.4  Score=21.36  Aligned_cols=71  Identities=18%  Similarity=0.326  Sum_probs=44.1

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHHH
Q ss_conf             58998865-88999999998589967899954983575117055128789899999998718979999--7955787489
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNGI   78 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~gi   78 (424)
                      |||||-.| .--|-|++.|++-..  .+-+.|.              ....+.+    .+ ++|.+|.  ||+.+-+...
T Consensus         1 kIlviD~~dsft~ni~~~l~~~g~--~v~v~~~--------------~~~~~~i----~~-~~dgiilS~GP~~~~~~~~   59 (184)
T PRK00758          1 KILVINNGGQYNHLIHRTLRYLGV--DAKIIPN--------------TTPLEEI----KA-EPDGIILSGGPEIERAGNC   59 (184)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--EEEEEEC--------------CCCHHHH----HH-CCCEEEECCCCCCCCCCCH
T ss_conf             999998986389999999997899--2899959--------------8989999----63-8998998899983332206


Q ss_pred             HHHHHHCCCCEEECC
Q ss_conf             989860588067010
Q gi|254780206|r   79 SDALNAAGFKVFGPS   93 (424)
Q Consensus        79 ~d~l~~~gi~v~Gp~   93 (424)
                      .+.+.+.++|++|=.
T Consensus        60 ~~~i~~~~iPiLGIC   74 (184)
T PRK00758         60 EEYLLELDVPILGIC   74 (184)
T ss_pred             HHHHHHCCCCEEEEE
T ss_conf             999986599889971


No 174
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]
Probab=83.93  E-value=3.2  Score=21.58  Aligned_cols=13  Identities=38%  Similarity=0.399  Sum_probs=6.9

Q ss_pred             CCCEEECCHHHHH
Q ss_conf             8806701066655
Q gi|254780206|r   86 GFKVFGPSQRAAK   98 (424)
Q Consensus        86 gi~v~Gp~~~aa~   98 (424)
                      |+.|--|-|+++.
T Consensus        62 G~NVTiP~Ke~~~   74 (283)
T COG0169          62 GLNVTIPFKEAAL   74 (283)
T ss_pred             EEEECCCCHHHHH
T ss_conf             1698775688899


No 175
>COG2403 Predicted GTPase [General function prediction only]
Probab=83.85  E-value=3.5  Score=21.26  Aligned_cols=94  Identities=28%  Similarity=0.459  Sum_probs=56.9

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEE----EECCCHH------HH--HCCEEEEC-CCCCHHHHHHHHHHHCCCEE
Q ss_conf             958998865889-99999998589967899----9549835------75--11705512-87898999999987189799
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELW----SIPGNPG------IA--QHAQCVAI-DIQNHSAIIHFCQEKHIDLV   66 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~----~~pgN~g------~~--~~~~~~~i-~~~d~~~i~~~a~~~~iDlv   66 (424)
                      |+|+++|.|||- |-.-|++..++..+.+-    ..||-++      .+  .....++| ...|++.+.++++++.+|.+
T Consensus         7 kRviiLgaggrdfhv~n~a~r~~~~yevvaf~aaqiiG~~er~yppsleg~~~p~Gvpi~~~k~~~~lek~ire~~VD~~   86 (449)
T COG2403           7 KRVIILGAGGRDFHVFNVALRDNPEYEVVAFTAAQIIGGTERIYPPSLEGVLYPLGVPILPEKDYDDLEKIIREKDVDIV   86 (449)
T ss_pred             EEEEEEECCCCCCCHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCEE
T ss_conf             26999950675662246786068752478889988327766538997011323378330466468999999987076616


Q ss_pred             EEC-----CCHHHHHHHHHHHHHCC--CCEEECCHHH
Q ss_conf             997-----95578748998986058--8067010666
Q gi|254780206|r   67 VVG-----PELPLVNGISDALNAAG--FKVFGPSQRA   96 (424)
Q Consensus        67 ivg-----pE~pL~~gi~d~l~~~g--i~v~Gp~~~a   96 (424)
                      +..     +|.  .--++..+-++|  +..|||....
T Consensus        87 VlaySDvs~e~--v~~IaS~vLs~GA~f~~~gP~et~  121 (449)
T COG2403          87 VLAYSDVSYEH--VFRIASRVLSAGADFKELGPKETM  121 (449)
T ss_pred             EEECCCCCHHH--HHHHHHHHHHCCCEEEEECCCHHH
T ss_conf             87701289899--878999997478536872752776


No 176
>KOG2158 consensus
Probab=83.76  E-value=1  Score=25.12  Aligned_cols=53  Identities=13%  Similarity=0.168  Sum_probs=38.2

Q ss_pred             HHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHH
Q ss_conf             87653101111223440111112101242025630465343000232356778
Q gi|254780206|r  110 CTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEA  162 (424)
Q Consensus       110 l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~  162 (424)
                      =+++.+-+-.|..=..+.++.++.+....|.++|||+.+.|.|++...+..+.
T Consensus       199 peey~fyp~sw~lPa~l~df~a~~~~~KrtfivkpDsgaqg~giylisDir~~  251 (565)
T KOG2158         199 PEEYMFYPTSWRLPAPLCDFPASTEIMKRTFIVKPDSGAQGSGIYLISDIREK  251 (565)
T ss_pred             HHHHCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCCCCCCCCEEEECHHHHH
T ss_conf             48756777533376577777999997406578788888777640552022221


No 177
>pfam03652 UPF0081 Uncharacterized protein family (UPF0081).
Probab=83.76  E-value=1.6  Score=23.72  Aligned_cols=72  Identities=19%  Similarity=0.392  Sum_probs=46.9

Q ss_pred             CCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             89899999998718979999795578748998986058806701066655520102357888765310111122344011
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMK  128 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~e  128 (424)
                      .+.+.+.+++.+++|+.+|+|-  |+        ...|-       ...+-+.-+.|++.+-++.++|.--+..--+-.+
T Consensus        38 ~~~~~i~~ii~e~~i~~iVvGl--P~--------~~dG~-------~~~~~~~v~~f~~~L~~~~~i~v~~~DEr~TS~~  100 (134)
T pfam03652        38 PDLEELAELIKEWQPDGIVVGL--PL--------NMDGS-------EGEQTKRVRKFARRLKKRFGLPVELVDERLTTVE  100 (134)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEC--CC--------CCCCC-------CCHHHHHHHHHHHHHHHHHCCCEEEEECCCCHHH
T ss_conf             8999999999983999899955--89--------99988-------0889999999999999861998688634327999


Q ss_pred             HHHHHHCCC
Q ss_conf             111210124
Q gi|254780206|r  129 AKQYVQNKS  137 (424)
Q Consensus       129 a~~~~~~~g  137 (424)
                      |.+.+.+.+
T Consensus       101 A~~~l~~~~  109 (134)
T pfam03652       101 AERILREAG  109 (134)
T ss_pred             HHHHHHHCC
T ss_conf             999999737


No 178
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional
Probab=83.76  E-value=3.6  Score=21.24  Aligned_cols=65  Identities=18%  Similarity=0.187  Sum_probs=34.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEE-CCCHHHHHCCEEE-----ECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             589988658899999999858996789995-4983575117055-----12878989999999871897999
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSI-PGNPGIAQHAQCV-----AIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~-pgN~g~~~~~~~~-----~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      +|||||-||--..++.-|..+. +.++.++ ++.-....+...+     .+-..-.+...+..++.+++.-|
T Consensus        34 ~VlivG~GGlG~~~~~~La~aG-vg~i~lvD~D~ve~sNLnRQ~l~~~~diG~~Kv~~a~~~l~~inp~i~i  104 (245)
T PRK05690         34 RVLVVGLGGLGCAAAQYLAAAG-VGTLTLVDFDTVSLSNLQRQVLHDDATIGQPKVESAKAALARINPHIAI  104 (245)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCHHHHHCCCHHHCCCCHHHHHHHHHHHHCCCCCE
T ss_conf             7899877777899999999859-9659999688678886788864598778988799999999975887522


No 179
>COG0066 LeuD 3-isopropylmalate dehydratase small subunit [Amino acid transport and metabolism]
Probab=83.68  E-value=1.6  Score=23.78  Aligned_cols=26  Identities=12%  Similarity=0.084  Sum_probs=15.1

Q ss_pred             CCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             12234401111121012420256304
Q gi|254780206|r  120 YQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus       120 ~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                      |-.=+|.|.|--++...|+.+||-|+
T Consensus        72 FGcGSSREHApwALk~~Gi~~VIA~S   97 (191)
T COG0066          72 FGCGSSREHAPWALKDYGIRAVIAPS   97 (191)
T ss_pred             CCCCCCHHHHHHHHHHCCEEEEEECC
T ss_conf             77885277899999975924999362


No 180
>pfam02593 DUF166 Uncharacterized ArCR, COG1810.
Probab=83.32  E-value=3.7  Score=21.12  Aligned_cols=35  Identities=9%  Similarity=0.221  Sum_probs=17.9

Q ss_pred             HHHHHHHHHH--CCC-CCCC--CCCHHHHHHHHCCCCEEE
Q ss_conf             7888765310--111-1223--440111112101242025
Q gi|254780206|r  107 KKFCTKYGIP--TAT-YQHF--SDPMKAKQYVQNKSMPIV  141 (424)
Q Consensus       107 K~~l~~~gIP--t~~-~~~~--~~~~ea~~~~~~~g~PvV  141 (424)
                      |+.+++.|+-  +|+ +...  .......+|++.+|.|.+
T Consensus        93 k~~~e~~g~~~~~P~~~CsL~~~~~p~i~~F~~~FG~P~~  132 (215)
T pfam02593        93 KEQLEEFGVEVEFPEPFCSLEPVGNPVIDEFAERFGRPEL  132 (215)
T ss_pred             HHHHHHCCCEEECCCCCCCCCCCCCHHHHHHHHHHCCCEE
T ss_conf             9999975973877876557889888669999998199669


No 181
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents UDP-N-acetylmuramoylalanine-D-glutamate ligase (MurD). MurD catalyses the addition of d-glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-l-alanine. ; GO: 0005524 ATP binding, 0008764 UDP-N-acetylmuramoylalanine-D-glutamate ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=83.24  E-value=3.7  Score=21.10  Aligned_cols=119  Identities=19%  Similarity=0.284  Sum_probs=69.8

Q ss_pred             EEEEECCC--HHHHHHHHHHHHCCCCCEEEEECCCHHH----HHCCEEEE----CCCCCHHHHHHHHHHHCCCEEEECCC
Q ss_conf             58998865--8899999999858996789995498357----51170551----28789899999998718979999795
Q gi|254780206|r    2 RVLLIGSG--GREHALAWKIAQSPLLSELWSIPGNPGI----AQHAQCVA----IDIQNHSAIIHFCQEKHIDLVVVGPE   71 (424)
Q Consensus         2 kILviGsG--grEhAl~~~l~~s~~~~~v~~~pgN~g~----~~~~~~~~----i~~~d~~~i~~~a~~~~iDlvivgpE   71 (424)
                      ||||+|-|  ||--|++.=|.+...  .+++...-+..    ........    ....+..   +.-..+++|+||.-|=
T Consensus         1 ~i~i~GlG~tG~G~a~a~~L~~~g~--~~~~~D~~~~~~~~~~~~~~~~~~~~~l~~~~~~---~~~~~~~~d~vv~SPG   75 (476)
T TIGR01087         1 KILILGLGKTGRGVAVARFLKKKGA--EVTVTDDDPEEELERSKGQLKLSEGVVLYTGGKD---DLEDLNNADLVVLSPG   75 (476)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCC--EEEEEECCCCCCCCCHHHHCCCCCCEEEEECCCC---CCCCCCCCEEEEECCC
T ss_conf             9789986751078999999997298--7999984522134311331245564135326753---1012334207997898


Q ss_pred             HHHHHHHHHHHHHCCCCEEECCHHHHHHHH----CCH--------------HHHHHHHHHHHHCCCCCCCCC
Q ss_conf             578748998986058806701066655520----102--------------357888765310111122344
Q gi|254780206|r   72 LPLVNGISDALNAAGFKVFGPSQRAAKLES----SKS--------------FAKKFCTKYGIPTATYQHFSD  125 (424)
Q Consensus        72 ~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~----sK~--------------~~K~~l~~~gIPt~~~~~~~~  125 (424)
                      .|...-+...+.+.|+||.|==.-+.++..    .|.              +...+|++.|++++-.-.+..
T Consensus        76 i~~~hp~~~~a~~~g~~v~gdi~L~~~~~~~~~~~~~~aITGTnGKtTTT~L~~~~L~~~G~~a~~gGNIG~  147 (476)
T TIGR01087        76 IPPDHPLVQAAAKRGIPVVGDIELALRLVDFPEPAKVVAITGTNGKTTTTSLLYHLLKAAGLKAVLGGNIGT  147 (476)
T ss_pred             CCCCCHHHHHHHHCCCEEEEHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             986777999999669808986799997415789873799972686079999999999846997786257881


No 182
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=83.16  E-value=3.8  Score=21.07  Aligned_cols=82  Identities=12%  Similarity=0.200  Sum_probs=45.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH----HHCC-EEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             589988658899999999858996789995498357----5117-05512878989999999871897999979557874
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI----AQHA-QCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~----~~~~-~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      ||+|+|-|----|.+..|++-  . .+++..+....    .... ........+.       .-.++|++|+.|-.|+..
T Consensus         8 ~v~V~GlG~sG~a~~~~L~~~--~-~~~~~dd~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~d~iV~SPGI~~~~   77 (450)
T PRK01368          8 KIGVFGLGKTGISVYEELQNK--Y-DLIVYDDLKANRDIFEELFSKNAIIALSDS-------RWQNLDKIVLSPGIPLTH   77 (450)
T ss_pred             EEEEEEECHHHHHHHHHHHHC--C-CEEEEECCCCCHHHHHHHHCCCCEECCCCC-------CHHCCCEEEECCCCCCCC
T ss_conf             089995878799999999719--9-989998996564789975214836025711-------152199999899619989


Q ss_pred             HHHHHHHHCCCCEEECC
Q ss_conf             89989860588067010
Q gi|254780206|r   77 GISDALNAAGFKVFGPS   93 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~   93 (424)
                      -+...+++.|+|+++=-
T Consensus        78 p~~~~a~~~~i~i~~ei   94 (450)
T PRK01368         78 EIVKIAKNFNIPITSDI   94 (450)
T ss_pred             HHHHHHHHCCCCEEEHH
T ss_conf             99999998799587699


No 183
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=83.15  E-value=3.8  Score=21.07  Aligned_cols=63  Identities=14%  Similarity=0.192  Sum_probs=39.9

Q ss_pred             CEEEEECCCHH-HHHHHHHHHHCCCCCEEEEEC--C-CHH-HHH-CCEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             95899886588-999999998589967899954--9-835-751-1705512878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGR-EHALAWKIAQSPLLSELWSIP--G-NPG-IAQ-HAQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgr-EhAl~~~l~~s~~~~~v~~~p--g-N~g-~~~-~~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |||||.|+.|. -..|+..|.+...  +|.+.-  . +.. ... -.+.+.-|..|.+.+.+..+  .+|.||
T Consensus         1 MriLVTGgtGfiG~~l~~~L~~~G~--~V~~l~r~~~~~~~~~~~~~~~~~gDl~d~~~~~~~~~--~~d~Vi   69 (328)
T TIGR03466         1 MKVLVTGATGFVGSAVVRLLLERGE--EVRVLVRPTSDRRNLEGLDVEIVEGDLRDPASLRKALA--GCRALF   69 (328)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCCCCHHHHCCCCCEEEEEECCCHHHHHHHHH--CCCEEE
T ss_conf             9499986777999999999997849--89999899986556521797799820799999999971--785897


No 184
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators. The SalR binds to glucose based compound Salicin which is chemically related to aspirin. The ligand-binding of SalR is structurally homologous to the periplasmic sugar-binding domain of ABC-transporters and both domains contain the type I periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type I periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand bind
Probab=83.10  E-value=2.5  Score=22.40  Aligned_cols=14  Identities=21%  Similarity=0.337  Sum_probs=5.3

Q ss_pred             HHHHHHHHCCCEEE
Q ss_conf             99999871897999
Q gi|254780206|r   54 IIHFCQEKHIDLVV   67 (424)
Q Consensus        54 i~~~a~~~~iDlvi   67 (424)
                      +.+...+.++|.+|
T Consensus        48 ~~~~l~~~~vdGiI   61 (270)
T cd01545          48 VRALLQRSRVDGVI   61 (270)
T ss_pred             HHHHHHHCCCCEEE
T ss_conf             99999966999899


No 185
>pfam01993 MTD methylene-5,6,7,8-tetrahydromethanopterin dehydrogenase. This enzyme family is involved in formation of methane from carbon dioxide EC:1.5.99.9. The enzyme requires coenzyme F420.
Probab=82.93  E-value=3.8  Score=21.03  Aligned_cols=79  Identities=22%  Similarity=0.377  Sum_probs=43.4

Q ss_pred             CCHHHHH-HHHHHHCCCEEEE-CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             8989999-9998718979999-7955787489989860588067010666555201023578887653101111223440
Q gi|254780206|r   49 QNHSAII-HFCQEKHIDLVVV-GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDP  126 (424)
Q Consensus        49 ~d~~~i~-~~a~~~~iDlviv-gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~  126 (424)
                      .+.+.+. +..++.++|++|+ +|- |            ..|  ||+           -+|+++++.|||+---...-..
T Consensus        45 e~~e~~~~~~l~~~~pDf~i~isPN-~------------a~P--GP~-----------~ARE~l~~~giP~IvI~D~p~~   98 (276)
T pfam01993        45 ECVEEVVLDMLEEFEPDFVIYISPN-P------------AAP--GPK-----------KAREMLSDSGYPAVIIGDAPGL   98 (276)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEECCC-C------------CCC--CCH-----------HHHHHHHHCCCCEEEECCCCCH
T ss_conf             8899999999986189989997899-8------------899--956-----------7999997569987998378633


Q ss_pred             HHHHHHHHCCCCE-EEEEECCCCCCCCCC
Q ss_conf             1111121012420-256304653430002
Q gi|254780206|r  127 MKAKQYVQNKSMP-IVVKADGLCAGKGVV  154 (424)
Q Consensus       127 ~ea~~~~~~~g~P-vVVKp~~~agGkGV~  154 (424)
                       .+++.+++.||- ++||+|-+-|-|--+
T Consensus        99 -K~kd~l~~~g~GYIivk~D~MIGARREF  126 (276)
T pfam01993        99 -KVKDEMEEQGLGYILVKADPMIGARREF  126 (276)
T ss_pred             -HHHHHHHHCCCCEEEEECCCCCCHHHHC
T ss_conf             -2589998659847998367644312320


No 186
>TIGR02483 PFK_mixed phosphofructokinase; InterPro: IPR012829    Members of this family that are characterised, save one, are phosphofructokinases dependent on pyrophosphate (2.7.1.90 from EC) rather than ATP (2.7.1.11 from EC). The exception is one of three phosphofructokinases from Streptomyces coelicolor. Family members are both bacterial and archaeal.; GO: 0005524 ATP binding, 0008443 phosphofructokinase activity, 0006002 fructose 6-phosphate metabolic process, 0006096 glycolysis.
Probab=82.83  E-value=3.8  Score=21.01  Aligned_cols=127  Identities=20%  Similarity=0.297  Sum_probs=72.6

Q ss_pred             CCHHHHH-C---CEEEECCCCCHHHHHHHHHHHCCCEEE-ECCCHHHHHHHHHHHHHCC-CCEEECCHHHH--HHHHCCH
Q ss_conf             9835751-1---705512878989999999871897999-9795578748998986058-80670106665--5520102
Q gi|254780206|r   33 GNPGIAQ-H---AQCVAIDIQNHSAIIHFCQEKHIDLVV-VGPELPLVNGISDALNAAG-FKVFGPSQRAA--KLESSKS  104 (424)
Q Consensus        33 gN~g~~~-~---~~~~~i~~~d~~~i~~~a~~~~iDlvi-vgpE~pL~~gi~d~l~~~g-i~v~Gp~~~aa--~le~sK~  104 (424)
                      .||.-.+ .   .+.+..|.+  +.+++-+++.++|-.| ||-|..|  +++..|.+.| +||+|=+|.--  -.++|-.
T Consensus        75 ~NPF~~~~~~~~G~~v~~DvS--d~~~~n~~~~GlDAlIaIGGdGTL--~~A~~l~~~GGl~vVGVPKTIDNDl~~TD~T  150 (339)
T TIGR02483        75 TNPFKYEEDGEDGKTVVRDVS--DKIVANLKELGLDALIAIGGDGTL--GIARRLADKGGLPVVGVPKTIDNDLEATDYT  150 (339)
T ss_pred             CCCCCCCCCCCCCCEEEEECC--HHHHHHHHHCCCEEEEEECCCCHH--HHHHHHHHCCCCCEEEECCCCCCCCCCCCCE
T ss_conf             787420010579827997320--899998996498189986687268--9999999658985474157754675324402


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEE-----------ECCCCCCCCCCCH----HHHHHHHHHHHHH
Q ss_conf             357888765310111122344011111210124202563-----------0465343000232----3567788878875
Q gi|254780206|r  105 FAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVK-----------ADGLCAGKGVVVA----ATVDEATSAIDRC  169 (424)
Q Consensus       105 ~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVK-----------p~~~agGkGV~i~----~~~~e~~~~~~~~  169 (424)
                      |-        .-||..-..+-.+-+..-++++..=.||=           -+|+|||=-|.++    .|.++.-+.+++.
T Consensus       151 FG--------FDTAv~iATEAlDRLhtTAeSH~RVmVvEVMGRhAGWIAL~sG~aGGAd~ILIPE~P~d~~~v~~~v~~r  222 (339)
T TIGR02483       151 FG--------FDTAVEIATEALDRLHTTAESHHRVMVVEVMGRHAGWIALHSGIAGGADVILIPEIPFDIDSVCEKVRER  222 (339)
T ss_pred             EC--------CCCHHHHHHHHHHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHH
T ss_conf             22--------1007899999875240058731948999984854579998843520876789786048889999999999


Q ss_pred             HC
Q ss_conf             14
Q gi|254780206|r  170 FQ  171 (424)
Q Consensus       170 ~~  171 (424)
                      +.
T Consensus       223 ~~  224 (339)
T TIGR02483       223 FA  224 (339)
T ss_pred             HH
T ss_conf             87


No 187
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=82.82  E-value=3.9  Score=20.98  Aligned_cols=87  Identities=20%  Similarity=0.302  Sum_probs=55.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCC-EEEECCCCCHHHHHHHHHHHCCCEEEEC-CC--HHHHHH
Q ss_conf             5899886588999999998589967899954983575117-0551287898999999987189799997-95--578748
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA-QCVAIDIQNHSAIIHFCQEKHIDLVVVG-PE--LPLVNG   77 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~-~~~~i~~~d~~~i~~~a~~~~iDlvivg-pE--~pL~~g   77 (424)
                      ++||+|.|.-.-.|++++++++...-|-+...++-  ... +...+...-..++.+++++.+++.+++. |.  ..-..-
T Consensus       118 r~lIiGAG~ag~~l~r~~~~~~~~~pV~fiDdd~~--~~g~~i~Gv~V~g~~~i~~~v~~~~~~~iiiAips~~~~~~~~  195 (588)
T COG1086         118 RLLIIGAGSAGDLLLRALRRDPEYTPVAFLDDDPD--LTGMKIRGVPVLGRIEIERVVEELGIQLILIAIPSASQEERRR  195 (588)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHH--HCCCEEECEEEECHHHHHHHHHHCCCCEEEEECCCCCHHHHHH
T ss_conf             66999376589999999974899615999888736--5188770226423147999999718766999648788999999


Q ss_pred             HHHHHHHCCCCEE
Q ss_conf             9989860588067
Q gi|254780206|r   78 ISDALNAAGFKVF   90 (424)
Q Consensus        78 i~d~l~~~gi~v~   90 (424)
                      +.+.+.+.|+.|-
T Consensus       196 i~~~l~~~~~~v~  208 (588)
T COG1086         196 ILLRLARTGIAVR  208 (588)
T ss_pred             HHHHHHHCCCCEE
T ss_conf             9999875597078


No 188
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus. NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain.
Probab=82.36  E-value=4  Score=20.86  Aligned_cols=30  Identities=27%  Similarity=0.476  Sum_probs=25.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             958998865889999999985899678999
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWS   30 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~   30 (424)
                      +||.|||+|.--.||+..|.+......+|.
T Consensus         1 kKI~IiGaG~wGtAla~~la~n~~~V~l~~   30 (159)
T pfam01210         1 KKIAVLGAGSWGTALAKVLARNGHEVRLWG   30 (159)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             989999969999999999998799899999


No 189
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase; InterPro: IPR005766    delta l-pyrroline-5-carboxylate synthetase contains a glutamate 5-kinase (ProB, 2.7.2.11 from EC) region followed by a gamma-glutamyl phosphate reductase (ProA, 1.2.1.41 from EC) region and catalyses the first and second steps in proline biosynthesis.; GO: 0003824 catalytic activity, 0006561 proline biosynthetic process.
Probab=82.34  E-value=0.94  Score=25.44  Aligned_cols=11  Identities=27%  Similarity=0.561  Sum_probs=4.2

Q ss_pred             EEEEEEEEEEC
Q ss_conf             64454489855
Q gi|254780206|r  261 GVLFAGLMITE  271 (424)
Q Consensus       261 G~l~~~~m~t~  271 (424)
                      |--|+++|+|+
T Consensus       636 GSaHTD~IvtE  646 (738)
T TIGR01092       636 GSAHTDVIVTE  646 (738)
T ss_pred             CCCCCCEEEEC
T ss_conf             88424557846


No 190
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=82.29  E-value=1.8  Score=23.35  Aligned_cols=89  Identities=19%  Similarity=0.216  Sum_probs=48.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHH---HHHC---CEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             58998865889999999985899678999549835---7511---70551287898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG---IAQH---AQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g---~~~~---~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      ++||+|-|+---+++.-|.+...  +|++...+..   ...+   ...+.+..-+.+  .++  -.+.|++|+.|-.|..
T Consensus         9 ~~LV~G~G~sG~s~a~~L~~~G~--~V~~~D~~~~~~~~~~~~~~~~~i~~~~g~~~--~~~--~~~~d~vv~SPgI~~~   82 (448)
T PRK03803          9 LRIVVGLGKSGMSLVRFLARQGY--QFAVTDTRENPPELATLRRDYPQVEVRCGELD--AEF--LCQAEEIIVSPGLALA   82 (448)
T ss_pred             CEEEEEECHHHHHHHHHHHHCCC--EEEEEECCCCCHHHHHHHHHCCCCEEEECCCC--HHH--HCCCCEEEECCCCCCC
T ss_conf             58999989999999999997889--59999189991679999974799779978889--778--0789999989972999


Q ss_pred             HHHHHHHHHCCCCEEECCHHH
Q ss_conf             489989860588067010666
Q gi|254780206|r   76 NGISDALNAAGFKVFGPSQRA   96 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~~~a   96 (424)
                      .-....+.+.|+|+++-..-.
T Consensus        83 ~p~~~~a~~~~i~i~~e~el~  103 (448)
T PRK03803         83 TPALQAAAAAGIKISGDIELF  103 (448)
T ss_pred             CHHHHHHHHCCCCEECHHHHH
T ss_conf             999999998599683199998


No 191
>pfam03054 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs.
Probab=82.17  E-value=4.1  Score=20.82  Aligned_cols=130  Identities=16%  Similarity=0.182  Sum_probs=69.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCC--EEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             95899886588999999998589967--8999549835751170551287898999999987189799997955787489
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLS--ELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~--~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      |||+|--|||---+.+-.|.+....+  -++.-.-.........|  -...|.....+.|.+..|.+-++--++.....|
T Consensus         1 mkV~VamSGGVDSsVaA~LL~~~Gy~V~Gv~m~~w~~~~~~~~~C--~~~~d~~dA~~va~~LgIp~~v~d~~~~f~~~V   78 (354)
T pfam03054         1 MKVVVAMSGGVDSSVAAYLLKEQGYEVIGVFMKNWDEEDEFGHGC--CSEEDLADAQRVCEQLGIPLYVVNFEKEYWEKV   78 (354)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCC--CCHHHHHHHHHHHHHCCCCEEEECHHHHHHHHH
T ss_conf             969999047899999999999779963999999566887667889--988999999999998699789978799875899


Q ss_pred             HHHHHH---CCCCEEECCHHHHHHHHCCHHHHHHHHHH----H---HHCCCCCCCCCCHHHHHHHHCCCCEEEEEECC
Q ss_conf             989860---58806701066655520102357888765----3---10111122344011111210124202563046
Q gi|254780206|r   79 SDALNA---AGFKVFGPSQRAAKLESSKSFAKKFCTKY----G---IPTATYQHFSDPMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus        79 ~d~l~~---~gi~v~Gp~~~aa~le~sK~~~K~~l~~~----g---IPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~  146 (424)
                      .|.|-+   .|.+   |+...  ++..+.....|++.+    |   |.|--|.....         .-+.+.+.++.+
T Consensus        79 i~~fv~~Y~~G~T---PNPcv--~CN~~IKFg~l~~~A~~~lGad~iATGHYAri~~---------~~~~~~L~r~~D  142 (354)
T pfam03054        79 FEPFLDEYKNGRT---PNPDI--LCNREIKFGALLDYAKQVLGADYLATGHYARVSL---------NENESELLRGKD  142 (354)
T ss_pred             HHHHHHHHHCCCC---CCCCH--HHCCCCCHHHHHHHHHHHCCCCCCCCCCEEEEEE---------CCCEEEEEECCC
T ss_conf             9999999976999---98414--4189643899999999866998104474289990---------499389998999


No 192
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]
Probab=82.13  E-value=4.1  Score=20.81  Aligned_cols=24  Identities=21%  Similarity=0.295  Sum_probs=14.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             958998865889999999985899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPL   24 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~   24 (424)
                      .+|||+|+|.-.-.=+..|.+...
T Consensus        13 k~VlvvGgG~va~rKa~~ll~~ga   36 (210)
T COG1648          13 KKVLVVGGGSVALRKARLLLKAGA   36 (210)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC
T ss_conf             779998998999999999974699


No 193
>PRK00109 Holliday junction resolvase-like protein; Reviewed
Probab=81.94  E-value=2.1  Score=22.88  Aligned_cols=71  Identities=24%  Similarity=0.419  Sum_probs=45.6

Q ss_pred             CHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             98999999987189799997955787489989860588067010666555201023578887653101111223440111
Q gi|254780206|r   50 NHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKA  129 (424)
Q Consensus        50 d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea  129 (424)
                      +.+.+.+++++++|+.+|+|-  |+        ...|-       ...+-+.-+.|++.+-++.++|.--+..--+-.+|
T Consensus        42 ~~~~l~~ii~e~~i~~iViGl--P~--------~~~g~-------~~~~~~~v~~F~~~L~~~~~l~v~~~DEr~TS~~A  104 (141)
T PRK00109         42 DWDALEKLLKEWQPDLLVVGL--PL--------NMDGT-------EGPMTERARKFANRLEGRFGLPVELVDERLTTVEA  104 (141)
T ss_pred             HHHHHHHHHHHHCCCEEEEEC--CC--------CCCCC-------CCHHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHH
T ss_conf             999999999983999899944--79--------99988-------44889999999999999729987986243279999


Q ss_pred             HHHHHCCC
Q ss_conf             11210124
Q gi|254780206|r  130 KQYVQNKS  137 (424)
Q Consensus       130 ~~~~~~~g  137 (424)
                      .+.+.+.+
T Consensus       105 ~~~l~~~~  112 (141)
T PRK00109        105 ERMLFEAG  112 (141)
T ss_pred             HHHHHHCC
T ss_conf             99999736


No 194
>PRK06522 2-dehydropantoate 2-reductase; Reviewed
Probab=81.70  E-value=2.9  Score=21.85  Aligned_cols=32  Identities=19%  Similarity=0.325  Sum_probs=24.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             958998865889999999985899678999549
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPG   33 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pg   33 (424)
                      |||+|||.|+---.+++.|+++.. +-.+++.+
T Consensus         1 MkI~IiGaGaiG~~~a~~L~~ag~-~V~li~r~   32 (307)
T PRK06522          1 MKIAILGAGAIGGLFGARLAQAGH-DVTLVARG   32 (307)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-CEEEEECC
T ss_conf             989999914999999999984899-88999788


No 195
>PRK08811 uroporphyrinogen-III synthase; Validated
Probab=81.61  E-value=4.3  Score=20.68  Aligned_cols=93  Identities=17%  Similarity=0.162  Sum_probs=43.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEE-ECCCHHHHHHHHH
Q ss_conf             589988658899999999858996789995498357511705512878989999999871897999-9795578748998
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVV-VGPELPLVNGISD   80 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvi-vgpE~pL~~gi~d   80 (424)
                      .|||.==-++-.+|+.+|.+.+.  .+...|    .-.+.   ..+..  +..-.+.+-.+-|.+| +.|-+-  ....+
T Consensus        18 tvLvTRP~~q~~~L~~~L~~aG~--~~i~lP----~l~I~---~~~~~--~~~~~l~~~~~~d~vIFVS~nAV--~~a~~   84 (264)
T PRK08811         18 TLISLRPSGEHAALRRAVARHGG--RLLALS----PWRLQ---RLDTA--QARDALRQALAAPIVVFTSPAAV--QAAHR   84 (264)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCC--CEEECC----HHHCC---CCCCC--HHHHHHHHHHCCCEEEEECHHHH--HHHHH
T ss_conf             89995855567999999998799--778467----00046---79960--47999986423999999858999--99997


Q ss_pred             HH---HHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             98---60588067010666555201023578887653101
Q gi|254780206|r   81 AL---NAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT  117 (424)
Q Consensus        81 ~l---~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt  117 (424)
                      .+   .-.++++++-.+.++          +.|+++|++.
T Consensus        85 ~l~~~~p~~~~~~aVG~~TA----------~~L~~~g~~~  114 (264)
T PRK08811         85 LLPLQRPARAHWLSVGEGTA----------RALQACGIDR  114 (264)
T ss_pred             HHHCCCCCCCEEEEECHHHH----------HHHHHCCCCC
T ss_conf             54212788985999989999----------9999759985


No 196
>PRK08309 short chain dehydrogenase; Provisional
Probab=81.51  E-value=4.3  Score=20.65  Aligned_cols=81  Identities=17%  Similarity=0.281  Sum_probs=38.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCH-HHHH---------CCEEEECCCCCHHHHHH----HHHHHC-CCE
Q ss_conf             95899886588999999998589967899954983-5751---------17055128789899999----998718-979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNP-GIAQ---------HAQCVAIDIQNHSAIIH----FCQEKH-IDL   65 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~-g~~~---------~~~~~~i~~~d~~~i~~----~a~~~~-iDl   65 (424)
                      |..||||+-|==--...-|.+.+  .+|.++--++ -+..         ...++..|..|.+++.+    ..+++. +|+
T Consensus         1 mhaLVIGGTGML~~vs~~L~~qg--~~VsiiaR~~~kl~~~~~~~~~p~~i~~l~~DY~d~~~l~~~l~~ai~q~Gp~dl   78 (182)
T PRK08309          1 MHALVIGGTGMLKRVSLWLCEEG--FHVSIIARDEVKLENVKRESGTPESITCLPLDYHDDDAVKLAIKRTIEQNGPITL   78 (182)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCC--CEEEEEECCHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCCE
T ss_conf             91699724175599999997379--9999994487886536862379863257874648869999999999961898568


Q ss_pred             EEEC-----CCHHHHHHHHHHHHHC
Q ss_conf             9997-----9557874899898605
Q gi|254780206|r   66 VVVG-----PELPLVNGISDALNAA   85 (424)
Q Consensus        66 vivg-----pE~pL~~gi~d~l~~~   85 (424)
                      +|..     ++++.+  +++.+...
T Consensus        79 ~VaWiHssa~~al~~--v~~~l~~~  101 (182)
T PRK08309         79 AVAWIHSSAKDALSV--VCRELDLS  101 (182)
T ss_pred             EEEEEECCCHHHHHH--HHHHHHCC
T ss_conf             999983572245999--99998548


No 197
>TIGR00018 panC pantoate--beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis . Pantoate-beta-alanine ligase, also know as pantothenate synthase, (6.3.2.1 from EC) catalyzes the formation of pantothenate from pantoate and alanine in the pantothenate biosynthesis pathway .; GO: 0004592 pantoate-beta-alanine ligase activity, 0015940 pantothenate biosynthetic process.
Probab=81.46  E-value=3.6  Score=21.19  Aligned_cols=137  Identities=18%  Similarity=0.301  Sum_probs=82.5

Q ss_pred             HHHH-HHH-CCCCCEEEEECCCHHHHHCCEEEEC--CCCCHHHHHHHHHHHCCCEEEE------CCC-HHHHHHHHHHHH
Q ss_conf             9999-985-8996789995498357511705512--8789899999998718979999------795-578748998986
Q gi|254780206|r   15 LAWK-IAQ-SPLLSELWSIPGNPGIAQHAQCVAI--DIQNHSAIIHFCQEKHIDLVVV------GPE-LPLVNGISDALN   83 (424)
Q Consensus        15 l~~~-l~~-s~~~~~v~~~pgN~g~~~~~~~~~i--~~~d~~~i~~~a~~~~iDlviv------gpE-~pL~~gi~d~l~   83 (424)
                      |+.+ .++ +.-+-+|||-|   -  +++.+-++  -+.|++.=+++|++.++|.+|.      +|. .||-      .+
T Consensus        43 L~~~a~~End~vvvSIFVNP---~--QFgp~EDl~~YPR~l~~D~~l~E~lgVd~~FaP~~~~mYP~~~Pld------ie  111 (310)
T TIGR00018        43 LIDRAVKENDLVVVSIFVNP---L--QFGPNEDLEAYPRDLEEDLALLEKLGVDVVFAPKVHEMYPDGAPLD------IE  111 (310)
T ss_pred             HHHHHHHHCCEEEEEEEECC---C--CCCCCCCHHHCCCCHHHHHHHHHHCCCCEEECCCCEEECCCCCCCC------CC
T ss_conf             99999866885899997578---7--8888754544579858999999838965885572144078862321------13


Q ss_pred             HCCCCEEECCHHHHHHHHC--CHHHHHH----HHHHHH--HCCCCCCCCCCHHH---HHHHHCCCC-------EEEEEEC
Q ss_conf             0588067010666555201--0235788----876531--01111223440111---112101242-------0256304
Q gi|254780206|r   84 AAGFKVFGPSQRAAKLESS--KSFAKKF----CTKYGI--PTATYQHFSDPMKA---KQYVQNKSM-------PIVVKAD  145 (424)
Q Consensus        84 ~~gi~v~Gp~~~aa~le~s--K~~~K~~----l~~~gI--Pt~~~~~~~~~~ea---~~~~~~~g~-------PvVVKp~  145 (424)
                      +...++.-|...+..|||-  +.+.+-.    .|=.+|  ||-.|.--.|.+++   ..-++.+.+       |+|=--|
T Consensus       112 E~~~~~~~p~~ls~~LeGa~RpGHF~GVa~iVtKLFnlV~Pd~AYFG~KD~QQla~i~~lV~Dl~~di~i~~~~iVR~~d  191 (310)
T TIGR00018       112 EQKTTVLVPKALSEVLEGASRPGHFRGVATIVTKLFNLVKPDVAYFGKKDAQQLAVIRKLVKDLFLDIEIVPVPIVREED  191 (310)
T ss_pred             CCEEEEECCCCCCCCCCCCCCCCCCCCEEEEEEEHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEEEEECCC
T ss_conf             75447861765410016789868234202545410031674510047743889999999998734630876330563488


Q ss_pred             CCC-CCCCCCCHH-HHHHH
Q ss_conf             653-430002323-56778
Q gi|254780206|r  146 GLC-AGKGVVVAA-TVDEA  162 (424)
Q Consensus       146 ~~a-gGkGV~i~~-~~~e~  162 (424)
                      ||| +||-++++- .+++|
T Consensus       192 GLAlSSRN~YL~a~~rK~A  210 (310)
T TIGR00018       192 GLALSSRNVYLTAEERKQA  210 (310)
T ss_pred             CCEECCCCCCCCHHHHHHH
T ss_conf             8412014766786678764


No 198
>PRK09275 aspartate aminotransferase; Provisional
Probab=81.23  E-value=1.9  Score=23.21  Aligned_cols=21  Identities=10%  Similarity=0.064  Sum_probs=11.5

Q ss_pred             EEECCCHHHHHHHHHHHHHCC
Q ss_conf             996289899999999998525
Q gi|254780206|r  378 TALGKTITESRELAYHMVENI  398 (424)
Q Consensus       378 v~~g~~l~eA~~~ay~~i~~I  398 (424)
                      +++++=-+++..++-+.+.++
T Consensus       498 VSLANL~~~dY~~IG~~i~~~  518 (531)
T PRK09275        498 VSLANLNEEDYAKIGKSIRKL  518 (531)
T ss_pred             EEECCCCHHHHHHHHHHHHHH
T ss_conf             873689988999999999999


No 199
>COG3494 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=81.21  E-value=4.4  Score=20.58  Aligned_cols=63  Identities=21%  Similarity=0.338  Sum_probs=37.9

Q ss_pred             EEECCCHHHHHHHHHHHHCCCCCEEEEEC--C--CHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEE-EC
Q ss_conf             99886588999999998589967899954--9--8357511705512878989999999871897999-97
Q gi|254780206|r    4 LLIGSGGREHALAWKIAQSPLLSELWSIP--G--NPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVV-VG   69 (424)
Q Consensus         4 LviGsGgrEhAl~~~l~~s~~~~~v~~~p--g--N~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvi-vg   69 (424)
                      ||-|+|.--|-++....+...  .+|.++  +  ++- -...++..+++-++-++.++-+.+++|-+| .|
T Consensus         9 lIaG~G~LP~~va~~a~~~G~--~~~ii~l~~eaD~~-~~~~e~~~~~iG~vg~lik~l~~~~v~~vVl~G   76 (279)
T COG3494           9 LIAGNGSLPLEVAENARNQGY--APFIIGLRGEADPE-LKEFEYKEVSIGEVGKLIKLLKTEGVDRVVLAG   76 (279)
T ss_pred             EEECCCCCCHHHHHHHHHCCC--CCEEEEECCCCCHH-HHCCCCEEEEHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             995598675899999986799--82799835756655-525887077578799999999984886899964


No 200
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=81.03  E-value=3.4  Score=21.39  Aligned_cols=35  Identities=31%  Similarity=0.472  Sum_probs=28.2

Q ss_pred             CEEEEECCCH-HHHHHHHHHHHCCCCCEEEEECCCH
Q ss_conf             9589988658-8999999998589967899954983
Q gi|254780206|r    1 MRVLLIGSGG-REHALAWKIAQSPLLSELWSIPGNP   35 (424)
Q Consensus         1 MkILviGsGg-rEhAl~~~l~~s~~~~~v~~~pgN~   35 (424)
                      |||.|||.|| --.++|+.|...+..+++.+..=|+
T Consensus         1 mKV~IIGagg~VG~~~A~~l~~~~l~~elvL~D~~~   36 (142)
T pfam00056         1 VKVAVVGAGGGVGSSLAFALALQGLADELVLVDINK   36 (142)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             989998987789999999997479663478850577


No 201
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of  a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1).
Probab=80.87  E-value=4.5  Score=20.50  Aligned_cols=66  Identities=17%  Similarity=0.206  Sum_probs=35.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHCCEEE-----ECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             95899886588999999998589967899954-983575117055-----12878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIP-GNPGIAQHAQCV-----AIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~~~~~-----~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      .+|||+|-||--..++..|.++. +.++.++. +.-....+...+     .+-..-.+...+..++.+++.-|
T Consensus        22 s~VlivG~GGlGs~~~~~La~~G-vg~i~lvD~D~ve~sNLnRQ~l~~~~diG~~K~~~a~~~l~~iNp~i~i   93 (228)
T cd00757          22 ARVLVVGAGGLGSPAAEYLAAAG-VGKLGLVDDDVVELSNLQRQILHTEADVGQPKAEAAAERLRAINPDVEI   93 (228)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCHHHHEECHHHCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             97899887788999999999839-9758999787455676422102378668789599999999854887530


No 202
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112   This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium). This enzyme is the first step in the pathway for the biosynthesis of tryprophan from chorismate.; GO: 0004049 anthranilate synthase activity, 0000162 tryptophan biosynthetic process.
Probab=80.65  E-value=1.8  Score=23.42  Aligned_cols=31  Identities=19%  Similarity=0.133  Sum_probs=14.8

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCCEEEEEECC
Q ss_conf             1566654201333321234444206754225
Q gi|254780206|r  300 LEILNSCVHGNLHNTHINWKAEYALTVVVAT  330 (424)
Q Consensus       300 ~~il~~~~~g~L~~~~~~~~~~~~v~Vvlas  330 (424)
                      ++-|-..--|.|...+.-.+-+.+---|+.+
T Consensus       606 LQg~vEafGG~L~vL~~P~HGK~srirVl~p  636 (726)
T TIGR01815       606 LQGLVEAFGGELDVLAIPVHGKASRIRVLEP  636 (726)
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCCEEEEECC
T ss_conf             6899987467213578887886336888368


No 203
>PRK13303 L-aspartate dehydrogenase; Provisional
Probab=80.31  E-value=4.7  Score=20.38  Aligned_cols=83  Identities=24%  Similarity=0.287  Sum_probs=40.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCH--HHHHCCEEEEC-CCCCHHHHHHHHHHHCCCEEEE--CCCHHHH
Q ss_conf             95899886588999999998589967899954983--57511705512-8789899999998718979999--7955787
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNP--GIAQHAQCVAI-DIQNHSAIIHFCQEKHIDLVVV--GPELPLV   75 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~--g~~~~~~~~~i-~~~d~~~i~~~a~~~~iDlviv--gpE~pL~   75 (424)
                      |||.+||-|.--+.++.+|.+.+...-.++.-.|+  ........... -..+.+.+   +  .++|+||=  ++++  +
T Consensus         2 mrVgiiG~GaIG~~va~~l~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~L---~--~~~DlVVE~A~~~a--v   74 (265)
T PRK13303          2 MKVAMIGFGAIAAAVYELLEHDPRLRVDWVIVPEHSVDAVRRALGRAVQVVSSVDAL---A--QRPDLVVECAGHAA--L   74 (265)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCEEEEEEECCCCHHHHHHHHCCCCCCCCCHHHH---H--HCCCEEEECCCHHH--H
T ss_conf             299998546899999999844997279999946852677875304588644798898---2--37999998988899--9


Q ss_pred             HHHHHHHHHCCCCEE
Q ss_conf             489989860588067
Q gi|254780206|r   76 NGISDALNAAGFKVF   90 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~   90 (424)
                      .-.+...-+.|..++
T Consensus        75 ~~~~~~~L~~g~dl~   89 (265)
T PRK13303         75 KEHVVPILKAGIDCA   89 (265)
T ss_pred             HHHHHHHHHCCCCEE
T ss_conf             999999997299889


No 204
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=80.18  E-value=3.4  Score=21.40  Aligned_cols=23  Identities=30%  Similarity=0.426  Sum_probs=16.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             95899886588999999998589
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSP   23 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~   23 (424)
                      |||||+|-|----|.+..|.+..
T Consensus         1 mKi~V~GlG~sG~s~a~~L~~~g   23 (401)
T PRK03815          1 MKISLFGYGKTTKALARFFVKNG   23 (401)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCC
T ss_conf             93999847771899999999487


No 205
>PRK12550 shikimate 5-dehydrogenase; Reviewed
Probab=79.83  E-value=4.8  Score=20.34  Aligned_cols=20  Identities=20%  Similarity=0.091  Sum_probs=9.8

Q ss_pred             ECCCCCHHHHHHHHHHHCCC
Q ss_conf             12878989999999871897
Q gi|254780206|r   45 AIDIQNHSAIIHFCQEKHID   64 (424)
Q Consensus        45 ~i~~~d~~~i~~~a~~~~iD   64 (424)
                      .++..|.+..++..+..++.
T Consensus        42 ~~~~~~l~~~i~~lr~~~~~   61 (272)
T PRK12550         42 AFTTTDLTAAIGGVRALGIR   61 (272)
T ss_pred             EECHHHHHHHHHHHHHCCCC
T ss_conf             63787799999988757998


No 206
>pfam04127 DFP DNA / pantothenate metabolism flavoprotein. The DNA/pantothenate metabolism flavoprotein (EC:4.1.1.36) affects synthesis of DNA, and pantothenate metabolism.
Probab=79.58  E-value=4.9  Score=20.25  Aligned_cols=74  Identities=22%  Similarity=0.259  Sum_probs=41.0

Q ss_pred             EEEEECCCHHH-----------------HHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHC--
Q ss_conf             58998865889-----------------99999998589967899954983575117055128789899999998718--
Q gi|254780206|r    2 RVLLIGSGGRE-----------------HALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKH--   62 (424)
Q Consensus         2 kILviGsGgrE-----------------hAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~--   62 (424)
                      ||||-++|-||                 .|||+.+.+.+.-..++..|++.-...-.....+.....+++.+.+.+.-  
T Consensus         4 ~vlITaG~T~E~ID~VR~ItN~SSGkmG~alA~~~~~~Ga~V~li~g~~~~~~~~~~~~~~i~v~t~~em~~~~~~~~~~   83 (197)
T pfam04127         4 RVLVTSGGTREPIDPVRFISNFSSGKMGAAIAEEFLKRGADVTLIAGKGSLKPEPSGNLLIIPVETAEEMLNALKEIAPD   83 (197)
T ss_pred             EEEEECCCCCCCCCCCCEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCEEEEEECCHHHHHHHHHHHCCC
T ss_conf             99993688644438831536269559999999999978993899723565566898881899968999999999974756


Q ss_pred             -CCEEEECCCHHHHHHHHHH
Q ss_conf             -9799997955787489989
Q gi|254780206|r   63 -IDLVVVGPELPLVNGISDA   81 (424)
Q Consensus        63 -iDlvivgpE~pL~~gi~d~   81 (424)
                       .|++|      ++|.++|+
T Consensus        84 ~~D~~I------~aAAVsDf   97 (197)
T pfam04127        84 LHDVFI------LAAAVSDF   97 (197)
T ss_pred             CCCEEE------EEEECCCC
T ss_conf             577999------91000445


No 207
>cd01674 Homoaconitase_Swivel Homoaconitase swivel domain. This family includes homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases. This is the swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.
Probab=79.28  E-value=2.7  Score=22.09  Aligned_cols=21  Identities=29%  Similarity=0.396  Sum_probs=8.4

Q ss_pred             CCCHHHHHHHHCCCCEEEEEE
Q ss_conf             440111112101242025630
Q gi|254780206|r  124 SDPMKAKQYVQNKSMPIVVKA  144 (424)
Q Consensus       124 ~~~~ea~~~~~~~g~PvVVKp  144 (424)
                      +|.|.|-..+...|+++||-+
T Consensus        59 SSREhA~~aL~~~Gi~aVIA~   79 (129)
T cd01674          59 SSREQAATALLAKGIPLVVSG   79 (129)
T ss_pred             CCHHHHHHHHHHCCCCEEEEC
T ss_conf             348899999998499799985


No 208
>pfam04694 Corona_3 Coronavirus ORF3 protein.
Probab=78.66  E-value=3.6  Score=21.24  Aligned_cols=28  Identities=25%  Similarity=0.506  Sum_probs=24.4

Q ss_pred             ECCCCEEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             8188079999962898999999999985
Q gi|254780206|r  369 ANGGRVLSATALGKTITESRELAYHMVE  396 (424)
Q Consensus       369 t~GGRVL~vv~~g~~l~eA~~~ay~~i~  396 (424)
                      -+.|+.|.+++.|+++++|.+++|..+.
T Consensus        31 F~tgkllvCIgfgdt~~ea~~kayakL~   58 (60)
T pfam04694        31 FKTGKLLVCIGFGDTLEEAEQKAYAKLQ   58 (60)
T ss_pred             EECCCEEEEEECCCHHHHHHHHHHHHHC
T ss_conf             8048699999427168998987887644


No 209
>COG2308 Uncharacterized conserved protein [Function unknown]
Probab=78.56  E-value=3.7  Score=21.13  Aligned_cols=14  Identities=7%  Similarity=0.112  Sum_probs=5.0

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             35677888788751
Q gi|254780206|r  157 ATVDEATSAIDRCF  170 (424)
Q Consensus       157 ~~~~e~~~~~~~~~  170 (424)
                      .|++-...++-+.|
T Consensus       178 enR~~~~r~~Pely  191 (488)
T COG2308         178 ENRRAMARAFPELY  191 (488)
T ss_pred             HHHHHHHHHCHHHH
T ss_conf             74899998776778


No 210
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional
Probab=78.55  E-value=5.3  Score=20.00  Aligned_cols=149  Identities=21%  Similarity=0.360  Sum_probs=77.1

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCC----CCEEECCHHHHHHHHCC--H----HHHHHHHHHHHH
Q ss_conf             8789899999998718979999795578748998986058----80670106665552010--2----357888765310
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAG----FKVFGPSQRAAKLESSK--S----FAKKFCTKYGIP  116 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~g----i~v~Gp~~~aa~le~sK--~----~~K~~l~~~gIP  116 (424)
                      -+.+++.=++++.+.++|+++. |+.       +.+--.|    ..+..|..-+..||+-.  .    .+.-+.+=.+|-
T Consensus        69 YPr~~~~D~~ll~~~gvd~vf~-P~~-------~emYp~~~~~~~~~~~~~~l~~~l~G~~RpghF~GV~Tvv~kLf~iv  140 (512)
T PRK13477         69 YPRTLEADRELCESAGVDAIFA-PSP-------EELYPGGAKSITQVQPPAELTSHLCGASRPGHFDGVATVVTRLLNLV  140 (512)
T ss_pred             CCCCHHHHHHHHHHCCCCEEEC-CCH-------HHCCCCCCCCEEEECCCCCCCHHHCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             7999899999999689999988-988-------98089999871798166311234417768506778999999999636


Q ss_pred             CCCCCCC--CCCHHH---HHHHHCCCCEEEEE-------ECCCC-CCCCCCCHHHHHHHHHH-------HHHHHCC--CC
Q ss_conf             1111223--440111---11210124202563-------04653-43000232356778887-------8875144--53
Q gi|254780206|r  117 TATYQHF--SDPMKA---KQYVQNKSMPIVVK-------ADGLC-AGKGVVVAATVDEATSA-------IDRCFQQ--IN  174 (424)
Q Consensus       117 t~~~~~~--~~~~ea---~~~~~~~g~PvVVK-------p~~~a-gGkGV~i~~~~~e~~~~-------~~~~~~~--~~  174 (424)
                      .|.+..|  .|++++   +..++.+.+|+-|.       +|||| ++|-.++..+..+.-..       ....+..  ..
T Consensus       141 ~P~~a~fGeKD~QQl~vIk~mv~dl~~~v~i~~~ptvRe~dGLA~SSRN~~Ls~~er~~A~~l~~~L~~a~~~~~~g~~~  220 (512)
T PRK13477        141 QPKRAYFGEKDWQQLAIIRRLVADLNLPVTIVGCPTVREADGLALSSRNQYLSAEERQQAAALPRALQAAKKAFQAGKRI  220 (512)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHHHCCCCEEEECCCEECCCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99989982322879999999999719993899708637899964313440159999999999999999999999758976


Q ss_pred             HHHHH----HHHHH--CCCCCEEEECCCCCCCCCC
Q ss_conf             17778----87752--0575234421577631035
Q gi|254780206|r  175 STVII----EEYLE--GFEVSFFALCDGKTAIPFT  203 (424)
Q Consensus       175 ~~Vli----Eefl~--G~E~Sv~~i~dG~~~~~l~  203 (424)
                      ...++    ++.+.  |.++-...++|..+..+..
T Consensus       221 ~~~~~~~~~~~~~~~~~~~idY~~i~d~~tL~~~~  255 (512)
T PRK13477        221 NLSLLAAVQQELLSEPGLEVEYLELVDPQTLQPLE  255 (512)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEEECHHHCCCCC
T ss_conf             49999999999951889873289964641285362


No 211
>TIGR01819 F420_cofD LPPG:Fo 2-phospho-L-lactate transferase; InterPro: IPR010115   This entry represents LPPG:Fo 2-phospho-L-lactate transferase (CofD), which catalyses the fourth step in the biosynthesis of coenzyme F420, a flavin derivative found in methanogens, Mycobacteria, and several other lineages. This enzyme is characterised so far in Methanococcus jannaschii  but appears restricted to F420-containing species and is predicted to carry out the same function in these other species. .
Probab=78.50  E-value=3.6  Score=21.23  Aligned_cols=240  Identities=17%  Similarity=0.149  Sum_probs=106.4

Q ss_pred             HCCHHHHHHHHHHHH-----H-CCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             010235788876531-----0-1111223440111112101242025630465343000232356778887887514453
Q gi|254780206|r  101 SSKSFAKKFCTKYGI-----P-TATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN  174 (424)
Q Consensus       101 ~sK~~~K~~l~~~gI-----P-t~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~  174 (424)
                      .+=..+++-|+++|+     | ||+|-. .+.+.|-.-+.+..       .-.++.-++.+ .+++-|...+..-+=..+
T Consensus        81 ddTf~t~e~L~~lG~aadidPdtPrylP-ddaqtaGrdiarWr-------rfsa~~E~~~l-GDrDrAtH~~Rt~~l~~G  151 (359)
T TIGR01819        81 DDTFHTHEELKELGVAADIDPDTPRYLP-DDAQTAGRDIARWR-------RFSAADEWLRL-GDRDRATHILRTQMLRAG  151 (359)
T ss_pred             CCCHHHHHHHHHCCCEECCCCCCCCCCC-CHHHHHHHHHHHHH-------HCCCCCCCCCC-CCHHHHHHHHHHHHHHCC
T ss_conf             8612389999860212027888886576-41223222446652-------01477643213-627888999999998668


Q ss_pred             H------HHHHHHHHH--------CC--CCCEEEECC--CCC-CCCCCCCCCC--CCCCCCCCCCCCCCCCEEECCCCCC
Q ss_conf             1------777887752--------05--752344215--776-3103520001--1135665444443443000012344
Q gi|254780206|r  175 S------TVIIEEYLE--------GF--EVSFFALCD--GKT-AIPFTTARDH--KRIHDGDIGPNTGGMGACSPALGMS  233 (424)
Q Consensus       175 ~------~VliEefl~--------G~--E~Sv~~i~d--G~~-~~~l~~~~dy--Kr~~~~d~GpnTGGMGa~~p~~~~~  233 (424)
                      .      .-|-+.|=.        =.  |+++.+-+|  |+. ...|   |||  ++..+-             |+.-+.
T Consensus       152 ~~Ls~vT~~l~~~~~~~~~l~PMtdDRvev~~~v~~dvdg~~~~~HF---QefWV~~rg~v-------------~v~dV~  215 (359)
T TIGR01819       152 HSLSEVTEALADAFGIKARLLPMTDDRVEVSTLVETDVDGKEGAMHF---QEFWVRRRGDV-------------EVEDVE  215 (359)
T ss_pred             CCHHHHHHHHHHHHCCCEEEEECCCCCCCEEEEEEECCCCCCCCEEC---CHHHHHCCCCC-------------CCEEEE
T ss_conf             87779999999872897178606789733289997478787475300---12532037996-------------401366


Q ss_pred             CCCCEEEECCHHHHHHHHHHHCCCEEEEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCC-CCHHHHHHHHHCCCC
Q ss_conf             3222010000089999986204623566445448985570489998865147751044332654-411566654201333
Q gi|254780206|r  234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLES-DILEILNSCVHGNLH  312 (424)
Q Consensus       234 ~~~~~~i~~~i~~~~~~~l~~~~~~y~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~-dl~~il~~~~~g~L~  312 (424)
                      ..-.++  .++-++.++||+++..         +|+-...|            = -.|.|.|.= ++-+.|...-- +  
T Consensus       216 f~G~e~--A~~a~~a~EAi~~~~~---------vligPSNP------------v-tSIGpILal~Gire~Lrda~~-k--  268 (359)
T TIGR01819       216 FRGAEK--AKAAPEAIEAIRDADV---------VLIGPSNP------------V-TSIGPILALPGIREALRDATV-K--  268 (359)
T ss_pred             ECCCCC--CCCCHHHHHHHHCCCE---------EEECCCCC------------C-CCCHHHCCHHHHHHHHHHCCC-C--
T ss_conf             406533--6688789998605998---------99778668------------1-113223272568999983697-3--


Q ss_pred             CCCCCCCC---CC----EEEEEECCCCCCCCCCCCCC-CCCCC--CCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECC
Q ss_conf             32123444---42----06754225446687757976-24876--66898689983358778879981880799999628
Q gi|254780206|r  313 NTHINWKA---EY----ALTVVVATKGYPEEYPHGTI-ISKIP--QNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGK  382 (424)
Q Consensus       313 ~~~~~~~~---~~----~v~Vvlas~GYP~~~~kg~~-I~~l~--~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~  382 (424)
                        -+-.++   +.    -...+|++.|| ++..+|.. .++--  .-.-|.+++|-.=+..-..+-..|=.|..+...=+
T Consensus       269 --VVavSPIvG~~~vsGpA~Klm~A~G~-dvsa~gVae~Y~dfCatG~lD~~vvD~~D~~~~~r~~~~Gv~v~~t~t~M~  345 (359)
T TIGR01819       269 --VVAVSPIVGDKPVSGPAGKLMAAVGV-DVSAAGVAEHYGDFCATGLLDVLVVDEADKADLDRVEALGVEVVATDTLMT  345 (359)
T ss_pred             --EEEECCCCCCCCCCCCHHHCCCCCCC-CCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHCCCEEEECCCCCC
T ss_conf             --89971640688875843420422343-634489999888652003034678601255899999847963888166438


Q ss_pred             CHHHHHHHHHHHH
Q ss_conf             9899999999998
Q gi|254780206|r  383 TITESRELAYHMV  395 (424)
Q Consensus       383 ~l~eA~~~ay~~i  395 (424)
                      |.+++.+.|-..+
T Consensus       346 ~~~~~~~lAr~~~  358 (359)
T TIGR01819       346 TLDDAARLARAVV  358 (359)
T ss_pred             CHHHHHHHHHHHC
T ss_conf             9889999999853


No 212
>TIGR00232 tktlase_bact transketolase; InterPro: IPR005478     Transketolase (EC 2.2.1.1) (TK) catalyzes the reversible transfer of a two-carbon ketol unit from xylulose 5-phosphate to an aldose receptor, such as ribose 5-phosphate, to form sedoheptulose 7-phosphate and glyceraldehyde 3- phosphate. This enzyme, together with transaldolase, provides a link between the glycolytic and pentose-phosphate pathways. TK requires thiamine pyrophosphate as a cofactor.    This group includes two proteins from the yeast Saccharomyces cerevisiae but excludes dihydroxyactetone synthases (formaldehyde transketolases) from various yeasts and the even more distant mammalian transketolases. Among the family of thiamine diphosphate-dependent enzymes that includes transketolases, dihydroxyacetone synthases, pyruvate dehydrogenase E1-beta subunits, and deoxyxylulose-5-phosphate synthases, mammalian and bacterial transketolases seem not to be orthologous. ; GO: 0004802 transketolase activity.
Probab=78.37  E-value=5.4  Score=19.96  Aligned_cols=23  Identities=17%  Similarity=0.141  Sum_probs=12.9

Q ss_pred             EEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             79999962898999999999985
Q gi|254780206|r  374 VLSATALGKTITESRELAYHMVE  396 (424)
Q Consensus       374 VL~vv~~g~~l~eA~~~ay~~i~  396 (424)
                      -+.++++|+-++=|.+.+....+
T Consensus       560 d~iliAtGSEV~La~~a~~~L~~  582 (675)
T TIGR00232       560 DIILIATGSEVQLAVEAAKKLAA  582 (675)
T ss_pred             EEEEEECCCHHHHHHHHHHHHHH
T ss_conf             08998527368999999999985


No 213
>cd01577 IPMI_Swivel Aconatase-like swivel domain of 3-isopropylmalate dehydratase and related uncharacterized proteins. 3-isopropylmalate dehydratase catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate 3-isopropylmalate. IPMI is involved in fungal and bacterial leucine biosynthesis and is also found in eukaryotes. This is the aconitase-like swivel domain, which is believed to undergo swivelling conformational change in the enzyme mechanism.
Probab=78.29  E-value=3.3  Score=21.50  Aligned_cols=28  Identities=21%  Similarity=0.525  Sum_probs=18.0

Q ss_pred             EEEEECCC-----HHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             58998865-----88999999998589967899954
Q gi|254780206|r    2 RVLLIGSG-----GREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         2 kILviGsG-----grEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      .|||-|..     .|||| +|+|+....  +..+++
T Consensus        19 ~Ilvag~NFG~GSSREhA-~~al~~~Gi--~~VIa~   51 (91)
T cd01577          19 DIIVAGKNFGCGSSREHA-PWALKDAGI--RAVIAE   51 (91)
T ss_pred             CEEEECCCCCCCCCHHHH-HHHHHHCCC--EEEEEH
T ss_conf             689956865778528999-999998495--499972


No 214
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=78.28  E-value=5.4  Score=19.95  Aligned_cols=65  Identities=12%  Similarity=0.198  Sum_probs=40.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH-----C-CEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             958998865889999999985899678999549835751-----1-7055128789899999998718979999
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ-----H-AQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~-----~-~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      |||+|+|.|---+.||+.|++..+  .|.+...|+-...     + ...+.-|..+.+.+. -|.-.+.|++|.
T Consensus         1 M~IiI~GaG~vG~~La~~Ls~e~~--dV~vID~d~~~~~~~~~~lDv~~i~Gd~~~~~~L~-~Agi~~ad~~IA   71 (455)
T PRK09496          1 MKIIILGAGQVGGTLAERLVGENN--DVTVIDTDEERLRRLQDRLDVRTVVGNGSHPDVLR-EAGAEDADMLIA   71 (455)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--CEEEEECCHHHHHHHHHHCCEEEEEECCCCHHHHH-HCCCCCCCEEEE
T ss_conf             979999988899999999986899--79999899999999886258689996689999999-659986999999


No 215
>COG1692 Calcineurin-like phosphoesterase [General function prediction only]
Probab=78.08  E-value=5.5  Score=19.91  Aligned_cols=21  Identities=24%  Similarity=0.317  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHCCCEEEECCCH
Q ss_conf             999999987189799997955
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPEL   72 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE~   72 (424)
                      +.+-.+-.+.++|+||+.-|.
T Consensus        20 ~~Lp~lk~kyk~dfvI~N~EN   40 (266)
T COG1692          20 EHLPQLKSKYKIDFVIVNGEN   40 (266)
T ss_pred             HHHHHHHHHHCCCEEEECCCC
T ss_conf             870777875067389985730


No 216
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG. This protein is found in association with enzymes involved in the biosynthesis of pseudaminic acid, a component of polysaccharide in certain Pseudomonas strains as well as a modification of flagellin in Campylobacter and Hellicobacter. The role of this protein is unclear, although it may participate in N-acetylation in conjunction with, or in the absence of PseH (TIGR03585) as it often scores above the trusted cutoff to pfam00583 representing a family of acetyltransferases.
Probab=78.06  E-value=5.5  Score=19.90  Aligned_cols=68  Identities=21%  Similarity=0.304  Sum_probs=39.4

Q ss_pred             CEEEE-------ECCC--HHHHHHHHHHHHCCCCCEEEEECCCHHH--HHC----CEEEEC-----CCCCHHHHHHHHHH
Q ss_conf             95899-------8865--8899999999858996789995498357--511----705512-----87898999999987
Q gi|254780206|r    1 MRVLL-------IGSG--GREHALAWKIAQSPLLSELWSIPGNPGI--AQH----AQCVAI-----DIQNHSAIIHFCQE   60 (424)
Q Consensus         1 MkILv-------iGsG--grEhAl~~~l~~s~~~~~v~~~pgN~g~--~~~----~~~~~i-----~~~d~~~i~~~a~~   60 (424)
                      |||++       ||.|  -|--|||.+|.+... +-.|+...+++.  ..+    .....+     ...+...+.++.++
T Consensus         1 mkI~fr~d~~~~iG~GH~~RclaLA~~l~~~g~-~v~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (280)
T TIGR03590         1 MRILFRADASSEIGLGHVMRCLTLARELRKRGA-EVAFACKTLPGDLIDLILSAGFPVYVLPDTSSWQDDALELINLLEK   79 (280)
T ss_pred             CEEEEEEECCCCEEHHHHHHHHHHHHHHHHCCC-EEEEEEECCCHHHHHHHHHCCCCEEECCCCCCCCCCHHHHHHHHHH
T ss_conf             979999967899132089999999999998899-4999992795889999997598179816756520129999999973


Q ss_pred             HCCCEEEEC
Q ss_conf             189799997
Q gi|254780206|r   61 KHIDLVVVG   69 (424)
Q Consensus        61 ~~iDlvivg   69 (424)
                      .++|++|+.
T Consensus        80 ~~~d~vIiD   88 (280)
T TIGR03590        80 EKFDILIVD   88 (280)
T ss_pred             CCCCEEEEE
T ss_conf             797999992


No 217
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated
Probab=77.98  E-value=5  Score=20.19  Aligned_cols=169  Identities=23%  Similarity=0.307  Sum_probs=75.2

Q ss_pred             EEEEECCCHHH----HHHHHHHHHCCCCCEEEEECC-----CHHHHH-CC-EEEECCCCCH-----HHHHHHHHHHCCCE
Q ss_conf             58998865889----999999985899678999549-----835751-17-0551287898-----99999998718979
Q gi|254780206|r    2 RVLLIGSGGRE----HALAWKIAQSPLLSELWSIPG-----NPGIAQ-HA-QCVAIDIQNH-----SAIIHFCQEKHIDL   65 (424)
Q Consensus         2 kILviGsGgrE----hAl~~~l~~s~~~~~v~~~pg-----N~g~~~-~~-~~~~i~~~d~-----~~i~~~a~~~~iDl   65 (424)
                      |||+.=+||-.    --|+..|++.....+|...+.     .|-+.. +. ..+..+..+.     -.-+++++  ..|+
T Consensus         6 ~IllgVtGsIAayK~~~L~r~L~k~G~~V~vvmT~~A~~fi~plt~~~ls~~~V~td~~~~~~~~~~~HI~la~--~aD~   83 (392)
T PRK05579          6 RIVLGVSGGIAAYKALELVRRLRKAGADVRVVMTEAALKFVTPLTFQALSGNPVYTDLWDPAAEAAMGHIELAK--WADL   83 (392)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHHHCCHHHHHHHHCCCEECCCCCCCCCCCCCHHHHHH--HCCE
T ss_conf             89999833799999999999998789989999885375427998999980998862777876667754634413--1576


Q ss_pred             EEECCCHH-----HHHHHHHHHH-----HCCCCEE-ECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
Q ss_conf             99979557-----8748998986-----0588067-01066655520102357888765310111122344011111210
Q gi|254780206|r   66 VVVGPELP-----LVNGISDALN-----AAGFKVF-GPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQ  134 (424)
Q Consensus        66 vivgpE~p-----L~~gi~d~l~-----~~gi~v~-Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~  134 (424)
                      ++|.|-..     ++.|++|-|-     ..+-|++ .|.....            |.++         -. ..+-.+.++
T Consensus        84 ~liAPATAN~iaK~A~GiaDdllt~~~la~~~pv~iaPAMn~~------------M~~n---------p~-tq~Ni~~L~  141 (392)
T PRK05579         84 VLIAPATADLIAKLAHGIADDLLTTTLLATDAPVLVAPAMNTQ------------MWEN---------PA-TQRNLATLR  141 (392)
T ss_pred             EEECCCCHHHHHHHHCCCCCHHHHHHHHHCCCCEEEEECCCHH------------HHHC---------HH-HHHHHHHHH
T ss_conf             8983233789999875774378888888539957998376988------------8869---------79-999999997


Q ss_pred             CCCCEEEEEEC-C-CCCC-CCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             12420256304-6-5343-00023235677888788751445317778877520575234421577631035200
Q gi|254780206|r  135 NKSMPIVVKAD-G-LCAG-KGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTAR  206 (424)
Q Consensus       135 ~~g~PvVVKp~-~-~agG-kGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~  206 (424)
                      +.|+ .||-|. | ||.| .|....-+.++...++.+.+.        ++.+.|.-+   .++-|-+.-++-++|
T Consensus       142 ~~G~-~vi~P~~G~LAcgd~G~Grl~ep~~I~~~i~~~l~--------~~~l~gkkv---LITaG~T~E~IDpVR  204 (392)
T PRK05579        142 SRGV-LVIGPASGRLACGDVGKGRMAEPEEIVAAAERLLG--------PKDLAGKRV---LITAGPTREPIDPVR  204 (392)
T ss_pred             HCCC-EEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCC--------CCCCCCCEE---EEECCCCEEEECCEE
T ss_conf             3698-88189667524633235689999999999998506--------777678879---997477247767624


No 218
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=77.94  E-value=5.5  Score=19.88  Aligned_cols=66  Identities=17%  Similarity=0.165  Sum_probs=37.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH-HCCEEE---ECCCCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             95899886588999999998589967899954983575-117055---1287898999999987189799997
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA-QHAQCV---AIDIQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~-~~~~~~---~i~~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      .||||||.|+--..++..|.+. ...+++++.-+..-+ .+++..   .+...+++.+.+...  +.|++|.+
T Consensus        13 ~~vlVIGaG~~~~~~~~~L~~~-g~~~i~v~nRt~~ka~~la~~~~~~~~~~~~~~~l~~~l~--~~DivI~a   82 (134)
T pfam01488        13 KKVLLIGAGEMARLAAKHLLSK-GAKKITIANRTLEKAKELAEEFGGEEVEALPLDELEELLA--EADIVISA   82 (134)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCCEEEEECCCHHHHHHHHHHCCCCCEEEEECHHHHHHHH--HCCEEEEE
T ss_conf             9899999609999999999975-9988999547578999999984997258985135441363--19999992


No 219
>PRK08655 prephenate dehydrogenase; Provisional
Probab=77.56  E-value=5.6  Score=19.80  Aligned_cols=33  Identities=21%  Similarity=0.311  Sum_probs=19.6

Q ss_pred             CEEEEECCCH-HHHHHHHHHHHCCCCCEEEEECCCH
Q ss_conf             9589988658-8999999998589967899954983
Q gi|254780206|r    1 MRVLLIGSGG-REHALAWKIAQSPLLSELWSIPGNP   35 (424)
Q Consensus         1 MkILviGsGg-rEhAl~~~l~~s~~~~~v~~~pgN~   35 (424)
                      |||.|||+.| =-.-+++-|..+..  +|.+.-.|+
T Consensus         1 mkI~IIGG~G~MG~~Fa~~f~~sGy--eV~I~gRd~   34 (441)
T PRK08655          1 MKISIIGGTGGLGKWFARFLKDKGY--EVIVWGRDP   34 (441)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCC
T ss_conf             9799994798177999999986798--899981573


No 220
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=77.34  E-value=5.7  Score=19.76  Aligned_cols=90  Identities=26%  Similarity=0.273  Sum_probs=46.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEE-EE---ECCCHHHHHCCEE-EECCCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             9589988658899999999858996789-99---5498357511705-51287898999999987189799997955787
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSEL-WS---IPGNPGIAQHAQC-VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v-~~---~pgN~g~~~~~~~-~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      .||.+||||-.-.-|-.|+.++...-+. |.   -|+..|.+..++. +.-.-.-.+.+++.-....|||||-...+..-
T Consensus         5 ~kvaiigsgni~tdlm~k~lr~g~~le~~~mvgidp~sdglaraarlgv~tt~egv~~ll~~p~~~di~lvfdatsa~~h   84 (310)
T COG4569           5 RKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARAARLGVATTHEGVIGLLNMPEFADIDLVFDATSAGAH   84 (310)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCCCCEEEECCCCCCCHHHHHHHCCCCCHHHHHHHHHHCCCCCCCCEEEECCCCCHH
T ss_conf             25999736862088999998547865630487348885077888861985224478999839998776558852432034


Q ss_pred             HHHHHHHHHCCCCEE
Q ss_conf             489989860588067
Q gi|254780206|r   76 NGISDALNAAGFKVF   90 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~   90 (424)
                      ..-+-.|.+.|++.+
T Consensus        85 ~~~a~~~ae~gi~~i   99 (310)
T COG4569          85 VKNAAALAEAGIRLI   99 (310)
T ss_pred             HHHHHHHHHCCCCEE
T ss_conf             440577886498423


No 221
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E.coli hypothetical protein ygdL. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown.
Probab=77.17  E-value=5.8  Score=19.73  Aligned_cols=66  Identities=20%  Similarity=0.146  Sum_probs=43.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-C-----CHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             5899886588999999998589967899954-9-----83575117055128789899999998718979999
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP-G-----NPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p-g-----N~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      +|||+|-||--.-.+..|.++. +.++.++. +     |-.-+.++....+-..-.+...+..++.+++.-|.
T Consensus        13 ~V~v~G~GGvGs~~a~~LarsG-VG~l~lvD~D~v~~SNLnRQ~~a~~~~iG~~K~~~~~~rl~~iNP~~~v~   84 (231)
T cd00755          13 HVAVVGLGGVGSWAAEALARSG-VGKLTLIDFDVVCVSNLNRQIHALLSTVGKPKVEVMAERIRDINPECEVD   84 (231)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCEECCCCHHHHHCCCHHHCCCCCHHHHHHHHHHHCCCCEEE
T ss_conf             7899888636899999999809-97599971999045444433016563369972899999999879998899


No 222
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated
Probab=77.15  E-value=5.8  Score=19.73  Aligned_cols=66  Identities=15%  Similarity=0.091  Sum_probs=36.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHCCEEEECCCCCH-------HHHHHHHHHHCCCEEE
Q ss_conf             95899886588999999998589967899954-9835751170551287898-------9999999871897999
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIP-GNPGIAQHAQCVAIDIQNH-------SAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~~~~~~i~~~d~-------~~i~~~a~~~~iDlvi   67 (424)
                      .+|||+|-||=-..++.-|..+. +-++.++. +.-..+.+...+-.+..|.       +...+..++.+++.-|
T Consensus        25 a~VlVvGaGGLGs~~a~~La~aG-VG~i~ivD~D~Ve~SNL~RQ~L~~e~Dig~~~pKa~aA~~~L~~iNp~v~I   98 (339)
T PRK07688         25 KHVLIIGAGALGTANAEMLVRAG-VGKVTIVDRDYVEWSNLQRQQLYTESDVKNNLPKAVAAKKRLEEINSEVRV   98 (339)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCEECCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHCCCCCEE
T ss_conf             97899877777799999999848-982999809992466788650656213322637799999999834998605


No 223
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=77.12  E-value=5.8  Score=19.72  Aligned_cols=35  Identities=26%  Similarity=0.312  Sum_probs=29.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCH
Q ss_conf             95899886588999999998589967899954983
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNP   35 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~   35 (424)
                      |||-|||.|.--.++|..|...+.++++.+..=|.
T Consensus         1 mKI~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~   35 (308)
T cd05292           1 MKVAIVGAGFVGSTTAYALLLRGLASEIVLVDINK   35 (308)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             97999994888999999998679988799991889


No 224
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase.
Probab=76.85  E-value=5.9  Score=19.67  Aligned_cols=128  Identities=16%  Similarity=0.163  Sum_probs=65.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEE-CCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEE--------EECCCH
Q ss_conf             589988658899999999858996789995-49835751170551287898999999987189799--------997955
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSI-PGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLV--------VVGPEL   72 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~-pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlv--------ivgpE~   72 (424)
                      +|.|-|.|---...++.|.+...  +|..+ ..++++      ++-+-.|++++.++..+++-.+.        .+.+++
T Consensus        34 ~v~IqGfGnVG~~~a~~l~~~Ga--kvvavsD~~G~i------~~~~Gldi~~l~~~~~~~~~~~~~~~~~~~~~i~~~~  105 (237)
T pfam00208        34 TVAVQGFGNVGSYAAEKLLELGA--KVVAVSDSSGYI------YDPNGIDIEELLELKEEGGGRVVEYAGSGAEYISGEE  105 (237)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCCEE------ECCCCCCHHHHHHHHHHHCCEEECCCCCCCEECCCCC
T ss_conf             99998988999999999998799--699998287679------9999999999999999719843124665753448710


Q ss_pred             HHHHHHHHHHHHCCCCEEECCHHHHHHH---HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCC
Q ss_conf             7874899898605880670106665552---0102357888765310111122344011111210124202563046534
Q gi|254780206|r   73 PLVNGISDALNAAGFKVFGPSQRAAKLE---SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCA  149 (424)
Q Consensus        73 pL~~gi~d~l~~~gi~v~Gp~~~aa~le---~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~ag  149 (424)
                      +|         ....-+|-|.+..-.|.   -.+.-+|-+.+-+|-|+.        .+|.+.+.+-|  +++=||-++-
T Consensus       106 ~~---------~~~~DIliPaA~~~~I~~~na~~i~ak~I~EgAN~p~t--------~eA~~~L~~rg--I~viPD~laN  166 (237)
T pfam00208       106 LW---------EIDCDILVPCATQNEINEENAKLIKAKAVVEGANMPTT--------PEADEILEERG--ILYAPDKAAN  166 (237)
T ss_pred             CC---------CCCCCEEEECCCCCCCCHHHHHHCCCCEEEECCCCCCC--------HHHHHHHHHCC--CEEECHHHHC
T ss_conf             00---------47666886445568899899986275489753789889--------78999999889--9896807752


Q ss_pred             CCCCCCH
Q ss_conf             3000232
Q gi|254780206|r  150 GKGVVVA  156 (424)
Q Consensus       150 GkGV~i~  156 (424)
                      .-||.+.
T Consensus       167 AGGV~vS  173 (237)
T pfam00208       167 AGGVTVS  173 (237)
T ss_pred             CCCEEEE
T ss_conf             8763544


No 225
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional
Probab=76.80  E-value=5.9  Score=19.66  Aligned_cols=91  Identities=12%  Similarity=0.204  Sum_probs=41.7

Q ss_pred             CCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEE-----ECCHH-HHHHHH-CCHHHH-----HHHHHHHHH
Q ss_conf             898999999987189799997955787489989860588067-----01066-655520-102357-----888765310
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVF-----GPSQR-AAKLES-SKSFAK-----KFCTKYGIP  116 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~-----Gp~~~-aa~le~-sK~~~K-----~~l~~~gIP  116 (424)
                      .|+.++++.+++..+...+.-.-..|....++.|.+.|+..+     |++.+ ..++-+ .-.|.|     +.++++|||
T Consensus        78 ~D~~ei~~~a~~~G~~~~l~TNG~lit~~~a~~L~~~gl~~v~vSlDg~~~e~hD~~rG~~G~f~~~~~~i~~l~~~Gi~  157 (375)
T PRK05301         78 KDLEELVAHARRLGLYTNLITSGVGLTEARLAALKAAGLDHIQLSFQDSDPELADRIAGTRGAFAQKLEVARLVKAHGYP  157 (375)
T ss_pred             CCHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             68999999999769758996067455799999998509988999567798778777637886299999999999974981


Q ss_pred             CCCCC-----CCCCCHHHHHHHHCCCCE
Q ss_conf             11112-----234401111121012420
Q gi|254780206|r  117 TATYQ-----HFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus       117 t~~~~-----~~~~~~ea~~~~~~~g~P  139 (424)
                      +---.     .+++.++..+++.++|.+
T Consensus       158 v~i~~ti~r~N~~~l~~i~~la~~lGv~  185 (375)
T PRK05301        158 LTLNAVIHRHNIDQIPRIIELAVELGAD  185 (375)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHCCCC
T ss_conf             6999872305688899999999972998


No 226
>cd00764 Eukaryotic_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to a subfamily of the PFKA family (cd00363) and include eukaryotic ATP-dependent phosphofructokinases. These have evolved from the bacterial PFKs by gene duplication and fusion events and exhibit complex allosteric behavior.
Probab=76.71  E-value=5.9  Score=19.64  Aligned_cols=36  Identities=22%  Similarity=0.369  Sum_probs=23.3

Q ss_pred             HHHHHHCCC-EEEECCCHHHH---------HHHHHHHHHCC------------CCEEE
Q ss_conf             999871897-99997955787---------48998986058------------80670
Q gi|254780206|r   56 HFCQEKHID-LVVVGPELPLV---------NGISDALNAAG------------FKVFG   91 (424)
Q Consensus        56 ~~a~~~~iD-lvivgpE~pL~---------~gi~d~l~~~g------------i~v~G   91 (424)
                      +-.++++|| ||++|-+-.|.         -++.+.|.+.|            ++++|
T Consensus        91 ~nL~~~gIdaLiVIGGDGSltGA~~fr~ew~~ll~eL~~~G~i~~~~~~~~~~l~ivG  148 (762)
T cd00764          91 YNLIQRGITNLCVIGGDGSLTGADLFRSEWPSLLEELVKDGKITEEEVAKYQHLNIVG  148 (762)
T ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCCCCCCEEE
T ss_conf             9999809988999879537877777665546789999872764234430257875788


No 227
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed
Probab=76.16  E-value=6.1  Score=19.54  Aligned_cols=64  Identities=30%  Similarity=0.426  Sum_probs=39.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCC-CEEEEECCCHHHHH-CCEEEE-CC-CCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             9589988658899999999858996-78999549835751-170551-28-7898999999987189799997
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLL-SELWSIPGNPGIAQ-HAQCVA-ID-IQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~-~~v~~~pgN~g~~~-~~~~~~-i~-~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      |||.+||.|-=..||+..|.++... .++++.+-|+.... +.+... +. ..|.+++++     +-|++|.+
T Consensus         1 MkIgfIG~GnMg~Aii~Gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~~v~~~~~n~~~~~-----~~dvi~La   68 (255)
T PRK06476          1 MRIGFIGTGAITEAMVTGLLSSPADVSEIIVSPRNAQIAARLAARFAKVRIAKDNQAVVD-----RSDVVFLA   68 (255)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCCCEEEECCHHHHHH-----HCCEEEEE
T ss_conf             989998646999999999997889925088989898999999987695598578899985-----18878886


No 228
>PRK12921 2-dehydropantoate 2-reductase; Provisional
Probab=75.98  E-value=5.6  Score=19.85  Aligned_cols=32  Identities=9%  Similarity=0.196  Sum_probs=23.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECC
Q ss_conf             958998865889999999985899678999549
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPG   33 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pg   33 (424)
                      |||+|+|.|+----+++.|++...-.. +++.+
T Consensus         1 MkI~I~GaGAiG~~~a~~L~~~g~~V~-lv~r~   32 (306)
T PRK12921          1 MKIAVVGAGAVGGTFGARLLEAGRDVT-FLGRS   32 (306)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEE-EEEEC
T ss_conf             989999924999999999983699889-99700


No 229
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]
Probab=75.62  E-value=6.3  Score=19.45  Aligned_cols=65  Identities=22%  Similarity=0.410  Sum_probs=25.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH-------------CCEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             58998865889999999985899678999549835751-------------17055128789899999998718979999
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ-------------HAQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~-------------~~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      +|||||.|.-.  .++.+.+-+.+.++.++-=||....             .+..+.+-+.|--+.++-+.+ +.|++|+
T Consensus        79 ~VLiiGgGdG~--tlRevlkh~~ve~i~~VEID~~Vi~~ar~~l~~~~~~~~dpRv~i~i~Dg~~~v~~~~~-~fDvIi~  155 (282)
T COG0421          79 RVLIIGGGDGG--TLREVLKHLPVERITMVEIDPAVIELARKYLPEPSGGADDPRVEIIIDDGVEFLRDCEE-KFDVIIV  155 (282)
T ss_pred             EEEEECCCCCH--HHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCEEEEECCHHHHHHHCCC-CCCEEEE
T ss_conf             69998897669--99999836884337999708899999998666754335797368996107999874887-6778998


Q ss_pred             C
Q ss_conf             7
Q gi|254780206|r   69 G   69 (424)
Q Consensus        69 g   69 (424)
                      -
T Consensus       156 D  156 (282)
T COG0421         156 D  156 (282)
T ss_pred             C
T ss_conf             5


No 230
>TIGR00250 TIGR00250 conserved hypothetical protein TIGR00250; InterPro: IPR005227   Holliday junction resolvases (HJRs) are key enzymes of DNA recombination. The principal HJRs are now known or confidently predicted for all bacteria and archaea whose genomes have been completely sequenced, with many species encoding multiple potential HJRs. Structural and evolutionary relationships of HJRs and related nucleases suggests that the HJR function has evolved independently from at least four distinct structural folds, namely RNase H, endonuclease, endonuclease VIIcolicin E and RusA (IPR008822 from INTERPRO):  The endonuclease fold, whose structural prototypes are the phage exonuclease, the very short patch repair nuclease (Vsr) and type II restriction enzymes, is shown to encompass by far a greater diversity of nucleases than previously suspected. This fold unifies archaeal HJRs (IPR002732 from INTERPRO), repair nucleases such as RecB (IPR004586 from INTERPRO) and Vsr (IPR004603 from INTERPRO), restriction enzymes and a variety of predicted nucleases whose specific activities remain to be determined.  The RNase H fold characterises the RuvC family (IPR002176 from INTERPRO), which is nearly ubiquitous in bacteria, and in addition the YqgF family (IPR005227 from INTERPRO). The proteins of this family, typified by Escherichia coli YqgF, are likely to function as an alternative to RuvC in most bacteria, but could be the principal HJRs in low-GC Gram-positive bacteria and Aquifex.   Endonuclease VII of phage T4 (IPR004211 from INTERPRO) is shown to serve as a structural template for many nucleases, including McrA and other type II restriction enzymes. Together with colicin E7, endonuclease VII defines a distinct metal-dependent nuclease fold.     Horizontal gene transfer, lineage-specific gene loss and gene family expansion, and non-orthologous gene displacement seem to have been major forces in the evolution of HJRs and related nucleases. A remarkable case of displacement is seen in the Lyme disease spirochete Borrelia burgdorferi, which does not possess any of the typical HJRs, but instead encodes, in its chromosome and each of the linear plasmids, members of the exonuclease family predicted to function as HJRs. The diversity of HJRs and related nucleases in bacteria and archaea contrasts with their near absence in eukaryotes. The few detected eukaryotic representatives of the endonuclease fold and the RNase H fold have probably been acquired from bacteria via horizontal gene transfer. The identity of the principal HJR(s) involved in recombination in eukaryotes remains uncertain; this function could be performed by topoisomerase IB or by a novel, so far undetected, class of enzymes. Likely HJRs and related nucleases were identified in the genomes of numerous bacterial and eukaryotic DNA viruses. Gene flow between viral and cellular genomes has probably played a major role in the evolution of this class of enzymes.   This family represents the YqgF family of putative Holliday junction resolvases. With the exception of the spirochetes, the YqgF family is represented in all bacterial lineages, including the mycoplasmas with their highly degenerate genomes.   The RuvC resolvases are conspicuously absent in the low-GC Gram-positive bacterial lineage, with the exception of Ureaplasma urealyticum (Q9PQY7 from SWISSPROT, ). Furthermore, loss of function ruvC mutants of E. coli show a residual HJR activity that cannot be ascribed to the prophage-encoded RusA resolvase . This suggests that the YqgF family proteins could be alternative HJRs whose function partially overlaps with that of RuvC . ; GO: 0000150 recombinase activity, 0003677 DNA binding, 0004518 nuclease activity, 0006281 DNA repair, 0006310 DNA recombination, 0006974 response to DNA damage stimulus.
Probab=75.04  E-value=3.3  Score=21.50  Aligned_cols=63  Identities=30%  Similarity=0.538  Sum_probs=42.6

Q ss_pred             CCCH--HHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCC-CCC
Q ss_conf             7898--9999999871897999979557874899898605880670106665552010235788876531011112-234
Q gi|254780206|r   48 IQNH--SAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ-HFS  124 (424)
Q Consensus        48 ~~d~--~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~-~~~  124 (424)
                      ..|.  +.|.++.++.+||.+|+|-  |+        +-.|  .+||...     .++.|+|.+-.++++|.--+. ..+
T Consensus        35 ~~d~Gl~~i~~l~ke~~~d~~vvGl--P~--------nM~G--t~g~~~~-----~~~kFA~r~~~~~~v~v~l~DERL~   97 (133)
T TIGR00250        35 EPDWGLSRIEELLKEWKVDKIVVGL--PL--------NMDG--TVGPLTK-----RAQKFAKRLEGRFGVPVELMDERLS   97 (133)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEECC--CC--------CCCC--CCCHHHH-----HHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             8862179999987315889788617--87--------8788--7250268-----8899998865540664378617613


Q ss_pred             CCH
Q ss_conf             401
Q gi|254780206|r  125 DPM  127 (424)
Q Consensus       125 ~~~  127 (424)
                      +.+
T Consensus        98 t~~  100 (133)
T TIGR00250        98 TVE  100 (133)
T ss_pred             HHH
T ss_conf             789


No 231
>COG1810 Uncharacterized protein conserved in archaea [Function unknown]
Probab=74.90  E-value=6.6  Score=19.32  Aligned_cols=15  Identities=13%  Similarity=0.242  Sum_probs=11.0

Q ss_pred             HHHHHHHHCCCCEEE
Q ss_conf             111112101242025
Q gi|254780206|r  127 MKAKQYVQNKSMPIV  141 (424)
Q Consensus       127 ~ea~~~~~~~g~PvV  141 (424)
                      ....+|++.+|.|-|
T Consensus       124 p~i~~F~e~FG~P~v  138 (224)
T COG1810         124 PHIDEFAERFGKPEV  138 (224)
T ss_pred             HHHHHHHHHCCCCEE
T ss_conf             579999997199559


No 232
>PRK06545 prephenate dehydrogenase; Validated
Probab=74.77  E-value=6.6  Score=19.30  Aligned_cols=65  Identities=20%  Similarity=0.156  Sum_probs=36.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEE-ECC--CCCHHHHHHHHHHHCCCEEEECC
Q ss_conf             95899886588999999998589967899954983575117055-128--78989999999871897999979
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCV-AID--IQNHSAIIHFCQEKHIDLVVVGP   70 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~-~i~--~~d~~~i~~~a~~~~iDlvivgp   70 (424)
                      .+|+|||-|=---.|+.+|++.....+++-..-|+-....+... .+|  ..+.+..+     .+.|+||++-
T Consensus         1 k~V~IiGlGLIGgSlalalk~~g~~~~i~~~d~~~~~l~~A~~~g~id~~~~~~~~~~-----~~~DlVvlat   68 (357)
T PRK06545          1 KTVLIVGLGLIGGSLALAIKAAGPDVFIIGYDPSGAQLARALGFGVIDELAEDLARAA-----AEADLIVLAV   68 (357)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCEECCCHHHHC-----CCCCEEEECC
T ss_conf             9799997787899999999854997699996699999999986899773048876715-----6799999949


No 233
>PRK07588 hypothetical protein; Provisional
Probab=74.69  E-value=5.8  Score=19.73  Aligned_cols=29  Identities=21%  Similarity=0.255  Sum_probs=21.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEE
Q ss_conf             95899886588999999998589967899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELW   29 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~   29 (424)
                      |||+|+|.|=---++|..|++...-..||
T Consensus         1 mkVlIvGaGiaGLalA~~L~r~G~~v~V~   29 (391)
T PRK07588          1 MKIAISGAGIAGATLAHWLQRTGHEPTLI   29 (391)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             97999993289999999998689998999


No 234
>PRK05599 hypothetical protein; Provisional
Probab=74.51  E-value=6.7  Score=19.25  Aligned_cols=65  Identities=18%  Similarity=0.269  Sum_probs=39.0

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH----H-H----C---CEEEECCCCCHHHHHHHHHHH-----C
Q ss_conf             958998865-8899999999858996789995498357----5-1----1---705512878989999999871-----8
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI----A-Q----H---AQCVAIDIQNHSAIIHFCQEK-----H   62 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~----~-~----~---~~~~~i~~~d~~~i~~~a~~~-----~   62 (424)
                      |.|||.|.. |--.|+|+.|.+  .. .+.++-.|+.-    + .    .   ...+..|.+|.+.+.+++++.     .
T Consensus         1 MtvlITGASsGIG~a~A~~lA~--G~-~vvl~~R~~e~l~~l~~~l~~~g~~~v~~~~~Dvtd~~~~~~~v~~~~~~~g~   77 (246)
T PRK05599          1 MSILILGGTSDIAGEIATLLAH--GE-DVVLAARRPEAAGGLAEDLRQLGATSVHVLSFDATDLDSHRELVKQTQELAGE   77 (246)
T ss_pred             CEEEEECCCHHHHHHHHHHHHC--CC-CEEEEECCHHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             9899988868999999999985--99-49999999999999999998625971899728999999999999999986198


Q ss_pred             CCEEEE
Q ss_conf             979999
Q gi|254780206|r   63 IDLVVV   68 (424)
Q Consensus        63 iDlviv   68 (424)
                      +|..+.
T Consensus        78 id~lv~   83 (246)
T PRK05599         78 ISLAVV   83 (246)
T ss_pred             CEEEEE
T ss_conf             439998


No 235
>PRK12555 chemotaxis-specific methylesterase; Provisional
Probab=74.49  E-value=6.7  Score=19.25  Aligned_cols=103  Identities=19%  Similarity=0.279  Sum_probs=57.8

Q ss_pred             CEEEEECCCH--HHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             9589988658--89999999985899678999549835751170551287898999999987189799997955787489
Q gi|254780206|r    1 MRVLLIGSGG--REHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         1 MkILviGsGg--rEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      |||||+-.-.  |+ .|...|.+++.++-+.                 ...|-++.++.++++++|+++.--+-|-..|+
T Consensus         2 irVLIVDDs~~~R~-~l~~~L~~~~~~eVv~-----------------~A~~g~eAl~~~~~~~pDvVllDi~MP~mdGi   63 (340)
T PRK12555          2 MNVGIVDDSALARE-ALRRIIARRPDHRVLG-----------------VATDGLQARDLCKAQPPDVVLLDLEMPRMDGL   63 (340)
T ss_pred             CEEEEEECCHHHHH-HHHHHHHHCCCCEEEE-----------------EECCHHHHHHHHHHHCCCEEEEECCCCCCCHH
T ss_conf             88999909889999-9999996099948999-----------------98999999999886199999972788999879


Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCC--CCHHHHHHHHCCCCEEEEEECC
Q ss_conf             9898605880670106665552010235788876531011112234--4011111210124202563046
Q gi|254780206|r   79 SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFS--DPMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus        79 ~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~--~~~ea~~~~~~~g~PvVVKp~~  146 (424)
                                               .+.|++|+++.+|.--....+  +.+.+.++++.=-+-++-||..
T Consensus        64 -------------------------e~l~~I~~~~p~PVimvSs~~~~~~~~~~~AL~~GA~D~i~KP~~  108 (340)
T PRK12555         64 -------------------------TFLRRIMRRRPCPVLIVSSLTEAGASITYEALGAGALDAVDKPKL  108 (340)
T ss_pred             -------------------------HHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHCCHHHEEECCCC
T ss_conf             -------------------------999999987899869985035657699999997797766847887


No 236
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria. In this system, EII is a lactose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. The IIC and IIB domains are expressed as a single protein from the lac operon. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include lactose, chitobiose/lichenan, ascorbate, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.
Probab=74.18  E-value=6.8  Score=19.20  Aligned_cols=86  Identities=15%  Similarity=0.291  Sum_probs=41.3

Q ss_pred             CEEEEECCCHHHHH-HHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHH-HHHHH
Q ss_conf             95899886588999-99999858996789995498357511705512878989999999871897999979557-87489
Q gi|254780206|r    1 MRVLLIGSGGREHA-LAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELP-LVNGI   78 (424)
Q Consensus         1 MkILviGsGgrEhA-l~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~p-L~~gi   78 (424)
                      ||||++=+||---+ ++.++.+.-.              ...-.+.++-....+..+.+  .+.|+++.||..- .-..+
T Consensus         1 ~kVLl~Ca~GmSSs~la~~m~k~A~--------------~~gi~~~i~A~~~~~~~d~~--~~yDvilLaPQv~~~~~~l   64 (99)
T cd05565           1 LNVLVLCAGGGTSGLLANALNKGAK--------------ERGVPLEAAAGAYGSHYDMI--PDYDLVILAPQMASYYDEL   64 (99)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHH--------------HCCCCEEEEEEECHHHHHHH--HCCCEEEECHHHHHHHHHH
T ss_conf             9099990798858999999999999--------------81997699951034489887--0799999985088889999


Q ss_pred             HHHHHHCCCCEEE-CCHHHHHHHHC
Q ss_conf             9898605880670-10666555201
Q gi|254780206|r   79 SDALNAAGFKVFG-PSQRAAKLESS  102 (424)
Q Consensus        79 ~d~l~~~gi~v~G-p~~~aa~le~s  102 (424)
                      ...-.+.|+|+.- |.++...|.+|
T Consensus        65 k~~ad~~Gi~v~~i~~~~Yi~lt~d   89 (99)
T cd05565          65 KKDTDRLGIKLVTTTGKQYIELTRD   89 (99)
T ss_pred             HHHHHHCCCEEEEECHHHEEEEECC
T ss_conf             9999983991887083452221159


No 237
>pfam01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus. This family represents the N-terminal region of the D-alanine--D-alanine ligase enzyme EC:6.3.2.4 which is thought to be involved in substrate binding. D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine:D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF).
Probab=74.00  E-value=5  Score=20.16  Aligned_cols=89  Identities=17%  Similarity=0.208  Sum_probs=41.1

Q ss_pred             CEEEEECCC-HHHHHH--------HHHHHHCCC-CCEEEEECCCHHHHH---CCEEEECCCCC---HHHHHHHHHHHCCC
Q ss_conf             958998865-889999--------999985899-678999549835751---17055128789---89999999871897
Q gi|254780206|r    1 MRVLLIGSG-GREHAL--------AWKIAQSPL-LSELWSIPGNPGIAQ---HAQCVAIDIQN---HSAIIHFCQEKHID   64 (424)
Q Consensus         1 MkILviGsG-grEhAl--------~~~l~~s~~-~~~v~~~pgN~g~~~---~~~~~~i~~~d---~~~i~~~a~~~~iD   64 (424)
                      |||.|+-+| ..||.+        ..+|.++.. +..+++...+--...   .......+..+   .......-...++|
T Consensus         1 ~kvavl~GG~S~EheISl~Sa~~v~~~L~~~~~~v~~i~i~~~g~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D   80 (110)
T pfam01820         1 MRIAVLFGGRSSEHEVSLKSARAVLKALDKEGYEVIPIDIDKDGRWLLGDGDLGLLAPDDKLDLEDKAELLAVLLAEKVD   80 (110)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCEEECCCHHHHHCCCCCCCCCCCCCCCCHHHCCCCC
T ss_conf             97999955686113889988999999997649759999874898787346403332135310012222221011124889


Q ss_pred             EEEE---CC--CHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             9999---79--5578748998986058806701
Q gi|254780206|r   65 LVVV---GP--ELPLVNGISDALNAAGFKVFGP   92 (424)
Q Consensus        65 lviv---gp--E~pL~~gi~d~l~~~gi~v~Gp   92 (424)
                      ++++   |+  |+=-   +...|+..++|..|.
T Consensus        81 vvF~~lHG~~GEDG~---iQglle~~~iPytGs  110 (110)
T pfam01820        81 VVFPVLHGPFGEDGT---IQGLLELLGIPYVGS  110 (110)
T ss_pred             EEEEECCCCCCCCCH---HHHHHHHCCCCCCCC
T ss_conf             999988898866578---999999819998899


No 238
>PRK07680 late competence protein ComER; Validated
Probab=73.91  E-value=6.9  Score=19.15  Aligned_cols=64  Identities=19%  Similarity=0.207  Sum_probs=39.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCC--CEEEEECCCHHHHH-CCEEE-ECC-CCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             9589988658899999999858996--78999549835751-17055-128-7898999999987189799997
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLL--SELWSIPGNPGIAQ-HAQCV-AID-IQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~--~~v~~~pgN~g~~~-~~~~~-~i~-~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      |||.+||.|-=-.||+..|.++..+  ..+++...|+.-.. +.+.. .+. ..|.+++   ++  +.|++|.+
T Consensus         1 MkI~fIG~GnMg~Aii~gl~~~~~~~~~~i~i~~r~~~~~~~l~~~~~~i~~~~~~~~~---~~--~~dvIiLa   69 (273)
T PRK07680          1 MNIGFIGTGNMGTILIEAFLESRAVKPSCLTITNRTPAKAYHIKEKYPSIHVAKTIEEV---IE--QSELIFIC   69 (273)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCEEEECCHHHH---HH--CCCEEEEE
T ss_conf             98999876999999999999779989456999889989999999876990886888999---84--09989996


No 239
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane]
Probab=73.83  E-value=7  Score=19.14  Aligned_cols=66  Identities=21%  Similarity=0.293  Sum_probs=42.7

Q ss_pred             CEEEEECCCHHH--HHHHHHHHHCCCCCEEEEEC-----CCHHHHH-CC-----EEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             958998865889--99999998589967899954-----9835751-17-----05512878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGRE--HALAWKIAQSPLLSELWSIP-----GNPGIAQ-HA-----QCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrE--hAl~~~l~~s~~~~~v~~~p-----gN~g~~~-~~-----~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |++||-|+-|.=  +-+-..+.+-+. .+|.+..     ||..... +.     ..+..|+.|.+.+.++.+++++|.|+
T Consensus         1 ~~iLVTGGaGFIGsnfvr~~~~~~~d-~~v~~~DkLTYAgn~~~l~~~~~~~~~~fv~~DI~D~~~v~~~~~~~~~D~Vv   79 (340)
T COG1088           1 MKILVTGGAGFIGSNFVRYILNKHPD-DHVVNLDKLTYAGNLENLADVEDSPRYRFVQGDICDRELVDRLFKEYQPDAVV   79 (340)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCC-CEEEEEECCCCCCCHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHCCCCEEE
T ss_conf             93799657515778999999960997-52899752331577878886406997158854554799999999744887599


No 240
>TIGR02049 gshA_ferroox glutamate--cysteine ligase; InterPro: IPR011718   This entry represents a rare family of glutamate--cysteine ligases, demonstrated first in Thiobacillus ferrooxidans and present in a few other Proteobacteria . It is the first of two enzymes for glutathione biosynthesis. It is also called gamma-glutamylcysteine synthetase..
Probab=73.76  E-value=1.7  Score=23.60  Aligned_cols=181  Identities=24%  Similarity=0.235  Sum_probs=100.7

Q ss_pred             HHHHHHHHHHHCC-CCEEECCHHHHHHHHCCH--------HHHHHHHHHHHH----CCCCCC-----C----------CC
Q ss_conf             8748998986058-806701066655520102--------357888765310----111122-----3----------44
Q gi|254780206|r   74 LVNGISDALNAAG-FKVFGPSQRAAKLESSKS--------FAKKFCTKYGIP----TATYQH-----F----------SD  125 (424)
Q Consensus        74 L~~gi~d~l~~~g-i~v~Gp~~~aa~le~sK~--------~~K~~l~~~gIP----t~~~~~-----~----------~~  125 (424)
                      |++||=|.|+... -+++ |+-.+-+-.+.|.        .+++|++..+|=    .|-|..     |          +.
T Consensus       165 Ls~giPdiL~~~~eQ~il-Ppl~~GW~~RrK~~hF~~Y~~vA~efa~~i~IDPWli~p~f~~c~G~DF~~~~g~~~la~~  243 (436)
T TIGR02049       165 LSAGIPDILKGIKEQDIL-PPLHAGWRSRRKSNHFEAYQEVASEFAKLIGIDPWLINPYFEKCDGIDFDDREGEDALATA  243 (436)
T ss_pred             CCCCCCHHHCCCCCCCCC-CCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHCCCCCCCCCCCCHHHHHHH
T ss_conf             447876677577526215-8753565444112678999999999864417784421200001066335610353689999


Q ss_pred             CHHHHHHHH----CC---CCE-EEEEECCCCCCCCCCCHHHHHHHHHHHHHH---HCC-----CCHHHHHHHHHHCCCCC
Q ss_conf             011111210----12---420-256304653430002323567788878875---144-----53177788775205752
Q gi|254780206|r  126 PMKAKQYVQ----NK---SMP-IVVKADGLCAGKGVVVAATVDEATSAIDRC---FQQ-----INSTVIIEEYLEGFEVS  189 (424)
Q Consensus       126 ~~ea~~~~~----~~---g~P-vVVKp~~~agGkGV~i~~~~~e~~~~~~~~---~~~-----~~~~VliEefl~G~E~S  189 (424)
                      .|.+++.++    +.   .-| +|||+|-..=|.||.-++|-+|.+.-=.+-   +..     .-+.|+|+|=+.-.|-.
T Consensus       244 Vd~vL~~~~~kY~eYgI~~~Pyv~vKAdaGTYGMGimTa~sgeE~l~LNrK~R~kM~k~KEGl~vs~ViiQEGV~T~e~~  323 (436)
T TIGR02049       244 VDQVLSKVQKKYEEYGIHEKPYVIVKADAGTYGMGIMTAKSGEEVLGLNRKERNKMAKVKEGLEVSEVIIQEGVYTFEKL  323 (436)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCEEEEECHHHHHCCCCCCCCCCCEEECCCCCCCEEEECCCCHHHHC
T ss_conf             99999999998875587568758997078874550588426378542530001344311257010556784784406530


Q ss_pred             E-EEEC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC----CCCCCEEEECCHHHHHHHHHHHCCCE
Q ss_conf             3-4421------57763103520001113566544444344300001234----43222010000089999986204623
Q gi|254780206|r  190 F-FALC------DGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM----SQELYSTVIQKIILPTIEGMQKEQNP  258 (424)
Q Consensus       190 v-~~i~------dG~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~----~~~~~~~i~~~i~~~~~~~l~~~~~~  258 (424)
                      - .+.+      =|..++ ...=|=|.+. +-|...|++|| .+-|.++-    +.+..++. -+.++.+.+..+..++|
T Consensus       324 ~q~avAEPvvYmig~~v~-GgfYRvh~~r-g~denLNA~g~-~F~pls~~iPtGnGdnsqea-Peackrvfeq~~s~~lP  399 (436)
T TIGR02049       324 NQEAVAEPVVYMIGRTVV-GGFYRVHTGR-GVDENLNAPGM-HFVPLSFSIPTGNGDNSQEA-PEACKRVFEQFDSLSLP  399 (436)
T ss_pred             CCCCCCCCEEEECCCEEE-EEEEEECCCC-CCCCCCCCCCC-EEECCCCCCCCCCCCCCCCH-HHHHHHHHHHHHHCCCC
T ss_conf             454655640233177677-5578752778-87536789886-55037766667887542001-58899998877532787


Q ss_pred             E
Q ss_conf             5
Q gi|254780206|r  259 F  259 (424)
Q Consensus       259 y  259 (424)
                      -
T Consensus       400 ~  400 (436)
T TIGR02049       400 R  400 (436)
T ss_pred             C
T ss_conf             5


No 241
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=73.68  E-value=7  Score=19.11  Aligned_cols=10  Identities=20%  Similarity=0.288  Sum_probs=4.8

Q ss_pred             CCCCCCCCHH
Q ss_conf             3430002323
Q gi|254780206|r  148 CAGKGVVVAA  157 (424)
Q Consensus       148 agGkGV~i~~  157 (424)
                      +||-|+.-..
T Consensus       105 aGG~GiaPl~  114 (246)
T cd06218         105 GGGIGIAPLL  114 (246)
T ss_pred             ECCCCHHHHH
T ss_conf             6573154399


No 242
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This group includes the type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine/isoleucine/valine binding protein (LIVBP); its ligand specificity has not been determined experimentally.
Probab=73.50  E-value=7.1  Score=19.08  Aligned_cols=96  Identities=17%  Similarity=0.213  Sum_probs=52.6

Q ss_pred             CCCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHH---HHHHHHC-CCC-CCCCCCHHHHHHHHCC
Q ss_conf             8979999795578748998986058806701066655520102357888---7653101-111-2234401111121012
Q gi|254780206|r   62 HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC---TKYGIPT-ATY-QHFSDPMKAKQYVQNK  136 (424)
Q Consensus        62 ~iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l---~~~gIPt-~~~-~~~~~~~ea~~~~~~~  136 (424)
                      .+-.|+.+--+|..+|+++.+..-|=.+.|-+-.. ..+....+.|+++   ++.|+.- |.. ......+++++++++.
T Consensus        81 ~iPIVF~~V~dPv~aglv~s~~~pg~NvTGvs~~~-~~~~~l~l~~~l~P~~k~igvlyn~~e~ns~~~~~~~~~~a~~~  159 (281)
T cd06325          81 DIPIVFTAVTDPVGAGLVKSLEKPGGNVTGVSDLV-PVETQLELLKKLLPDAKTVGVLYNPSEANSVVQVKELKKAAAKL  159 (281)
T ss_pred             CCCEEEEECCCHHHCCCCCCCCCCCCCEEEEECCC-CHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC
T ss_conf             99989995168666275435678999579987874-78999999998588985899995799865699999999999976


Q ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             420256304653430002323567788878875
Q gi|254780206|r  137 SMPIVVKADGLCAGKGVVVAATVDEATSAIDRC  169 (424)
Q Consensus       137 g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~  169 (424)
                      |+.++..+.           .+..|...+++..
T Consensus       160 Gi~v~~~~v-----------~~~~ei~~a~~~l  181 (281)
T cd06325         160 GIEVVEATV-----------SSSNDVQQAAQSL  181 (281)
T ss_pred             CCEEEEEEC-----------CCHHHHHHHHHHH
T ss_conf             988999945-----------9888999999975


No 243
>PRK08229 2-dehydropantoate 2-reductase; Provisional
Probab=73.07  E-value=6.9  Score=19.16  Aligned_cols=29  Identities=21%  Similarity=0.319  Sum_probs=21.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             9589988658899999999858996789995
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSI   31 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~   31 (424)
                      |||+|||.|+----++..|.+...  +|.+.
T Consensus         3 mkI~IiGaGAvG~~~a~~L~~aG~--~V~lv   31 (341)
T PRK08229          3 ARICVLGAGSIGCYLGGRLAAAGA--DVTLI   31 (341)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--CEEEE
T ss_conf             779998967999999999985899--87999


No 244
>PRK06223 malate dehydrogenase; Reviewed
Probab=72.68  E-value=7.4  Score=18.95  Aligned_cols=111  Identities=26%  Similarity=0.362  Sum_probs=58.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH----H-HCCEEEE-------CC-CCCHHHHHHHHHHHCCCEEE
Q ss_conf             9589988658899999999858996789995498357----5-1170551-------28-78989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI----A-QHAQCVA-------ID-IQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~----~-~~~~~~~-------i~-~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |||-|||.|.--.+++..|...+..+++.+..-|+..    + .+.....       +. ..|.++      -.+-|+||
T Consensus         1 mKI~IiGaG~VG~~~a~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~------~~daDiVV   74 (312)
T PRK06223          1 MKISIIGAGNVGATLAHLLALKELGKDVVLFDIPEGIPQGKALDIAESSAVDGFDAKITGTNDYAD------IAGSDVVI   74 (312)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEEEECCCHHH------HCCCCEEE
T ss_conf             979999969899999999985799874899769997336798887651433688847983788899------57999999


Q ss_pred             ECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHH---HHHHHHCCCCCCCCCCHHHHHHH
Q ss_conf             9795578748998986058806701066655520102357888---76531011112234401111121
Q gi|254780206|r   68 VGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC---TKYGIPTATYQHFSDPMKAKQYV  133 (424)
Q Consensus        68 vgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l---~~~gIPt~~~~~~~~~~ea~~~~  133 (424)
                      +-.-.|.-.|.               .+...+..+-...|+++   .+++ |.+.+-.++|.-+...++
T Consensus        75 itag~~rk~g~---------------tR~dll~~N~~I~k~i~~~i~~~~-p~~iilvvsNPvDv~t~~  127 (312)
T PRK06223         75 ITAGVPRKPGM---------------SRDDLLGINAKIMKDVGEGIKKYA-PDAIVIVITNPVDAMTYV  127 (312)
T ss_pred             EECCCCCCCCC---------------CHHHHHHHHHHHHHHHHHHHHHHC-CCCEEEEECCCHHHHHHH
T ss_conf             90677899998---------------868999987899999999998409-981899936936899999


No 245
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B. subtilis) [DNA replication, recombination, and repair]
Probab=72.67  E-value=6.4  Score=19.39  Aligned_cols=70  Identities=26%  Similarity=0.542  Sum_probs=45.4

Q ss_pred             CCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             89899999998718979999795578748998986058806701066655520102357888765310111122344011
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMK  128 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~e  128 (424)
                      .|++.+.+++++++++.+|+|-.  +        ...|-.  ||     +-+..+.|++.+.++.++|.--+..=-+-.+
T Consensus        40 ~~~~~l~~li~~~~~~~vVVGlP--~--------~m~g~~--~~-----~~~~~~~f~~~L~~r~~lpv~l~DERltTv~  102 (141)
T COG0816          40 QDFNALLKLVKEYQVDTVVVGLP--L--------NMDGTE--GP-----RAELARKFAERLKKRFNLPVVLWDERLSTVE  102 (141)
T ss_pred             HHHHHHHHHHHHHCCCEEEEECC--C--------CCCCCC--CH-----HHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
T ss_conf             56999999999838887999667--6--------888871--34-----6999999999998764987899818657999


Q ss_pred             HHHHHHC
Q ss_conf             1112101
Q gi|254780206|r  129 AKQYVQN  135 (424)
Q Consensus       129 a~~~~~~  135 (424)
                      |...+.+
T Consensus       103 A~~~L~~  109 (141)
T COG0816         103 AERMLIE  109 (141)
T ss_pred             HHHHHHH
T ss_conf             9999997


No 246
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism]
Probab=72.62  E-value=4.1  Score=20.82  Aligned_cols=109  Identities=18%  Similarity=0.210  Sum_probs=53.1

Q ss_pred             HHHHHHHHHHH-----CCCEEEECCCH-HHHHHHHHHHHHCCC------CEEECCHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             89999999871-----89799997955-787489989860588------0670106665552010235788876531011
Q gi|254780206|r   51 HSAIIHFCQEK-----HIDLVVVGPEL-PLVNGISDALNAAGF------KVFGPSQRAAKLESSKSFAKKFCTKYGIPTA  118 (424)
Q Consensus        51 ~~~i~~~a~~~-----~iDlvivgpE~-pL~~gi~d~l~~~gi------~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~  118 (424)
                      .+++.+|+++.     +.+.++..|.. |-..-....|.+.|=      |++.|=..+...-+.|...-.+..+.     
T Consensus        66 ~~ai~~w~~~r~~~~i~~e~i~~~p~VVpgi~~~I~~~T~~gd~Vvi~tPvY~PF~~~i~~n~R~~i~~pL~~~~-----  140 (388)
T COG1168          66 YAAIAHWFKQRHQWEIKPEWIVFVPGVVPGISLAIRALTKPGDGVVIQTPVYPPFYNAIKLNGRKVIENPLVEDD-----  140 (388)
T ss_pred             HHHHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCEEEECCCCCCC-----
T ss_conf             999999999713777885528983751276999999837699826964888618999875169679746643469-----


Q ss_pred             CCCCCCCCHHHHHHHHCC--CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             112234401111121012--4202563046534300023235677888788751
Q gi|254780206|r  119 TYQHFSDPMKAKQYVQNK--SMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF  170 (424)
Q Consensus       119 ~~~~~~~~~ea~~~~~~~--g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~  170 (424)
                       .+..=|.+++.+.+.+-  +.=+..-|-...|     .|.+.+|+..-.+-+.
T Consensus       141 -~~y~iD~~~LE~~~~~~~vkl~iLCnPHNP~G-----rvwt~eeL~~i~elc~  188 (388)
T COG1168         141 -GRYEIDFDALEKAFVDERVKLFILCNPHNPTG-----RVWTKEELRKIAELCL  188 (388)
T ss_pred             -CCEEECHHHHHHHHHCCCCCEEEEECCCCCCC-----CCCCHHHHHHHHHHHH
T ss_conf             -84775299999998437760899937999998-----6436999999999999


No 247
>PRK13978 ribose-5-phosphate isomerase A; Provisional
Probab=71.71  E-value=6.2  Score=19.51  Aligned_cols=88  Identities=10%  Similarity=0.191  Sum_probs=51.0

Q ss_pred             CCCHHHHHHHHHHHCCCEE----EE----CCCH-HHHHHHHHHHHHCCCCEEE-CCHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             7898999999987189799----99----7955-7874899898605880670-10666555201023578887653101
Q gi|254780206|r   48 IQNHSAIIHFCQEKHIDLV----VV----GPEL-PLVNGISDALNAAGFKVFG-PSQRAAKLESSKSFAKKFCTKYGIPT  117 (424)
Q Consensus        48 ~~d~~~i~~~a~~~~iDlv----iv----gpE~-pL~~gi~d~l~~~gi~v~G-p~~~aa~le~sK~~~K~~l~~~gIPt  117 (424)
                      +.|.+++.+.|-+..+++|    ++    |+.. .+..-+++.+++.++.+.| ||+.         .++.+++++|||.
T Consensus         1 m~~~~~lK~~aa~~A~~~V~~gmviGLGTGSTv~~~I~~L~~~~k~~~l~i~~V~tS~---------~T~~~a~~~Gi~l   71 (228)
T PRK13978          1 MKDVKALKLMTLNDVLSQINGDMTLGIGTGSTMELLLPQMAQLIKERGYNITGVCTSN---------KIAFLAKELGIKI   71 (228)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEECCH---------HHHHHHHHCCCEE
T ss_conf             9868999999999999658999999855579999999999999860798489997999---------9999999879807


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCE-EEEEE
Q ss_conf             1112234401111121012420-25630
Q gi|254780206|r  118 ATYQHFSDPMKAKQYVQNKSMP-IVVKA  144 (424)
Q Consensus       118 ~~~~~~~~~~ea~~~~~~~g~P-vVVKp  144 (424)
                      -....+...+=+.+-++++..- -.||-
T Consensus        72 ~~l~~~~~iDl~iDGADEvd~~lnlIKG   99 (228)
T PRK13978         72 CEINDVDHIDLAIDGADEVDPSLNIIKG   99 (228)
T ss_pred             ECCCCCCCCCEEEECCCCCCCCCCEEEE
T ss_conf             6455687346798088641788788987


No 248
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated
Probab=71.43  E-value=7.9  Score=18.76  Aligned_cols=18  Identities=17%  Similarity=0.266  Sum_probs=9.5

Q ss_pred             HHHHHHHCCCCCCCCCCH
Q ss_conf             876531011112234401
Q gi|254780206|r  110 CTKYGIPTATYQHFSDPM  127 (424)
Q Consensus       110 l~~~gIPt~~~~~~~~~~  127 (424)
                      +++.|.|.-+-...++.+
T Consensus        96 W~~aGlPvErp~~~~~~~  113 (379)
T PRK08762         96 WRDAGLPLERPTLLTDEQ  113 (379)
T ss_pred             HHHCCCCCCCCCCCCHHH
T ss_conf             997799855588688113


No 249
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional
Probab=71.24  E-value=7.9  Score=18.73  Aligned_cols=30  Identities=27%  Similarity=0.317  Sum_probs=22.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             5899886588999999998589967899954
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      +|||||-||=-..++.-|..+. +.++.++.
T Consensus        26 ~VlIVGaGGLGs~~a~~La~aG-VG~l~ivD   55 (337)
T PRK12475         26 HVLIIGAGALGAANAEALVRAG-IGKLTIAD   55 (337)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEE
T ss_conf             6999977777899999999828-98699984


No 250
>PRK13435 response regulator; Provisional
Probab=71.21  E-value=8  Score=18.72  Aligned_cols=114  Identities=11%  Similarity=0.144  Sum_probs=55.1

Q ss_pred             CEEEEECCCH--HHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHH
Q ss_conf             9589988658--89999999985899678999549835751170551287898999999987189799997955787489
Q gi|254780206|r    1 MRVLLIGSGG--REHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         1 MkILviGsGg--rEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      |||||+-.-.  |+ .|...|.+.+ ...+.                 ...+.++.++.++++++|+++.--.-|  .  
T Consensus         2 mRILIVEDe~~i~~-~l~~~L~~~G-~~vv~-----------------~A~~~~eAl~~~~~~~PDlvllDi~Lp--d--   58 (141)
T PRK13435          2 LRVLIVEDEALIAL-ELEKLLEEAG-HQVVG-----------------IASTSEQALALGRRAQPDVALVDIRLA--D--   58 (141)
T ss_pred             CEEEEECCCHHHHH-HHHHHHHHCC-CEEEE-----------------EECCHHHHHHHHHCCCCCEEEECCCCC--C--
T ss_conf             78999899899999-9999999879-97999-----------------759999999997659998999788789--9--


Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHH
Q ss_conf             98986058806701066655520102357888765310111122344011111210124202563046534300023235
Q gi|254780206|r   79 SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAAT  158 (424)
Q Consensus        79 ~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~  158 (424)
                             |.       ...      ..+|++-...++|.--   .+...+.......-..-+++||            .+
T Consensus        59 -------G~-------~G~------e~~r~l~~~~~ipvI~---lTa~~d~~~~~~aGA~dyl~KP------------f~  103 (141)
T PRK13435         59 -------GP-------TGV------EVARRLSIDGGVEVIF---MTANPERVGHDFAGALGVIAKP------------YS  103 (141)
T ss_pred             -------CC-------CHH------HHHHHHHHCCCCCEEE---EECCHHHHHHHHCCCCCEEECC------------CC
T ss_conf             -------99-------899------9999998759983899---9777998601345998589899------------99


Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             67788878875144
Q gi|254780206|r  159 VDEATSAIDRCFQQ  172 (424)
Q Consensus       159 ~~e~~~~~~~~~~~  172 (424)
                      .+|+.++++.+...
T Consensus       104 ~~eL~~ai~~~~~r  117 (141)
T PRK13435        104 LRQVARALSYVAAR  117 (141)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             89999999999971


No 251
>cd01968 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of the NifE subunit of the NifEN complex: NifE forms an alpha2beta2 tetramer with NifN.  NifE and NifN are structurally homologous to nitrogenase MoFe protein alpha and beta subunits respectively.  NifEN participates in the synthesis of the iron-molybdenum cofactor (FeMoco) of the MoFe protein.  NifB-co (an iron and sulfur containing precursor of the FeMoco) from NifB is transferred to the NifEN complex where it is further processed to FeMoco. The NifEN bound precursor of FeMoco has been identified as a molybdenum-free, iron- and sulfur- containing analog of FeMoco. It has been suggested that this NifEN bound precursor also acts as a cofactor precursor in nitrogenase systems which require a cofactor other than FeMoco: i.e. iron-vanadium cofactor (FeVco) or iron only cofactor (FeFeco).
Probab=71.16  E-value=8  Score=18.72  Aligned_cols=92  Identities=13%  Similarity=0.184  Sum_probs=53.5

Q ss_pred             HHHHHHHHHHHCCCEEEEC----CCHHH---HHHHHHHHHH-CCCCEE---ECCHHHHHHHHCCHHHHHHHHHH---HHH
Q ss_conf             8999999987189799997----95578---7489989860-588067---01066655520102357888765---310
Q gi|254780206|r   51 HSAIIHFCQEKHIDLVVVG----PELPL---VNGISDALNA-AGFKVF---GPSQRAAKLESSKSFAKKFCTKY---GIP  116 (424)
Q Consensus        51 ~~~i~~~a~~~~iDlvivg----pE~pL---~~gi~d~l~~-~gi~v~---Gp~~~aa~le~sK~~~K~~l~~~---gIP  116 (424)
                      .+.|.+..++.+++++++-    +| -.   +.+++..+++ .++|++   .|+-..++.++-....+.+++..   .-|
T Consensus        75 ~~~I~~~~~~~~P~~I~v~tTC~~e-~IGDDi~~v~~~~~~~~~~pvv~v~tpgf~Gs~~~G~~~a~~ai~~~l~~~~~~  153 (410)
T cd01968          75 YKAILEIIERYHPKAVFVYSTCVVA-LIGDDIDAVCKTASEKFGIPVIPVHSPGFVGNKNLGNKLACEALLDHVIGTEEP  153 (410)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCHHH-HHCCCHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             9999999985499889997567088-735639999999888619977983289978757778999999999985236788


Q ss_pred             CC----------CCCCCCCCHHHHHHHHCCCCEEEEE
Q ss_conf             11----------1122344011111210124202563
Q gi|254780206|r  117 TA----------TYQHFSDPMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus       117 t~----------~~~~~~~~~ea~~~~~~~g~PvVVK  143 (424)
                      .+          .|..-.|..+.+..++.+|.++...
T Consensus       154 ~~~~~~~vNiig~~~~~~D~~eik~lL~~~Gl~v~~~  190 (410)
T cd01968         154 EPLTPYDINLIGEFNVAGELWGVKPLLEKLGIRVLAS  190 (410)
T ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEE
T ss_conf             8898881899688788766899999999769847774


No 252
>PRK05993 short chain dehydrogenase; Provisional
Probab=71.07  E-value=8  Score=18.70  Aligned_cols=63  Identities=16%  Similarity=0.292  Sum_probs=40.5

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHH-HH----HCCEEEECCCCCHHHHHHHHHH------HCCCEEE
Q ss_conf             8998865-889999999985899678999549835-75----1170551287898999999987------1897999
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPG-IA----QHAQCVAIDIQNHSAIIHFCQE------KHIDLVV   67 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g-~~----~~~~~~~i~~~d~~~i~~~a~~------~~iDlvi   67 (424)
                      |||-|.+ |--.|+|..|.+...  .|+..--+.. ..    ...+++.+|..|.+++.+++.+      .++|.+|
T Consensus         7 vlITGassGIG~alA~~la~~G~--~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~v~~~~~~~~g~id~lv   81 (277)
T PRK05993          7 ILITGCSSGIGAYCAHALQKRGW--RVFATCRKPEDIAALEAEGLEAFYLDYAEPESIAALVAQVLELSGGKLDALF   81 (277)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             99925686999999999998799--9999979999999998489819997266779999999999998089706999


No 253
>PRK00711 D-amino acid dehydrogenase small subunit; Validated
Probab=71.05  E-value=7.7  Score=18.83  Aligned_cols=30  Identities=37%  Similarity=0.530  Sum_probs=23.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             95899886588999999998589967899954
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      |||+|||+|----+.||-|++...  +|.+..
T Consensus         1 m~VvIIGaGi~G~stA~~La~~G~--~V~vle   30 (416)
T PRK00711          1 MRVVVLGSGVVGVTSAWYLARAGH--EVTVID   30 (416)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCC--CEEEEE
T ss_conf             979999944999999999996899--689996


No 254
>PRK07261 topology modulation protein; Provisional
Probab=70.85  E-value=4.3  Score=20.66  Aligned_cols=27  Identities=26%  Similarity=0.310  Sum_probs=18.6

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCE
Q ss_conf             958998865889-999999985899678
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSE   27 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~   27 (424)
                      |||+|||+.|-- -.||.+|++.-.+..
T Consensus         1 MrI~IiG~sGsGKSTlAr~L~~~~~ip~   28 (171)
T PRK07261          1 MKIAIIGYSGSGKSTLARFLGQHYNCPV   28 (171)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCE
T ss_conf             9899988999868999999999879797


No 255
>TIGR03022 WbaP_sugtrans Undecaprenyl-phosphate galactose phosphotransferase, WbaP. This model includes the enterobacterial enzymes, where the function is presumed to be identical to the S. typhimurium enzyme as well as a somewhat broader group which are likely to catalyze the same or highly similar reactions based on a phylogenetic tree-building analysis of the broader sugar transferase family. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. The most likely heterogeneity would be in the precise nature of the sugar molecule transferred.
Probab=70.80  E-value=8.1  Score=18.66  Aligned_cols=23  Identities=22%  Similarity=0.426  Sum_probs=11.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             58998865889999999985899
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPL   24 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~   24 (424)
                      ||||||+|.+-..++..+.+.+.
T Consensus       127 ~vlIVG~~~~a~~l~~~l~~~~~  149 (456)
T TIGR03022       127 PAVIIGAGQNAAILYRALQSNPQ  149 (456)
T ss_pred             CEEEEECCHHHHHHHHHHHHCCC
T ss_conf             18999787899999999983833


No 256
>PRK10329 glutaredoxin-like protein; Provisional
Probab=70.73  E-value=7.5  Score=18.89  Aligned_cols=41  Identities=15%  Similarity=0.245  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCC---EEEEEEC
Q ss_conf             23578887653101111223440111112101242---0256304
Q gi|254780206|r  104 SFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSM---PIVVKAD  145 (424)
Q Consensus       104 ~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~---PvVVKp~  145 (424)
                      ..+|++|.++||+--.-. ++.-.+|.+++...||   |+|+-.+
T Consensus        15 ~aTKr~L~~~gI~y~~vd-i~~dpea~~~vk~~G~~q~PVV~~~~   58 (81)
T PRK10329         15 HATKRAMESRGFDFEMIN-VDRVPEAADTLRAQGFRQLPVVIAGD   58 (81)
T ss_pred             HHHHHHHHHCCCCEEEEE-CCCCHHHHHHHHHCCCCCCCEEEECC
T ss_conf             989999998799429985-89999999999976985599899699


No 257
>PRK10669 putative cation:proton antiport protein; Provisional
Probab=70.47  E-value=8.2  Score=18.61  Aligned_cols=23  Identities=4%  Similarity=-0.301  Sum_probs=9.7

Q ss_pred             EEECCCHHHHHHHHHHHHHCCCCC
Q ss_conf             996289899999999998525899
Q gi|254780206|r  378 TALGKTITESRELAYHMVENIDWK  401 (424)
Q Consensus       378 v~~g~~l~eA~~~ay~~i~~I~~~  401 (424)
                      +..=+|.++++ ++.+.+++.+-+
T Consensus       486 vit~~d~~~~~-~iv~~~r~~~p~  508 (558)
T PRK10669        486 LLTIPNGYEAG-EIVASAREKNPD  508 (558)
T ss_pred             EEEECCHHHHH-HHHHHHHHHCCC
T ss_conf             99819889999-999999987869


No 258
>PRK09423 gldA glycerol dehydrogenase; Provisional
Probab=70.33  E-value=8.3  Score=18.59  Aligned_cols=42  Identities=19%  Similarity=0.419  Sum_probs=28.7

Q ss_pred             CCHHHHHHHHHHHCCCEEE-ECCCHHH--HHHHHHHHHHCCCCEEE-CC
Q ss_conf             8989999999871897999-9795578--74899898605880670-10
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVV-VGPELPL--VNGISDALNAAGFKVFG-PS   93 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlvi-vgpE~pL--~~gi~d~l~~~gi~v~G-p~   93 (424)
                      .+.+.+.+.++++++|+|| +|--.++  +-.+++   ..|+|++. ||
T Consensus        71 ~~v~~~~~~~~~~~~D~IiavGGGS~iD~AKaia~---~~~~P~i~IPT  116 (366)
T PRK09423         71 NEIDRLVAIAEENGCDVIIGIGGGKTLDTAKAVAD---YLGVPVVIVPT  116 (366)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHH---HCCCCEEEECC
T ss_conf             99999999998649998999378388777999999---82899799568


No 259
>PRK07102 short chain dehydrogenase; Provisional
Probab=70.06  E-value=8.4  Score=18.55  Aligned_cols=66  Identities=20%  Similarity=0.266  Sum_probs=40.6

Q ss_pred             CE-EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH-H----H-------CCEEEECCCCCHHHHHHHHHHH--CCC
Q ss_conf             95-8998865-8899999999858996789995498357-5----1-------1705512878989999999871--897
Q gi|254780206|r    1 MR-VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI-A----Q-------HAQCVAIDIQNHSAIIHFCQEK--HID   64 (424)
Q Consensus         1 Mk-ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~-~----~-------~~~~~~i~~~d~~~i~~~a~~~--~iD   64 (424)
                      || |||.|.+ |--.|+|..|.+...  +|++.--|..- .    +       .......|..|.+.+.++..+.  .+|
T Consensus         1 MK~vlITGassGIG~a~A~~la~~G~--~v~l~~R~~~~l~~~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~~~~~~d   78 (243)
T PRK07102          1 MKKILIIGATSDIARACARRYAAAGA--RLYLAARDTERLERIAADLEARGAVAVATHELDILDTARHAAFLDNLPALPD   78 (243)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             99799915745999999999998799--8999989889999999999853586289984340369999999999875379


Q ss_pred             EEEE
Q ss_conf             9999
Q gi|254780206|r   65 LVVV   68 (424)
Q Consensus        65 lviv   68 (424)
                      .++.
T Consensus        79 ~~v~   82 (243)
T PRK07102         79 TVLI   82 (243)
T ss_pred             EEEE
T ss_conf             7999


No 260
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=69.89  E-value=3.8  Score=21.04  Aligned_cols=90  Identities=18%  Similarity=0.223  Sum_probs=48.1

Q ss_pred             HCCCEEEECCCHH-HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE
Q ss_conf             1897999979557-874899898605880670106665552010235788876531011112234401111121012420
Q gi|254780206|r   61 KHIDLVVVGPELP-LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP  139 (424)
Q Consensus        61 ~~iDlvivgpE~p-L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P  139 (424)
                      +--|++++.|.+- -.+...+.|++.|..++|-|-++.  ++-+.|....-+..||-..+|-.+.|...  +..+.+|  
T Consensus        41 ~P~DFTfVCpTEi~af~~~~~eF~~~g~eVigvS~Ds~--fsH~aW~~~~~~~~gi~~i~~P~iaD~~~--~vs~~yg--  114 (194)
T COG0450          41 YPADFTFVCPTEIIAFAKRYEEFQKRGVEVIGVSTDSV--FSHKAWKATIREAGGIGKIKFPMIADPKG--EIARAYG--  114 (194)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCH--HHHHHHHHCHHHCCCCCCEECCEEECCCH--HHHHHCC--
T ss_conf             46887855840199997652889985998999966848--98999973677509835420066876822--6889709--


Q ss_pred             EEEEECCCCCCCCCCCHH
Q ss_conf             256304653430002323
Q gi|254780206|r  140 IVVKADGLCAGKGVVVAA  157 (424)
Q Consensus       140 vVVKp~~~agGkGV~i~~  157 (424)
                       |+-|+...+-||++|++
T Consensus       115 -vl~~~~g~a~R~~FIID  131 (194)
T COG0450         115 -VLHPEEGLALRGTFIID  131 (194)
T ss_pred             -CCCCCCCCCEEEEEEEC
T ss_conf             -80567772046899999


No 261
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454    Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants . RhaD from Rhizobium leguminosarum bv. trifolii is encoded by a gene occurring in a rhamnose utilisation cluster, and is necessary for growth on this compound . This protein is predicted to be a bifunctional NAD-dependent aldolase/dehydrogenase..
Probab=69.80  E-value=8.5  Score=18.52  Aligned_cols=23  Identities=13%  Similarity=0.317  Sum_probs=11.4

Q ss_pred             EEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             44215776310352000111356
Q gi|254780206|r  191 FALCDGKTAIPFTTARDHKRIHD  213 (424)
Q Consensus       191 ~~i~dG~~~~~l~~~~dyKr~~~  213 (424)
                      -.|.|...++-|.-.+|+||+.+
T Consensus       261 ~~f~D~d~vL~Fvns~e~~~La~  283 (709)
T TIGR02632       261 GTFDDSDAVLEFVNSKEAPRLAA  283 (709)
T ss_pred             EEECCCHHHHHHHHHHCCCCHHH
T ss_conf             53237478888762021310565


No 262
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342   The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants . It is a seven-step pathway which converts phosphoenolpyruvate and erythrose 4-phosphate to chorismate, the common precursor for the synthesis of folic acid, ubiquinone, vitamins E and K, and aromatic amino acids. Since this pathway is absent in metazoans, which must therefore obtain the essential amino acids phenylalanine and tryptophan from their diet, the enzymes in this pathway are important targets for the development of novel herbicides and antimicrobial compounds.   This entry represents shikimate 5-dehydrogenases from prokaryotes and functionally equivalent C-terminal domains from larger, multifunctional proteins, the majority of which have an N-terminal quinate dehydrogenase domain. These multifunctional proteins occur in plants, chlamydiae, planctomycetes and a limited number of marine proteobacteria. Shikimate 5-dehydrogenase catalyses the fourth step of the shikimate pathway, which is the NADP-dependent reduction of 3-dehydroshikimate to shikimate .   Structural studies suggests that some shikimate dehydrogenases are monmers while others form homodimers , . Each shikimate dehydrogenase monomer forms a compact two-domain alpha/beta sandwich with a deep interdomain cleft. The N-terminal substrate-binding domain forms a three layer alpha-beta-alpha sandwich, while the C-terminal NADP-binding domain forms a nearly typical Rossman fold. The active site is thought to be located within the interdomain cleft, with substrate binding causing a conformational change which closes the active site cleft, forming a productive active site.; GO: 0004764 shikimate 5-dehydrogenase activity, 0050661 NADP binding.
Probab=69.48  E-value=8.6  Score=18.47  Aligned_cols=18  Identities=0%  Similarity=-0.119  Sum_probs=7.3

Q ss_pred             CCCC--HHHHHHHHHHHCCC
Q ss_conf             8789--89999999871897
Q gi|254780206|r   47 DIQN--HSAIIHFCQEKHID   64 (424)
Q Consensus        47 ~~~d--~~~i~~~a~~~~iD   64 (424)
                      .+.+  ++..+.-++...+.
T Consensus        38 ~~~~Pll~~~~~~~~~~G~~   57 (286)
T TIGR00507        38 PPDDPLLEDAVSGFRALGFK   57 (286)
T ss_pred             CCCCCHHHHHHHHHHHCCCC
T ss_conf             82360179999999838984


No 263
>PRK12549 shikimate 5-dehydrogenase; Reviewed
Probab=69.42  E-value=8.7  Score=18.46  Aligned_cols=18  Identities=0%  Similarity=0.104  Sum_probs=8.9

Q ss_pred             CCCCHHHHHHHHHHHCCC
Q ss_conf             878989999999871897
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHID   64 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iD   64 (424)
                      ...+.+..++..+..++.
T Consensus        48 ~~~~l~~~~~~~~~~~~~   65 (284)
T PRK12549         48 SADALPELLDAAERMGFN   65 (284)
T ss_pred             CHHHHHHHHHHHHHCCCC
T ss_conf             978999999998768998


No 264
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]
Probab=68.89  E-value=8.9  Score=18.38  Aligned_cols=61  Identities=20%  Similarity=0.292  Sum_probs=37.2

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCC-----------HHHHHCCEEEEC-CCCCHHHHHHHHHHHCCCEEE
Q ss_conf             8998865-8899999999858996789995498-----------357511705512-878989999999871897999
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGN-----------PGIAQHAQCVAI-DIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN-----------~g~~~~~~~~~i-~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |||-|++ |---|||+++.+-..  +|+++--|           |++..  ...++ |.....++++|.+++-+.+-+
T Consensus         8 iLITGG~sGIGl~lak~f~elgN--~VIi~gR~e~~L~e~~~~~p~~~t--~v~Dv~d~~~~~~lvewLkk~~P~lNv   81 (245)
T COG3967           8 ILITGGASGIGLALAKRFLELGN--TVIICGRNEERLAEAKAENPEIHT--EVCDVADRDSRRELVEWLKKEYPNLNV   81 (245)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCC--EEEEECCCHHHHHHHHHCCCCHHE--EEECCCCHHHHHHHHHHHHHHCCCHHE
T ss_conf             99937964365999999998389--799965749999999860941315--651320356699999999862986113


No 265
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homol
Probab=68.80  E-value=8.9  Score=18.37  Aligned_cols=111  Identities=15%  Similarity=0.169  Sum_probs=61.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHCCEEEEC-------CCCCHHHHHHHHHHHCCCEEEEC-CCH
Q ss_conf             5899886588999999998589967899954-98357511705512-------87898999999987189799997-955
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP-GNPGIAQHAQCVAI-------DIQNHSAIIHFCQEKHIDLVVVG-PEL   72 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~~~~~~i-------~~~d~~~i~~~a~~~~iDlvivg-pE~   72 (424)
                      ||||+|-||=-..++.-|..+. +.++.++. +.-....+...+.+       -....+...+..++.+++.-+.- .+.
T Consensus        21 ~VlVvG~GGLG~~v~~~La~aG-Vg~i~ivD~D~Ve~sNL~RQ~l~~~~~~diG~~Ka~~a~~~l~~lNp~v~i~~~~~~   99 (198)
T cd01485          21 KVLIIGAGALGAEIAKNLVLAG-IDSITIVDHRLVSTEDLGSNFFLDAEVSNSGMNRAAASYEFLQELNPNVKLSIVEED   99 (198)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCCCCEEECCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             8999877889999999999749-986999959963533577575026541116872999999999977999779998224


Q ss_pred             H--HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             7--874899898605880670106665552010235788876531011
Q gi|254780206|r   73 P--LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA  118 (424)
Q Consensus        73 p--L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~  118 (424)
                      .  ...-..+.++...+-+-+..-..+     +...-+++.++++|--
T Consensus       100 ~~~~~~n~~~~~~~~DlVvd~~dn~~~-----r~~in~~c~~~~iPlI  142 (198)
T cd01485         100 SLSNDSNIEEYLQKFTLVIATEENYER-----TAKVNDVCRKHHIPFI  142 (198)
T ss_pred             CCCCHHHHHHHHHCCCEEEECCCCHHH-----HHHHHHHHHHHCCCEE
T ss_conf             457786899998489999999999999-----9999999999299889


No 266
>PRK13606 LPPG:FO 2-phospho-L-lactate transferase; Provisional
Probab=68.36  E-value=9.1  Score=18.31  Aligned_cols=21  Identities=14%  Similarity=0.270  Sum_probs=15.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHH
Q ss_conf             958998865889999999985
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQ   21 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~   21 (424)
                      |||.+||+|----.|+..|++
T Consensus         1 mkIv~lgGGtG~~~llrGLk~   21 (309)
T PRK13606          1 MMITVLSGGTGTPKLLRGLKE   21 (309)
T ss_pred             CEEEEECCCCCHHHHHHHHHH
T ss_conf             969998687578999999885


No 267
>KOG0256 consensus
Probab=68.17  E-value=8.6  Score=18.48  Aligned_cols=14  Identities=7%  Similarity=0.119  Sum_probs=5.9

Q ss_pred             CHHHHHHHHHHHHH
Q ss_conf             98999999999985
Q gi|254780206|r  383 TITESRELAYHMVE  396 (424)
Q Consensus       383 ~l~eA~~~ay~~i~  396 (424)
                      +++-|-++.+.-++
T Consensus       447 t~~~am~Ri~~~~~  460 (471)
T KOG0256         447 TLEVAMRRLKQFLD  460 (471)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             89999999999987


No 268
>PRK05884 short chain dehydrogenase; Provisional
Probab=68.00  E-value=9.2  Score=18.26  Aligned_cols=57  Identities=11%  Similarity=0.105  Sum_probs=33.4

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH-H----H-CCEEEECCCCCHHHHHHHHH
Q ss_conf             958998865-8899999999858996789995498357-5----1-17055128789899999998
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI-A----Q-HAQCVAIDIQNHSAIIHFCQ   59 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~-~----~-~~~~~~i~~~d~~~i~~~a~   59 (424)
                      |||||-|++ |--.|++.+|.+...  +|.+..-|... .    + ..+.+..|..|.+.+.+...
T Consensus         1 ~~VlVTGgs~GIG~aiA~~la~~Ga--~V~i~~r~~~~l~~~~~el~~~~~~~d~~d~~~~~~~~~   64 (223)
T PRK05884          1 MEVLVTGGDTDLGRTIAEGFRNDGH--KVTLVGARRDDLEVAAKELDVDAIVCDNTDPASLEEARG   64 (223)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHH
T ss_conf             9399987887999999999998799--999995987899999853487689985278899999999


No 269
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=67.72  E-value=9.3  Score=18.22  Aligned_cols=90  Identities=21%  Similarity=0.243  Sum_probs=48.5

Q ss_pred             EEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH------HHC-CEEEECCC---CCHHHHHHHHHHHCCCEEEECCCHH
Q ss_conf             9988658899999999858996789995498357------511-70551287---8989999999871897999979557
Q gi|254780206|r    4 LLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI------AQH-AQCVAIDI---QNHSAIIHFCQEKHIDLVVVGPELP   73 (424)
Q Consensus         4 LviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~------~~~-~~~~~i~~---~d~~~i~~~a~~~~iDlvivgpE~p   73 (424)
                      .|+|-|.---+.+.-|.+...  +|++...++..      ..+ .+.+.+..   .+......+  -.++|+||+.|-.|
T Consensus         4 ~V~GlG~sG~s~a~~L~~~G~--~v~~~D~~~~~~~~~~~~~L~~~gi~~~~g~~~~~~~~~~~--~~~~d~vV~SPGI~   79 (459)
T PRK02705          4 HVIGLGRSGIAAARLLKAQGW--EVVVSERNDSPELLERQQELEQEGITVELGKPLELESFQPW--LDQPDLVVVSPGIP   79 (459)
T ss_pred             EEEEECHHHHHHHHHHHHCCC--EEEEEECCCCCCHHHHHHHHHHCCCEEEECCCCCCCCHHHH--CCCCCEEEECCCCC
T ss_conf             999548999999999997899--59999898992347899999875986981676664301331--16788899899649


Q ss_pred             HHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             874899898605880670106665
Q gi|254780206|r   74 LVNGISDALNAAGFKVFGPSQRAA   97 (424)
Q Consensus        74 L~~gi~d~l~~~gi~v~Gp~~~aa   97 (424)
                      ...-....+++.|+|+++--.-+.
T Consensus        80 ~~~p~~~~a~~~gi~i~~eiel~~  103 (459)
T PRK02705         80 WDHPTLVELREKGIEVIGEMELAW  103 (459)
T ss_pred             CCCHHHHHHHHCCCCEECHHHHHH
T ss_conf             989999999987997214999999


No 270
>PRK00536 speE spermidine synthase; Provisional
Probab=67.66  E-value=9.4  Score=18.21  Aligned_cols=30  Identities=23%  Similarity=0.432  Sum_probs=14.0

Q ss_pred             HCCCEEEECCCHHH--HHHHHHHHHHCCCCEE
Q ss_conf             18979999795578--7489989860588067
Q gi|254780206|r   61 KHIDLVVVGPELPL--VNGISDALNAAGFKVF   90 (424)
Q Consensus        61 ~~iDlvivgpE~pL--~~gi~d~l~~~gi~v~   90 (424)
                      ++-|.+|+.+..|.  .+++..+|...||-|.
T Consensus       138 ~~fDvIIvDsl~~~~~~~~l~~~L~~~Gi~v~  169 (262)
T PRK00536        138 KKYDLIICLQEPDIHKIDGLKRMLKEDGVFIS  169 (262)
T ss_pred             CCCCEEEECCCCCCCHHHHHHHHHCCCCEEEE
T ss_conf             76688998899980549999998589989998


No 271
>cd01966 Nitrogenase_NifN_1 Nitrogenase_nifN1: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE.  NifN and nifE are structurally homologous to nitrogenase MoFe protein beta and alpha subunits respectively.  NifEN participates in the synthesis of the iron-molybdenum cofactor (FeMoco) of the MoFe protein.  NifB-co (an iron and sulfur containing precursor of the FeMoco) from NifB is transferred to the NifEN complex where it is further processed to FeMoco. The nifEN bound precursor of FeMoco has been identified as a molybdenum-free, iron- and sulfur- containing analog of FeMoco. It has been suggested that this nifEN bound precursor also acts as a cofactor precursor in nitrogenase systems which require a cofactor other than FeMoco: i.e. iron-vanadium cofactor (FeVco) or iron only cofactor (FeFeco).
Probab=67.57  E-value=9.4  Score=18.20  Aligned_cols=96  Identities=10%  Similarity=0.071  Sum_probs=59.7

Q ss_pred             HHHHHHHHHHHCCCEEEEC----CCHH--HHHHHHHHHHHC-----CCCEE---ECCHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             8999999987189799997----9557--874899898605-----88067---01066655520102357888765310
Q gi|254780206|r   51 HSAIIHFCQEKHIDLVVVG----PELP--LVNGISDALNAA-----GFKVF---GPSQRAAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        51 ~~~i~~~a~~~~iDlvivg----pE~p--L~~gi~d~l~~~-----gi~v~---Gp~~~aa~le~sK~~~K~~l~~~gIP  116 (424)
                      .++|.+..+..+++++++-    +|.-  =+.+++..+++.     |+|++   .|+-..+...+-+...+.+++..--|
T Consensus        70 ~~~I~~~~~~y~P~~I~V~tTC~se~IGDDi~~vv~~~~~~~~~~~~~pvi~v~tpgF~Gs~~~Gy~~a~~aii~~~~~~  149 (417)
T cd01966          70 EEALDTLAERAKPKVIGLLSTGLTETRGEDIAGALKQFRAEHPELADVPVVYVSTPDFEGSLEDGWAAAVEAIIEALVEP  149 (417)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCHHHHCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999852987799965531433077789999999974465579846851687645637889999999999874368


Q ss_pred             C--------------CCCCCCCCCHHHHHHHHCCCCEEEEEECC
Q ss_conf             1--------------11122344011111210124202563046
Q gi|254780206|r  117 T--------------ATYQHFSDPMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus       117 t--------------~~~~~~~~~~ea~~~~~~~g~PvVVKp~~  146 (424)
                      .              ..+..-.|.++++..++.+|.++++=||-
T Consensus       150 ~~~~~~~~~~iNli~g~~~~pgDl~eik~ll~~~Gl~~~ilpD~  193 (417)
T cd01966         150 GSRTVTDPRQVNLLPGAHLTPGDVEELKDIIEAFGLEPIILPDL  193 (417)
T ss_pred             CCCCCCCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCC
T ss_conf             78777778835881564688777999999999829956982365


No 272
>TIGR00137 gid gid protein; InterPro: IPR004417 The gid proteins are present in relatively few bacteria but very tightly conserved where they occur. The function of these proteins is unknown. They are closely related to gidA (glucose-inhibited division protein A), which appears to be present in all complete eubacterial genomes so far and in Saccharomyces cerevisiae..
Probab=67.38  E-value=7.5  Score=18.91  Aligned_cols=27  Identities=37%  Similarity=0.804  Sum_probs=21.4

Q ss_pred             EEEEECCC--HHHHHHHHHHHHCCCCCEEEE
Q ss_conf             58998865--889999999985899678999
Q gi|254780206|r    2 RVLLIGSG--GREHALAWKIAQSPLLSELWS   30 (424)
Q Consensus         2 kILviGsG--grEhAl~~~l~~s~~~~~v~~   30 (424)
                      +|-|||+|  |-|-  ||.|.+...-..+|=
T Consensus         2 ~v~VIGgGLAGsEA--AWqlA~~G~~ViLyE   30 (444)
T TIGR00137         2 KVIVIGGGLAGSEA--AWQLAKEGVRVILYE   30 (444)
T ss_pred             EEEEECCCCHHHHH--HHHHHHCCCCEEEEE
T ss_conf             36897188534689--999984897279975


No 273
>PHA02117 glutathionylspermidine synthase domain-containing protein
Probab=67.27  E-value=4.2  Score=20.72  Aligned_cols=15  Identities=20%  Similarity=0.474  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             788876531011112
Q gi|254780206|r  107 KKFCTKYGIPTATYQ  121 (424)
Q Consensus       107 K~~l~~~gIPt~~~~  121 (424)
                      +++|.+.+||..-+.
T Consensus        79 ~~l~~~l~IP~~~~~   93 (395)
T PHA02117         79 RRVWDMFNIPENARQ   93 (395)
T ss_pred             HHHHHHCCCCHHHHH
T ss_conf             345654399899999


No 274
>cd01421 IMPCH Inosine monophosphate cyclohydrolase domain. This is the N-terminal domain in the purine biosynthesis pathway protein ATIC (purH). The bifunctional ATIC protein contains a C-terminal  ATIC formylase domain that formylates 5-aminoimidazole-4-carboxamide-ribonucleotide. The IMPCH domain then converts the formyl-5-aminoimidazole-4-carboxamide-ribonucleotide to inosine monophosphate. This is the final step in de novo purine production.
Probab=67.03  E-value=9.6  Score=18.13  Aligned_cols=113  Identities=17%  Similarity=0.278  Sum_probs=50.3

Q ss_pred             CCCCCHHHHHHHHH---HHCCCEEEECCCHHHHHHHHHHHHHCCCCEE-------------------ECCHHHHHHHH--
Q ss_conf             28789899999998---7189799997955787489989860588067-------------------01066655520--
Q gi|254780206|r   46 IDIQNHSAIIHFCQ---EKHIDLVVVGPELPLVNGISDALNAAGFKVF-------------------GPSQRAAKLES--  101 (424)
Q Consensus        46 i~~~d~~~i~~~a~---~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~-------------------Gp~~~aa~le~--  101 (424)
                      |+..|...+..+|+   ++++.++=.       -|-++.|++.|++|.                   -|.-.+.-|..  
T Consensus         5 ISVsdKt~l~~la~~L~~~g~~IisT-------gGT~~~L~~~gi~v~~Vs~~TgfpEil~GRVKTLHPkI~gGIL~~r~   77 (187)
T cd01421           5 ISVSDKTGLVEFAKELVELGVEILST-------GGTAKFLKEAGIPVTDVSDITGFPEILGGRVKTLHPKIHGGILARRD   77 (187)
T ss_pred             EEEECCCCHHHHHHHHHHCCCEEEEC-------HHHHHHHHHCCCCEEEHHHHCCCHHHHCCCCCCCCCHHHHHHCCCCC
T ss_conf             98645327799999999889889978-------08999998668860669873197377589765357055440215666


Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCC-------------CCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             10235788876531011112234-------------40111112101242025630465343000232356778887887
Q gi|254780206|r  102 SKSFAKKFCTKYGIPTATYQHFS-------------DPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR  168 (424)
Q Consensus       102 sK~~~K~~l~~~gIPt~~~~~~~-------------~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~  168 (424)
                      ++.- ++ |+++|||.-..-++.             +.+++.+.+ .+|-|..|++.- ---+-|.++.+.++....++.
T Consensus        78 ~~~h-~~-~~~~~i~~IDlVvvNLYPF~~~v~~~~~~~~~~IEnI-DIGGpsliRAAA-KN~~~V~v~~dp~dY~~~i~~  153 (187)
T cd01421          78 NEEH-KD-LEEHGIEPIDLVVVNLYPFEETVAKGNVTLEEAIENI-DIGGPSLLRAAA-KNYKDVTVLVDPADYQKVLEE  153 (187)
T ss_pred             CHHH-HH-HHHCCCCCCCEEEEECCCHHHHHCCCCCCHHHHHHHC-CCCCHHHHHHHH-HCCCCEEEECCHHHHHHHHHH
T ss_conf             6358-99-9986999702799846577777555899989999844-677489999998-268812876799999999999


Q ss_pred             H
Q ss_conf             5
Q gi|254780206|r  169 C  169 (424)
Q Consensus       169 ~  169 (424)
                      .
T Consensus       154 l  154 (187)
T cd01421         154 L  154 (187)
T ss_pred             H
T ss_conf             9


No 275
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=66.94  E-value=9.7  Score=18.11  Aligned_cols=63  Identities=21%  Similarity=0.234  Sum_probs=32.7

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEECCCHHHHHCCEEE---ECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             958998865889-99999998589967899954983575117055---12878989999999871897999
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSIPGNPGIAQHAQCV---AIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~---~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |||-|||.-|+- +.|....++-.+  +|-+.--||.-...-+.+   .-|+-|.+.+.+..  ...|.||
T Consensus         1 mKIaiIgAsG~~Gs~i~~EA~~RGH--eVTAivRn~~K~~~~~~~~i~q~Difd~~~~a~~l--~g~DaVI   67 (211)
T COG2910           1 MKIAIIGASGKAGSRILKEALKRGH--EVTAIVRNASKLAARQGVTILQKDIFDLTSLASDL--AGHDAVI   67 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCC--EEEEEEECHHHCCCCCCCEEECCCCCCHHHHHHHH--CCCCEEE
T ss_conf             9078995374567999999986798--04899807676652235302000222745667663--5876699


No 276
>cd01424 MGS_CPS_II Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP). CSP, a CarA and CarB heterodimer, catalyzes the production of carbamoyl phosphate which is subsequently employed in the metabolic pathways responsible for the synthesis of pyrimidine nucleotides or arginine. The MGS-like domain is the C-terminal domain of CarB and appears to play a regulatory role in CPS function by binding allosteric effector molecules, including UMP and ornithine.
Probab=66.86  E-value=9.7  Score=18.10  Aligned_cols=54  Identities=20%  Similarity=0.238  Sum_probs=25.9

Q ss_pred             HHHHHHHCCCCCEEEEECCCHHHHH--CCEE--EECCCCCHHHHHHHHHHHCCCEEEECC
Q ss_conf             9999985899678999549835751--1705--512878989999999871897999979
Q gi|254780206|r   15 LAWKIAQSPLLSELWSIPGNPGIAQ--HAQC--VAIDIQNHSAIIHFCQEKHIDLVVVGP   70 (424)
Q Consensus        15 l~~~l~~s~~~~~v~~~pgN~g~~~--~~~~--~~i~~~d~~~i~~~a~~~~iDlvivgp   70 (424)
                      ++++|.+-  -.++|..+|-.-+..  ...+  +.-.....+.++++.++.+||+||--|
T Consensus        18 ~ak~l~~l--Gf~i~AT~GTa~~L~~~Gi~~~~v~k~~e~~p~i~d~i~~~~i~lVINt~   75 (110)
T cd01424          18 IAKRLAEL--GFKLVATEGTAKYLQEAGIPVEVVNKVSEGRPNIVDLIKNGEIQLVINTP   75 (110)
T ss_pred             HHHHHHHC--CCEEEECCHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHCCCEEEEEECC
T ss_conf             99999988--99999871699999864986403300567997689999779358999778


No 277
>PRK06182 short chain dehydrogenase; Validated
Probab=66.81  E-value=9.7  Score=18.10  Aligned_cols=78  Identities=19%  Similarity=0.338  Sum_probs=46.3

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH-H----HCCEEEECCCCCHHHHHHHHHHH-----CCCEEEECCC
Q ss_conf             8998865-8899999999858996789995498357-5----11705512878989999999871-----8979999795
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI-A----QHAQCVAIDIQNHSAIIHFCQEK-----HIDLVVVGPE   71 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~-~----~~~~~~~i~~~d~~~i~~~a~~~-----~iDlvivgpE   71 (424)
                      +||-|++ |--.|++..|.+...  +|+..--|... .    ...+.+..|.+|.+++.+++.+.     +||..|    
T Consensus         6 ~lITGassGIG~a~a~~la~~G~--~V~~~~r~~~~l~~l~~~~~~~~~~Dvt~~~~v~~~~~~i~~~~g~iDiLV----   79 (273)
T PRK06182          6 ALVTGASSGIGKATARKLIAEGF--TVYGAARRVDKMEDLASLGIHPLALDVTDEASMKAAVATILAEEGRIDVLV----   79 (273)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE----
T ss_conf             99906320999999999998799--899997989999999967997999858999999999999999839988775----


Q ss_pred             HHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             57874899898605880670106665
Q gi|254780206|r   72 LPLVNGISDALNAAGFKVFGPSQRAA   97 (424)
Q Consensus        72 ~pL~~gi~d~l~~~gi~v~Gp~~~aa   97 (424)
                                 ..+|+..+||-.+..
T Consensus        80 -----------NNAG~~~~~~~~~~~   94 (273)
T PRK06182         80 -----------NNAGYGSYGAIEDVP   94 (273)
T ss_pred             -----------ECCCCCCCCCHHHHH
T ss_conf             -----------058677787488731


No 278
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating); InterPro: IPR013357   Aldehyde dehydrogenases (1.2.1.3 from EC and 1.2.1.5 from EC) are enzymes which oxidize a wide variety of aliphatic and aromatic aldehydes using NAD(P) as a cofactor. In eukaryotes, at least twenty distinct aldehyde dehydrogenase families have been classified . Many aldehyde dehydrogenases have also been found in prokaryotic species. A glutamic acid and a cysteine residue have been implicated in the catalytic activity of mammalian aldehyde dehydrogenase, though these residues are not necessarily conserved in all the enzymes of this family.   The acetaldehyde dehydrogenase family (1.2.1.10 from EC) of bacterial enzymes catalyse the formation of acetyl-CoA from acetaldehyde in the degradation of phenols, cresols and catechol . Proteins in this entry occur in bacterial species and are annotated as probable acetaldehyde dehydrogenases, though this function has not been experimentally verified..
Probab=65.74  E-value=10  Score=17.96  Aligned_cols=35  Identities=17%  Similarity=0.320  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHCCC-EEEECCCHHH------HHHHHHHHHHCC
Q ss_conf             9999999871897-9999795578------748998986058
Q gi|254780206|r   52 SAIIHFCQEKHID-LVVVGPELPL------VNGISDALNAAG   86 (424)
Q Consensus        52 ~~i~~~a~~~~iD-lvivgpE~pL------~~gi~d~l~~~g   86 (424)
                      .+|.++......| .+|+.+|...      -+.|+++|++.|
T Consensus       230 ~Av~~Il~SKtFDnGtICASEQSvivE~~n~~aVv~Elk~QG  271 (528)
T TIGR02518       230 KAVRKILDSKTFDNGTICASEQSVIVEKCNKDAVVEELKKQG  271 (528)
T ss_pred             HHHHHHHCCCCCCCCEEEEECCCEEEECCCHHHHHHHHHHCC
T ss_conf             999887402566776165313506861577268999998524


No 279
>TIGR01284 alt_nitrog_alph nitrogenase alpha chain; InterPro: IPR005974    The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges. All known Mo-nitrogenases consist of two components, component I (also called dinitrogenase, or Fe-Mo protein), an alpha2beta2 tetramer encoded by the nifD and nifK genes, and component II (dinitrogenase reductase, or Fe protein) a homodimer encoded by the nifH gene. Two operons, nifDK and nifEN, encode a tetrameric (alpha2beta2 and N2E2) enzymatic complex. Nitrogenase contains two unusual rare metal clusters; one of them is the iron molybdenum cofactor (FeMo-co), which is considered to be the site of dinitrogen reduction and whose biosynthesis requires the products of nifNE and of some other nif genes. It has been proposed that NifNE might serve as a scaffold upon which FeMo-co is built and then inserted into component I.    This model represents the alpha chains of various forms of the nitrogen-fixing enzyme nitrogenase: vanadium-iron, iron-iron, and molybdenum-iron. Most examples of NifD, the molybdenum-iron type nitrogenase alpha chain, are excluded from this model and described instead by equivalog model IPR005972 from INTERPRO.; GO: 0016163 nitrogenase activity, 0051536 iron-sulfur cluster binding, 0009399 nitrogen fixation.
Probab=65.72  E-value=9.8  Score=18.08  Aligned_cols=125  Identities=15%  Similarity=0.259  Sum_probs=50.0

Q ss_pred             HHHHHHHCCCCEEECCHHHHHHHHCCHHH-HHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCH
Q ss_conf             99898605880670106665552010235-78887653101111223440111112101242025630465343000232
Q gi|254780206|r   78 ISDALNAAGFKVFGPSQRAAKLESSKSFA-KKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVA  156 (424)
Q Consensus        78 i~d~l~~~gi~v~Gp~~~aa~le~sK~~~-K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~  156 (424)
                      |.++|+..||.|+.      ...+|=++= =+.|.++.+..-+...-+++- |.+.-++.|-| =+|=|+    =|..- 
T Consensus       228 l~~Yf~rmGI~Vls------tFTGng~yD~lr~MHrA~Lnvv~CaRSa~YI-a~eL~~RYGiP-rldiD~----fGf~y-  294 (468)
T TIGR01284       228 LKKYFERMGIQVLS------TFTGNGSYDELRAMHRAKLNVVECARSAEYI-ANELKERYGIP-RLDIDS----FGFEY-  294 (468)
T ss_pred             HHHHHHHCCCEEEE------EECCCCCHHHHHHHHHHHHHHHHHCCHHHHH-HHHHHHHCCCC-CEEECC----CCHHH-
T ss_conf             99999863945887------6358887056677766403043211105799-99865306886-121133----46077-


Q ss_pred             HHHHHHHHHHHHHHC--CCCHHHHHHHHHH-CCCCCEEEE-CCCCCCCCCCCC---CCCCCCCCCCCC
Q ss_conf             356778887887514--4531777887752-057523442-157763103520---001113566544
Q gi|254780206|r  157 ATVDEATSAIDRCFQ--QINSTVIIEEYLE-GFEVSFFAL-CDGKTAIPFTTA---RDHKRIHDGDIG  217 (424)
Q Consensus       157 ~~~~e~~~~~~~~~~--~~~~~VliEefl~-G~E~Sv~~i-~dG~~~~~l~~~---~dyKr~~~~d~G  217 (424)
                        ..+-..++-.-|+  +..++||=||+-. +||+...== ..||.+.+++-=   .-.-|.-|.|+|
T Consensus       295 --~a~~lrkIg~fFGIeerae~~I~ee~ak~kPeldwyKerL~GKkv~~w~GGpklWHw~~~~EdelG  360 (468)
T TIGR01284       295 --LAENLRKIGEFFGIEERAERVIEEEVAKWKPELDWYKERLRGKKVAVWSGGPKLWHWARSVEDELG  360 (468)
T ss_pred             --HHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHCC
T ss_conf             --887788762027970378898997777508851014654178779994686812236733132468


No 280
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed
Probab=65.37  E-value=10  Score=17.91  Aligned_cols=16  Identities=19%  Similarity=0.331  Sum_probs=7.4

Q ss_pred             HHHHHHHCCCCEEEEE
Q ss_conf             1111210124202563
Q gi|254780206|r  128 KAKQYVQNKSMPIVVK  143 (424)
Q Consensus       128 ea~~~~~~~g~PvVVK  143 (424)
                      +..+++++.+.|++|=
T Consensus        80 eF~~~~~~~~ip~~Iv   95 (219)
T PRK09552         80 EFVQFVNENNISFYVI   95 (219)
T ss_pred             HHHHHHHHCCCCEEEE
T ss_conf             9999999859979998


No 281
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
Probab=65.24  E-value=10  Score=17.89  Aligned_cols=137  Identities=18%  Similarity=0.266  Sum_probs=65.1

Q ss_pred             CEEEEECCCHH--HHHHHHHHHHCCC--CCEEEEECCCHHH----HH--------CC-EEEECCCCCHHHHHHHHHHHCC
Q ss_conf             95899886588--9999999985899--6789995498357----51--------17-0551287898999999987189
Q gi|254780206|r    1 MRVLLIGSGGR--EHALAWKIAQSPL--LSELWSIPGNPGI----AQ--------HA-QCVAIDIQNHSAIIHFCQEKHI   63 (424)
Q Consensus         1 MkILviGsGgr--EhAl~~~l~~s~~--~~~v~~~pgN~g~----~~--------~~-~~~~i~~~d~~~i~~~a~~~~i   63 (424)
                      |||-+||+|+-  .--|.+.|.+++.  ..++.+..=++.-    ..        .. .......+|.++.+     ...
T Consensus         1 ~KI~iIGgGS~~ftp~li~~l~~~~~l~~~ei~L~Did~erl~~v~~l~~~~~~~~~~~~~v~~Ttd~~eAl-----~gA   75 (423)
T cd05297           1 IKIAFIGAGSVVFTKNLVGDLLKTPELSGSTIALMDIDEERLETVEILAKKIVEELGAPLKIEATTDRREAL-----DGA   75 (423)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCEEEEEECCHHHHH-----CCC
T ss_conf             979999986487599999999608457899899988999999999999999998519981899968999984-----689


Q ss_pred             CEEEE----CCCHHHHHHHHHH--HHHCCC-----CEEECCHHHHHHHHC---CHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             79999----7955787489989--860588-----067010666555201---023578887653101111223440111
Q gi|254780206|r   64 DLVVV----GPELPLVNGISDA--LNAAGF-----KVFGPSQRAAKLESS---KSFAKKFCTKYGIPTATYQHFSDPMKA  129 (424)
Q Consensus        64 Dlviv----gpE~pL~~gi~d~--l~~~gi-----~v~Gp~~~aa~le~s---K~~~K~~l~~~gIPt~~~~~~~~~~ea  129 (424)
                      |+|+.    |.-..-.   .|.  =.+.|+     -+.||.--+--|-+=   -..+|+ ++++- |-+..-.|+|....
T Consensus        76 DfV~~~irvGg~~~r~---~De~Iplk~Gv~~~vGET~G~GG~~~alRtIPv~leia~~-i~e~~-P~AwiiNytNP~~i  150 (423)
T cd05297          76 DFVINTIQVGGHEYTE---TDFEIPEKYGYYQTVGDTSGPGGIFRALRTIPVLLDIARD-IEELC-PDAWLLNYANPMAE  150 (423)
T ss_pred             CEEEEEEEECCCHHHH---HHHHHHHHCCCCEEECCCCCHHHHHHHHCCHHHHHHHHHH-HHHHC-CCCEEEECCCHHHH
T ss_conf             9999987746824889---8884898839660445654775899986228999999999-99879-98389976788899


Q ss_pred             H-HHHHCCCCEEEEEECCCCCC
Q ss_conf             1-12101242025630465343
Q gi|254780206|r  130 K-QYVQNKSMPIVVKADGLCAG  150 (424)
Q Consensus       130 ~-~~~~~~g~PvVVKp~~~agG  150 (424)
                      . +++.+ -+|  +|-.|+|-+
T Consensus       151 vteal~r-~~~--~k~iGlC~~  169 (423)
T cd05297         151 LTWALNR-YTP--IKTVGLCHG  169 (423)
T ss_pred             HHHHHHH-HCC--CCEEEECCC
T ss_conf             9999997-389--978987977


No 282
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane]
Probab=65.23  E-value=10  Score=17.89  Aligned_cols=120  Identities=17%  Similarity=0.168  Sum_probs=72.1

Q ss_pred             HHHHHHH-CCCCCEEEEECCCHHHH----H---CCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             9999985-89967899954983575----1---17055128789899999998718979999795578748998986058
Q gi|254780206|r   15 LAWKIAQ-SPLLSELWSIPGNPGIA----Q---HAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAG   86 (424)
Q Consensus        15 l~~~l~~-s~~~~~v~~~pgN~g~~----~---~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~g   86 (424)
                      |..+|++ .|.+.-+...--+-|..    .   .+.+.+......-.+-+|....++|++|+ .|..||--+...+...|
T Consensus        68 Lv~~l~~~~P~~~ilvTt~T~Tg~e~a~~~~~~~v~h~YlP~D~~~~v~rFl~~~~P~l~Ii-~EtElWPnli~e~~~~~  146 (419)
T COG1519          68 LVRALRERFPDLRILVTTMTPTGAERAAALFGDSVIHQYLPLDLPIAVRRFLRKWRPKLLII-METELWPNLINELKRRG  146 (419)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEE-EECCCCHHHHHHHHHCC
T ss_conf             99999976899878999527637999998769870899657676688999997428987999-80013678999998769


Q ss_pred             CCEEECCHHHHHHHHCCHHHHH----HHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEE
Q ss_conf             8067010666555201023578----88765310111122344011111210124202
Q gi|254780206|r   87 FKVFGPSQRAAKLESSKSFAKK----FCTKYGIPTATYQHFSDPMKAKQYVQNKSMPI  140 (424)
Q Consensus        87 i~v~Gp~~~aa~le~sK~~~K~----~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~Pv  140 (424)
                      +|.+=-+.+   | ++|+|.+-    .+.+.=...-....+.|.+++..|. ++|.+-
T Consensus       147 ~p~~LvNaR---L-S~rS~~~y~k~~~~~~~~~~~i~li~aQse~D~~Rf~-~LGa~~  199 (419)
T COG1519         147 IPLVLVNAR---L-SDRSFARYAKLKFLARLLFKNIDLILAQSEEDAQRFR-SLGAKP  199 (419)
T ss_pred             CCEEEEEEE---E-CHHHHHHHHHHHHHHHHHHHHCCEEEECCHHHHHHHH-HCCCCC
T ss_conf             989999423---0-2325777987789999999742333454888899999-649861


No 283
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism]
Probab=64.79  E-value=11  Score=17.83  Aligned_cols=26  Identities=27%  Similarity=0.523  Sum_probs=21.5

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCC
Q ss_conf             958998865889-99999998589967
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLS   26 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~   26 (424)
                      |||.|.|..||- ..|++++.+++...
T Consensus         3 iki~V~Ga~GRMG~~ii~~v~~~~~~~   29 (266)
T COG0289           3 IKVAVAGASGRMGRTLIRAVLEAPDLE   29 (266)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCCCE
T ss_conf             369997578727899999985289946


No 284
>PRK09564 coenzyme A disulfide reductase; Reviewed
Probab=64.63  E-value=11  Score=17.81  Aligned_cols=30  Identities=23%  Similarity=0.337  Sum_probs=18.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHH-CCCCCEEEEE
Q ss_conf             958998865889999999985-8996789995
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQ-SPLLSELWSI   31 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~-s~~~~~v~~~   31 (424)
                      |||+|||+|---...|..+++ .+.. +|.+.
T Consensus         1 MkvVIIG~G~AG~saA~~l~~~~~~~-~I~v~   31 (443)
T PRK09564          1 MKIIIIGGTAAGTSAAAKAKRLNKEL-EIVVY   31 (443)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCC-CEEEE
T ss_conf             96999996099999999998149399-99999


No 285
>TIGR01469 cobA_cysG_Cterm uroporphyrin-III C-methyltransferase; InterPro: IPR006366   This domain is found in a family of sequences that represent enzymes, or enzyme domains, with uroporphyrin-III C-methyltransferase activity. This enzyme catalyzes the first step committed to the biosynthesis of either siroheme or cobalamin (vitamin B12) rather than protoheme (heme). Cobalamin contains cobalt while siroheme contains iron. Siroheme is a cofactor for nitrite and sulphite reductases and therefore plays a role in cysteine biosynthesis; many members of this family are CysG, siroheme synthase, with an additional N-terminal domain and with additional oxidation and iron insertion activities.; GO: 0008168 methyltransferase activity, 0006779 porphyrin biosynthetic process.
Probab=64.57  E-value=11  Score=17.81  Aligned_cols=42  Identities=14%  Similarity=0.278  Sum_probs=27.9

Q ss_pred             HHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCH
Q ss_conf             8887653101111223440111112101242025630465343000232
Q gi|254780206|r  108 KFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVA  156 (424)
Q Consensus       108 ~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~  156 (424)
                      ++|.++|||   |.++-=...|.+.+...|+|+--+-    -++++.++
T Consensus       100 ~~L~~~GI~---~EvvPGvTsA~Aa~a~aGiPlThR~----~~~s~~f~  141 (242)
T TIGR01469       100 EALAEAGIP---FEVVPGVTSAIAAAAYAGIPLTHRG----LARSVTFV  141 (242)
T ss_pred             HHHHHCCCC---EEEECCCCHHHHHHHHCCCCCCCCC----CCCCEEEE
T ss_conf             999966897---9873881167789985589954130----21731688


No 286
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional
Probab=64.51  E-value=11  Score=17.80  Aligned_cols=47  Identities=15%  Similarity=0.174  Sum_probs=18.1

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCH-HHHHHHH-CCCCEEEEEECCCCC
Q ss_conf             10235788876531011112234401-1111210-124202563046534
Q gi|254780206|r  102 SKSFAKKFCTKYGIPTATYQHFSDPM-KAKQYVQ-NKSMPIVVKADGLCA  149 (424)
Q Consensus       102 sK~~~K~~l~~~gIPt~~~~~~~~~~-ea~~~~~-~~g~PvVVKp~~~ag  149 (424)
                      +..+ ++.++++||.......-++.+ -+.+.++ .-||=+.|=-.|..|
T Consensus       127 ~~~~-~~~~~~~gi~~I~lvaPtt~~~Ri~~i~~~s~gfiY~vs~~GvTG  175 (256)
T PRK13111        127 AEEF-RAAAKKHGIDLIFLVAPTTTDERLKKIASHASGFVYYVSRAGVTG  175 (256)
T ss_pred             HHHH-HHHHHHCCCEEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             8999-999997598089996999988999999962698599985677678


No 287
>COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion]
Probab=64.50  E-value=9.7  Score=18.11  Aligned_cols=26  Identities=12%  Similarity=0.312  Sum_probs=15.7

Q ss_pred             EEEECCCHH----HHHHHHHHHHCCCCCEEE
Q ss_conf             899886588----999999998589967899
Q gi|254780206|r    3 VLLIGSGGR----EHALAWKIAQSPLLSELW   29 (424)
Q Consensus         3 ILviGsGgr----EhAl~~~l~~s~~~~~v~   29 (424)
                      |-|||.=.|    +|.+-+-|.+.. --++|
T Consensus        13 vavigas~~~~~vg~~i~~nL~~~g-~g~i~   42 (598)
T COG1042          13 IAVIGASERPGKLGYEILRNLLEYG-QGKIY   42 (598)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCC-CCCEE
T ss_conf             7887146875215799999998568-88557


No 288
>KOG0243 consensus
Probab=64.35  E-value=11  Score=17.78  Aligned_cols=81  Identities=31%  Similarity=0.487  Sum_probs=49.8

Q ss_pred             CCCCEEEEEECCCCCCCCCCCHHHHHH----HHHHHHHHHCCC-CH--------HHHHHHHHHCCCCCEEEEC---CCCC
Q ss_conf             124202563046534300023235677----888788751445-31--------7778877520575234421---5776
Q gi|254780206|r  135 NKSMPIVVKADGLCAGKGVVVAATVDE----ATSAIDRCFQQI-NS--------TVIIEEYLEGFEVSFFALC---DGKT  198 (424)
Q Consensus       135 ~~g~PvVVKp~~~agGkGV~i~~~~~e----~~~~~~~~~~~~-~~--------~VliEefl~G~E~Sv~~i~---dG~~  198 (424)
                      +..-|+||.-++.  +|-|.+-.+.+.    -.-.+++.|+-. .+        .=+|+|.|.|.-.++||..   -|++
T Consensus        66 ~~~s~~VVs~~~~--~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eVl~GyNCTIFAYGQTGTGKT  143 (1041)
T KOG0243          66 KSKSSVVVSCDGI--RKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEVLEGYNCTIFAYGQTGTGKT  143 (1041)
T ss_pred             HCCCCEEEECCCC--CCEEEEECCCCCCCCCCEEECCEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCE
T ss_conf             0379758961897--61688732666531110000112227526589999999889999986247725998647888852


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             31035200011135665444443
Q gi|254780206|r  199 AIPFTTARDHKRIHDGDIGPNTG  221 (424)
Q Consensus       199 ~~~l~~~~dyKr~~~~d~GpnTG  221 (424)
                      |..-+-.++++    ++.++-+|
T Consensus       144 yTMeG~~~~~~----g~l~~~aG  162 (1041)
T KOG0243         144 YTMEGGERKKN----GELPSEAG  162 (1041)
T ss_pred             EEEECCCCCCC----CCCCCCCC
T ss_conf             46236754345----88996578


No 289
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids 
Probab=63.59  E-value=11  Score=17.68  Aligned_cols=133  Identities=19%  Similarity=0.214  Sum_probs=65.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEE-EECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHH
Q ss_conf             5899886588999999998589967899-954983575117055128789899999998718979999795578748998
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELW-SIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISD   80 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~-~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d   80 (424)
                      +|.|-|.|---..+++.|.+...  +|. ++.-+.++      ++-+-.|.+++.++..+++--.-+++.+. +.   .+
T Consensus        33 ~v~IqG~GnVG~~~a~~L~~~Ga--kvv~vsD~~G~i------~~~~Gld~~~l~~~~~~~~~~~~~~~~~~-~~---~~  100 (227)
T cd01076          33 RVAIQGFGNVGSHAARFLHEAGA--KVVAVSDSDGTI------YNPDGLDVPALLAYKKEHGSVLGFPGAER-IT---NE  100 (227)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCCEE------ECCCCCCHHHHHHHHHHCCCCCCCCCCCC-CC---CC
T ss_conf             99998988999999999998799--599998478738------88888999999999996598026788753-89---62


Q ss_pred             HHHHCCCCEEECCHHHHHHH---HCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCH
Q ss_conf             98605880670106665552---01023578887653101111223440111112101242025630465343000232
Q gi|254780206|r   81 ALNAAGFKVFGPSQRAAKLE---SSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVA  156 (424)
Q Consensus        81 ~l~~~gi~v~Gp~~~aa~le---~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~  156 (424)
                      .+.....-+|-|.+..-.|.   -.+.-+|-+.+-+|-|+.        .+|.+.+.+-|  +++=||-++-.-||.+.
T Consensus       101 ~~~~~~~DI~iP~A~~~~I~~~~a~~l~ak~I~EgAN~p~t--------~~A~~~L~~rg--I~viPD~laNaGGVivS  169 (227)
T cd01076         101 ELLELDCDILIPAALENQITADNADRIKAKIIVEAANGPTT--------PEADEILHERG--VLVVPDILANAGGVTVS  169 (227)
T ss_pred             CHHCCCCCEEEECCCCCCCCHHHHHHCCCEEEEECCCCCCC--------HHHHHHHHHCC--CEEECCHHHCCCCEEEE
T ss_conf             31047887898777669779999854476199845789989--------88999999886--98968077448774455


No 290
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=63.25  E-value=11  Score=17.64  Aligned_cols=34  Identities=29%  Similarity=0.429  Sum_probs=27.2

Q ss_pred             CEEEEEC-CCHHHHHHHHHHHHCCCCCEEEEECCC
Q ss_conf             9589988-658899999999858996789995498
Q gi|254780206|r    1 MRVLLIG-SGGREHALAWKIAQSPLLSELWSIPGN   34 (424)
Q Consensus         1 MkILviG-sGgrEhAl~~~l~~s~~~~~v~~~pgN   34 (424)
                      |||-||| .|.---++|..|.+++..+++....=|
T Consensus         1 mKV~IIGA~G~VG~~~A~~l~~~~~~~elvLiDi~   35 (310)
T cd01337           1 VKVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIV   35 (310)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             98999999981899999999729997769998277


No 291
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity. The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carbox
Probab=63.22  E-value=11  Score=17.63  Aligned_cols=117  Identities=20%  Similarity=0.336  Sum_probs=60.4

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCCCEEEEECCCHHH------H-HCCEE-------EECC-CCCHHHHHHHHHHHCCC
Q ss_conf             95899886-58899999999858996789995498357------5-11705-------5128-78989999999871897
Q gi|254780206|r    1 MRVLLIGS-GGREHALAWKIAQSPLLSELWSIPGNPGI------A-QHAQC-------VAID-IQNHSAIIHFCQEKHID   64 (424)
Q Consensus         1 MkILviGs-GgrEhAl~~~l~~s~~~~~v~~~pgN~g~------~-~~~~~-------~~i~-~~d~~~i~~~a~~~~iD   64 (424)
                      |||.|||. |.--.+++..|...+...++....-|...      + .+...       ..+. ..|.+.      -...|
T Consensus         1 mKV~IiGAaG~VG~~~a~~l~~~~~~~el~LiD~~~~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~------~~daD   74 (309)
T cd05294           1 MKVSIIGASGRVGSATALLLAKEDVVKEINLISRPKSLEKLKGLRLDIYDALAAAGIDAEIKISSDLSD------VAGSD   74 (309)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEHHHHCCCCCCCCCCEEEECCCHHH------HCCCC
T ss_conf             989999999769999999998379987599960556434231123554503433688767982798899------68999


Q ss_pred             EEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHH---HHHHHHCCCCCCCCCCHHHHHHHH--CCCCE
Q ss_conf             9999795578748998986058806701066655520102357888---765310111122344011111210--12420
Q gi|254780206|r   65 LVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC---TKYGIPTATYQHFSDPMKAKQYVQ--NKSMP  139 (424)
Q Consensus        65 lvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l---~~~gIPt~~~~~~~~~~ea~~~~~--~~g~P  139 (424)
                      .||+.      +|..   ++.|     .+ +...+..+-..+|++.   .+++ |.+..-.++|.-+...++.  ..|||
T Consensus        75 ivVit------AG~~---rk~g-----~t-R~dLl~~Na~I~~~i~~~i~~~~-p~~ivivvtNPvDv~t~~~~k~sg~p  138 (309)
T cd05294          75 IVIIT------AGVP---RKEG-----MS-RLDLAKKNAKIVKKYAKQIAEFA-PDTKILVVTNPVDVMTYKALKESGFD  138 (309)
T ss_pred             EEEEC------CCCC---CCCC-----CC-HHHHHHHHHHHHHHHHHHHHCCC-CCEEEEECCCCHHHHHHHHHHHCCCC
T ss_conf             99987------8988---9959-----98-78999989999999998764269-98499976896577999999966988


No 292
>TIGR00284 TIGR00284 dihydropteroate synthase-related protein; InterPro: IPR005236    The proteins of this family have been found so far only in the four archaeal species. The central region of the proteins shows considerable homology to the amino-terminal half of dihydropteroate synthases. .
Probab=63.07  E-value=11  Score=17.62  Aligned_cols=94  Identities=18%  Similarity=0.228  Sum_probs=53.6

Q ss_pred             CEEEEECCCHHHHHHHHHHH-HCCCCCEEEEECCCHHHHHCCEEEEC-CCCCHHHHHHHHHHHCCCEEEE-CCCHHHHHH
Q ss_conf             95899886588999999998-58996789995498357511705512-8789899999998718979999-795578748
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIA-QSPLLSELWSIPGNPGIAQHAQCVAI-DIQNHSAIIHFCQEKHIDLVVV-GPELPLVNG   77 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~-~s~~~~~v~~~pgN~g~~~~~~~~~i-~~~d~~~i~~~a~~~~iDlviv-gpE~pL~~g   77 (424)
                      ||||||-|---+--+-..++ ++.+--+|.++|= +-.+.+..+..+ +....+..++-+++...|++++ |    |+-|
T Consensus         1 ~kvl~iTg~lA~~~~~~~~kn~~d~~~ev~vln~-~va~~lstk~Iak~lk~~~~~L~~~~kd~~D~~l~pG----lvrg   75 (529)
T TIGR00284         1 VKVLVITGKLAKRLVEDVVKNKKDQEVEVKVLNV-SVAALLSTKLIAKELKKLKDKLEKKLKDSVDYVLVPG----LVRG   75 (529)
T ss_pred             CEEEEEECHHHHHHHHHHHHCCCCCEEEEEECCC-CCHHHCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECC----CHHH
T ss_conf             9789983223457899996034798789998482-0020337779999998788876454314647688477----0010


Q ss_pred             HHHHH-HHCCCCEEECCHHHHHH
Q ss_conf             99898-60588067010666555
Q gi|254780206|r   78 ISDAL-NAAGFKVFGPSQRAAKL   99 (424)
Q Consensus        78 i~d~l-~~~gi~v~Gp~~~aa~l   99 (424)
                      =+... +..|++||=.|.++.-|
T Consensus        76 Dak~veevtG~~~fKgT~ea~di   98 (529)
T TIGR00284        76 DAKVVEEVTGVKVFKGTEEAVDI   98 (529)
T ss_pred             HHHHHHHCCCCCCCCCCCCHHHH
T ss_conf             02321002540222476772035


No 293
>PRK06753 hypothetical protein; Provisional
Probab=62.89  E-value=11  Score=17.59  Aligned_cols=25  Identities=20%  Similarity=0.236  Sum_probs=18.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCC
Q ss_conf             9589988658899999999858996
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLL   25 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~   25 (424)
                      |||+|||.|=---++|..|.+...-
T Consensus         1 mkV~IVGaGiaGL~~A~~L~~~G~~   25 (373)
T PRK06753          1 MKIAIIGAGIGGLTAAALLQEQGHT   25 (373)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCC
T ss_conf             9899999458999999999977999


No 294
>PRK02842 light-independent protochlorophyllide reductase subunit N; Provisional
Probab=62.77  E-value=7.1  Score=19.07  Aligned_cols=81  Identities=20%  Similarity=0.368  Sum_probs=32.6

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECC--CCCHHHHHHHHHH----HCCCEEE-EC--CCHH
Q ss_conf             899886588999999998589967899954983575117055128--7898999999987----1897999-97--9557
Q gi|254780206|r    3 VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAID--IQNHSAIIHFCQE----KHIDLVV-VG--PELP   73 (424)
Q Consensus         3 ILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~--~~d~~~i~~~a~~----~~iDlvi-vg--pE~p   73 (424)
                      .||+||--=.|     |.||-.-.-+|.-|- -||+.+.+. ++.  ..+.+++.+.+.+    .+|..++ +|  |.+-
T Consensus        40 FLVvGsrTCah-----llQsA~GvMIFAePR-f~tAileE~-Dlag~ad~~~El~rvv~~l~rr~~i~~lflvgsCpsEv  112 (425)
T PRK02842         40 FLVVGTRTCAH-----LLQSAAGVMIFAEPR-FGTAILEEG-DLAGLADANEELDRVVEEIKRRPNPSVIFLVGSCPSEV  112 (425)
T ss_pred             EEEEECCHHHH-----HHHHCCCCEEECCCC-CCEEECCCC-HHCCCCCCCHHHHHHHHHHHCCCCCCEEEEECCCCHHH
T ss_conf             99984502787-----874066771315761-111232620-11046777188999999983489982799973587666


Q ss_pred             H---HHHHHHHHHHC-CCCEE
Q ss_conf             8---74899898605-88067
Q gi|254780206|r   74 L---VNGISDALNAA-GFKVF   90 (424)
Q Consensus        74 L---~~gi~d~l~~~-gi~v~   90 (424)
                      +   ..+.+..|+.. ++||+
T Consensus       113 IKlDL~~~A~rL~~~~~v~Vl  133 (425)
T PRK02842        113 IKLDLEGLAERLSTEFGVPVL  133 (425)
T ss_pred             HHHHHHHHHHHHHHHHCCEEE
T ss_conf             340288899986441187079


No 295
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.
Probab=62.68  E-value=12  Score=17.57  Aligned_cols=73  Identities=19%  Similarity=0.304  Sum_probs=38.7

Q ss_pred             CHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCH-HHHHHHHCCCCE--EEEEECC
Q ss_conf             557874899898605880670106665552010235788876531011112234401-111121012420--2563046
Q gi|254780206|r   71 ELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPM-KAKQYVQNKSMP--IVVKADG  146 (424)
Q Consensus        71 E~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~-ea~~~~~~~g~P--vVVKp~~  146 (424)
                      |.|-...+.+.++..|+.++|-+......|.+....|++++++|+.-|-.   .+.+ .+.+...-.++|  ++|-++|
T Consensus        41 e~P~l~~l~~~~~~~gv~vigV~~~~~~~e~~~~~~~~~~~~~~i~~pv~---~D~~~~~~~~~~v~~~Pt~~lID~~G  116 (126)
T cd03012          41 TLPYLTDLEQKYKDDGLVVIGVHSPEFAFERDLANVKSAVLRYGITYPVA---NDNDYATWRAYGNQYWPALYLIDPTG  116 (126)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEE---ECCCHHHHHHCCCCCCCEEEEECCCC
T ss_conf             72999999997065881799984454443025999999999859974289---85817889857998238799998998


No 296
>PRK08328 hypothetical protein; Provisional
Probab=62.61  E-value=12  Score=17.56  Aligned_cols=30  Identities=23%  Similarity=0.454  Sum_probs=23.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             5899886588999999998589967899954
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      +|||+|-||--..+++.|..+. +.++.++.
T Consensus        29 ~VlvvG~GGlGs~~~~~La~~G-vG~i~lvD   58 (230)
T PRK08328         29 KVAVVGVGGLGSPVAYYLAAAG-VGTVLLID   58 (230)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEC
T ss_conf             7899887878999999999848-98689874


No 297
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
Probab=62.55  E-value=12  Score=17.55  Aligned_cols=89  Identities=19%  Similarity=0.198  Sum_probs=43.2

Q ss_pred             EEEEEC-------CCHHH---HHHHHHHHHCCCCCEEEEECCCHH-HHH-CCEEEEC-----------------------
Q ss_conf             589988-------65889---999999985899678999549835-751-1705512-----------------------
Q gi|254780206|r    2 RVLLIG-------SGGRE---HALAWKIAQSPLLSELWSIPGNPG-IAQ-HAQCVAI-----------------------   46 (424)
Q Consensus         2 kILviG-------sGgrE---hAl~~~l~~s~~~~~v~~~pgN~g-~~~-~~~~~~i-----------------------   46 (424)
                      |||++.       .||-|   +-|+..|.+.+....|++...++. ... .......                       
T Consensus         1 rIl~vt~~~pP~~~GG~e~~~~~la~~L~~~Gh~V~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (359)
T cd03823           1 RILVVNHLYPPRSVGGAEVVAHDLAEALAKRGHEVAVLTAGEDPPRQDKEVIGVVVYGRPIDEVLRSALPRDLFHLSDYD   80 (359)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHC
T ss_conf             99999486489997649999999999999779989999557987664213576179704764200354310156776422


Q ss_pred             CCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             87898999999987189799997955787489989860588067
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVF   90 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~   90 (424)
                      +......+.++.++.++|+|++-.-.++..+....+...++|++
T Consensus        81 ~~~~~~~~~~~~~~~~pDivh~h~~~~~~~~~~~~~~~~~~p~v  124 (359)
T cd03823          81 NPAVVAEFARLLEDFRPDVVHFHHLQGLGVSILRAARDRGIPIV  124 (359)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHCCCCEE
T ss_conf             78999999999987499999988831767999999998499899


No 298
>KOG3198 consensus
Probab=62.46  E-value=3  Score=21.77  Aligned_cols=33  Identities=36%  Similarity=0.629  Sum_probs=29.6

Q ss_pred             CHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHH
Q ss_conf             55787489989860588067010666555201023578887
Q gi|254780206|r   71 ELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCT  111 (424)
Q Consensus        71 E~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~  111 (424)
                      |.|++.-|+|.|+..|+.++        +|.+|.+-++|+.
T Consensus        42 eNP~a~eI~Dvl~~lgl~~~--------~E~~K~hPrD~~n   74 (152)
T KOG3198          42 ENPLAKEIADVLRALGLNCL--------LEPNKKHPRDFVN   74 (152)
T ss_pred             CCCCHHHHHHHHHHHCCCCC--------CCCCCCCCHHCCC
T ss_conf             28442589999998198530--------2535358202078


No 299
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886    Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5.1.3.2 from EC) interconverts UDP-glucose and UDP-galactose which are precursors of glucose- and galactose-containing exopolysaccharides (EPS). A set of related proteins, some of which are tentatively identified as UDP-glucose-4-epimerase in Thermotoga maritima, Bacillus halodurans, and several archaea, but deeply branched from this set and lacking experimental evidence, are excluded and described by a separate model. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0006012 galactose metabolic process.
Probab=62.27  E-value=12  Score=17.52  Aligned_cols=63  Identities=21%  Similarity=0.407  Sum_probs=43.4

Q ss_pred             EEEEECCCHH--HHHHHHHHHHCCCCCEEEEE----CCCHHHHHCCE--------EEECCCCCHHHHHHHHH----HHCC
Q ss_conf             5899886588--99999999858996789995----49835751170--------55128789899999998----7189
Q gi|254780206|r    2 RVLLIGSGGR--EHALAWKIAQSPLLSELWSI----PGNPGIAQHAQ--------CVAIDIQNHSAIIHFCQ----EKHI   63 (424)
Q Consensus         2 kILviGsGgr--EhAl~~~l~~s~~~~~v~~~----pgN~g~~~~~~--------~~~i~~~d~~~i~~~a~----~~~i   63 (424)
                      ||||-|+-|-  =|- +..|.++..  +|.+.    .|++-.....+        .+.-|..|.+.|.++-.    +++|
T Consensus         1 ~iLVTGGAGYIGSHt-~~~Ll~~G~--ev~vlDNLs~G~~~~l~~~~~~~G~~~~fv~gDL~D~~~l~~~f~kqql~~~i   77 (341)
T TIGR01179         1 KILVTGGAGYIGSHT-VRQLLESGY--EVVVLDNLSNGSAEALKRGEEITGKEVTFVEGDLRDRELLRRVFEKQQLEHKI   77 (341)
T ss_pred             CEEEEECCCCCHHHH-HHHHHHCCC--EEEEEECCCCCCHHHHCCCCEECCCCCEEEEECCHHHHHHHHHHHHHHHCCCC
T ss_conf             926861466443588-788763597--28998157888488750023414853205871751579999998774311675


Q ss_pred             CEEE
Q ss_conf             7999
Q gi|254780206|r   64 DLVV   67 (424)
Q Consensus        64 Dlvi   67 (424)
                      |-||
T Consensus        78 dAVi   81 (341)
T TIGR01179        78 DAVI   81 (341)
T ss_pred             CEEE
T ss_conf             4675


No 300
>PRK06217 hypothetical protein; Validated
Probab=62.25  E-value=12  Score=17.52  Aligned_cols=37  Identities=22%  Similarity=0.463  Sum_probs=22.1

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCC-----CCEEEEECCCHHH
Q ss_conf             958998865889-999999985899-----6789995498357
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPL-----LSELWSIPGNPGI   37 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~-----~~~v~~~pgN~g~   37 (424)
                      |||+|+|+.|-- --|+.+|.+.-.     .+.+|--|++|.+
T Consensus         2 ~rI~i~G~sGsGkSTla~~La~~l~~~~~~lD~~~W~p~~~pf   44 (185)
T PRK06217          2 MRIHITGASGSGTTTLGAALAEALDLPHLDTDDFFWLPTDPPF   44 (185)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEECCCCEECCCCCCC
T ss_conf             6799978998878999999999759896864555356899975


No 301
>PRK13123 consensus
Probab=62.23  E-value=12  Score=17.51  Aligned_cols=15  Identities=7%  Similarity=-0.024  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHCCCCC
Q ss_conf             788876531011112
Q gi|254780206|r  107 KKFCTKYGIPTATYQ  121 (424)
Q Consensus       107 K~~l~~~gIPt~~~~  121 (424)
                      ++.++++||......
T Consensus       135 ~~~~~~~gi~~I~li  149 (256)
T PRK13123        135 APLLRDTDIALIPLV  149 (256)
T ss_pred             HHHHHHCCCCEEEEC
T ss_conf             999997699778640


No 302
>PTZ00287 6-phosphofructokinase; Provisional
Probab=62.07  E-value=12  Score=17.49  Aligned_cols=93  Identities=16%  Similarity=0.195  Sum_probs=57.4

Q ss_pred             CEEEEECCCHHH---HH----HHHHHHHCCCCCEEEEECCCH-HHH----------------------HCC-EEEEC-CC
Q ss_conf             958998865889---99----999998589967899954983-575----------------------117-05512-87
Q gi|254780206|r    1 MRVLLIGSGGRE---HA----LAWKIAQSPLLSELWSIPGNP-GIA----------------------QHA-QCVAI-DI   48 (424)
Q Consensus         1 MkILviGsGgrE---hA----l~~~l~~s~~~~~v~~~pgN~-g~~----------------------~~~-~~~~i-~~   48 (424)
                      +||.||=|||..   |-    |-.+|++-.--.++|=.-|.| |..                      -+. -..-| ..
T Consensus       180 LrVGVvLSGGqAPGGHNVI~GlfD~lK~~Np~S~L~GFlgGp~Gl~~~~y~EiT~e~i~~YRN~GGFDmIgSGR~KIet~  259 (1439)
T PTZ00287        180 LKIGIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTITDSLMNRFRNLGGFNMLWSGRGKVKNK  259 (1439)
T ss_pred             EEEEEEEECCCCCCCCEEEHHHHHHHHHHCCCCEEEEECCCCHHHCCCCEEEECHHHHHHHHCCCCCCEECCCCCCCCCH
T ss_conf             89999964799998640315268999864987879875678433226865993599998633388853321585323799


Q ss_pred             CCHHHHHHHHHHHCCC-EEEECCCHH--HHHHHHHHHHHCC--CCEEECC
Q ss_conf             8989999999871897-999979557--8748998986058--8067010
Q gi|254780206|r   49 QNHSAIIHFCQEKHID-LVVVGPELP--LVNGISDALNAAG--FKVFGPS   93 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iD-lvivgpE~p--L~~gi~d~l~~~g--i~v~Gp~   93 (424)
                      .++++.++.|++.+.| |||||-+..  -++=+++.|.+.+  +.|+|-+
T Consensus       260 EQ~~~a~~t~~~L~LdgLVIIGGDdSNTNAA~LAEYf~~~~~~t~VIGvP  309 (1439)
T PTZ00287        260 DDLIAIENIVAKLKLNGLVIIGGDGSNSNAALIAEYFAERNIPISIIGIP  309 (1439)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEECCC
T ss_conf             99999999999728987999848997488999999999669995798157


No 303
>PRK13609 diacylglycerol glucosyltransferase; Provisional
Probab=61.99  E-value=12  Score=17.48  Aligned_cols=35  Identities=20%  Similarity=0.426  Sum_probs=20.9

Q ss_pred             HHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHC-C--CCEE
Q ss_conf             9999999871897999979557874899898605-8--8067
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPELPLVNGISDALNAA-G--FKVF   90 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~-g--i~v~   90 (424)
                      ..+.++.+++++|+||.-  -|+..  +..+.+. +  +|++
T Consensus        94 ~~l~~li~~~kPDvII~T--~P~~~--l~~lk~~~~~~iP~~  131 (388)
T PRK13609         94 KRLKLLLQAEKPDIVINT--FPIIA--VPELKKQTGISIPVY  131 (388)
T ss_pred             HHHHHHHHHCCCCEEEEC--CCHHH--HHHHHHHCCCCCCEE
T ss_conf             999999998295999988--87899--999998459999889


No 304
>PRK05849 hypothetical protein; Provisional
Probab=61.72  E-value=12  Score=17.45  Aligned_cols=167  Identities=17%  Similarity=0.184  Sum_probs=80.3

Q ss_pred             HHHHHHHHHHCCCCCCC----CCCHHHHHHHH-CC-CCEEEEEEC-----C---CCCCCCCCC--H--HHHHHHHHHHHH
Q ss_conf             78887653101111223----44011111210-12-420256304-----6---534300023--2--356778887887
Q gi|254780206|r  107 KKFCTKYGIPTATYQHF----SDPMKAKQYVQ-NK-SMPIVVKAD-----G---LCAGKGVVV--A--ATVDEATSAIDR  168 (424)
Q Consensus       107 K~~l~~~gIPt~~~~~~----~~~~ea~~~~~-~~-g~PvVVKp~-----~---~agGkGV~i--~--~~~~e~~~~~~~  168 (424)
                      +..+++..||---+..+    .+.+...+.+. .+ +-|++|+-+     +   +.+|+=-++  +  .+.+++.+++.+
T Consensus        19 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~iVRSSa~~ED~~~~S~AG~~~S~lnV~~~~~~~l~~ai~~   98 (782)
T PRK05849         19 QTALKKAKILPLLLFSVAEWLSNKDKVLQEIQSSFPSDKLIVRSSSRSEDSMSSSNAGAFLSLLNVPADSKDALLKALEK   98 (782)
T ss_pred             HHHHHCCCCCCEEEEEHHHHHHCHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCEEECCCCCCCHHHHHHHHHH
T ss_conf             87642574797599889998747999999999864899479957873448745666767423248784669999999999


Q ss_pred             HHCCC-----CHHHHHHHHHHCCCCCEEEEC-C---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCC-CCCCCE
Q ss_conf             51445-----317778877520575234421-5---7763103520001113566544444344300001234-432220
Q gi|254780206|r  169 CFQQI-----NSTVIIEEYLEGFEVSFFALC-D---GKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM-SQELYS  238 (424)
Q Consensus       169 ~~~~~-----~~~VliEefl~G~E~Sv~~i~-d---G~~~~~l~~~~dyKr~~~~d~GpnTGGMGa~~p~~~~-~~~~~~  238 (424)
                      .+.+.     ++.|||++++++..+|=-+|+ |   |..++..    .|..-  +++---|+|-+.  +...+ ......
T Consensus        99 v~~sy~~~~~~~~vliQ~m~~~v~~sGV~ft~d~~~~~py~vi----n~~~~--g~t~~VtsG~~~--~~~~~~~~~~~~  170 (782)
T PRK05849         99 VINSYGEADKDDEILVQPMLEDIVLSGVIMSVDKEDGAPYYVV----NYDES--GSTDSVTGGSGG--SKTTYYHRSDAL  170 (782)
T ss_pred             HHHHHCCCCCCCEEEEEHHCCCCCEEEEEEECCCCCCCCEEEE----EECCC--CCCCEEECCCCC--CEEEEEECCCCC
T ss_conf             9998566888976997200157745899960688899974999----95588--987678678787--569999637754


Q ss_pred             EEECCHHHHHHHHHHHCCCEEEE-EEEEEEEEECCE-EEEEEEEE
Q ss_conf             10000089999986204623566-445448985570-48999886
Q gi|254780206|r  239 TVIQKIILPTIEGMQKEQNPFQG-VLFAGLMITEQG-PYLIEYNV  281 (424)
Q Consensus       239 ~i~~~i~~~~~~~l~~~~~~y~G-~l~~~~m~t~~g-p~viE~N~  281 (424)
                      .....-+++.+.+++..---|.+ .|-+++-++++| ++++-...
T Consensus       171 ~~~~~~~~~li~~~~elE~l~~~~~lDIEfaid~~~~l~llQvRP  215 (782)
T PRK05849        171 VFKPPRLKKLIELIRELEALFGCDFLDIEFAIDEKEELYILQVRP  215 (782)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCEEEEEECC
T ss_conf             578677999999999999981999621699985999589999433


No 305
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2. UBA2 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. UBA2 contains both the nucleotide-binding motif involved in adenylation and the catalytic cysteine involved in the thioester intermediate and Ublp transfer to E2.
Probab=61.38  E-value=12  Score=17.41  Aligned_cols=112  Identities=13%  Similarity=0.184  Sum_probs=54.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHCCEEEECCC-----CCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             5899886588999999998589967899954-9835751170551287-----898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP-GNPGIAQHAQCVAIDI-----QNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~~~~~~i~~-----~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      ||||+|.||----+++-|..++ +.++.++. +.-....+....-+..     .-.+...+.+++.+++.-|..-...+.
T Consensus         1 KVlvvGaGglG~e~lk~La~~G-vg~i~ivD~D~Ie~SNLnRQfLf~~~diGk~Ka~~a~~~l~~~Np~v~I~~~~~~i~   79 (312)
T cd01489           1 KVLVVGAGGIGCELLKNLVLTG-FGEIHIIDLDTIDLSNLNRQFLFRKKHVGKSKAQVAKEAVLSFNPNVKIVAYHANIK   79 (312)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             9899888888999999999828-985999719922610146682768221887099999999998888967998616766


Q ss_pred             H-HH-HHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCC
Q ss_conf             4-89-98986058806701066655520102357888765310111
Q gi|254780206|r   76 N-GI-SDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT  119 (424)
Q Consensus        76 ~-gi-~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~  119 (424)
                      . -. .+.++...+-+-|-.--.||     .+.-+.+..+++|--.
T Consensus        80 ~~~~~~~f~~~~DvVi~alDN~~aR-----~~vN~~C~~~~~PlIe  120 (312)
T cd01489          80 DPDFNVEFFKQFDLVFNALDNLAAR-----RHVNKMCLAADVPLIE  120 (312)
T ss_pred             CCCCCHHHHHHCCEEEECCCCHHHH-----HHHHHHHHHCCCCEEE
T ss_conf             8643498896299999766789999-----9999999983997597


No 306
>pfam04174 DUF407 Domain of unknown function (DUF407).
Probab=61.30  E-value=7  Score=19.15  Aligned_cols=62  Identities=16%  Similarity=0.306  Sum_probs=36.5

Q ss_pred             HHHH-HHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHH--HHHHHHHHHHHH
Q ss_conf             7888-76531011112234401111121012420256304653430002323--567788878875
Q gi|254780206|r  107 KKFC-TKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAA--TVDEATSAIDRC  169 (424)
Q Consensus       107 K~~l-~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~--~~~e~~~~~~~~  169 (424)
                      |.++ ++.-+|.....-+-+.++....++++. -+||||...++|.|+.+-.  +.+|..+..+++
T Consensus         3 r~lLgE~l~Lp~v~TwWCG~~~~~~~Vl~nl~-~lVIkp~~~~~g~~~~~g~~ls~~e~~~l~~~I   67 (145)
T pfam04174         3 ERYLGEEPLLPNVPTYWCGEPEELEHVLAHLT-ELVIKPVGGSGGYGMLVGPAASSAELAEFAERI   67 (145)
T ss_pred             HHHCCCCCCCCCCCCCCCCCHHHHHHHHHCHH-HCEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             68759873689865037998899999985676-558985467788877434108999999999998


No 307
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning]
Probab=61.21  E-value=12  Score=17.39  Aligned_cols=28  Identities=25%  Similarity=0.419  Sum_probs=16.9

Q ss_pred             EEEEECCC----HHH---HHHHHHHHHCCCCCEEEEE
Q ss_conf             58998865----889---9999999858996789995
Q gi|254780206|r    2 RVLLIGSG----GRE---HALAWKIAQSPLLSELWSI   31 (424)
Q Consensus         2 kILviGsG----grE---hAl~~~l~~s~~~~~v~~~   31 (424)
                      +|.||-||    |..   .+|+-+|.+...  ++.+.
T Consensus         3 ~iIVvTSGKGGVGKTTttAnig~aLA~~Gk--Kv~li   37 (272)
T COG2894           3 RIIVVTSGKGGVGKTTTTANIGTALAQLGK--KVVLI   37 (272)
T ss_pred             EEEEEECCCCCCCCCCHHHHHHHHHHHCCC--EEEEE
T ss_conf             499994488876743106778999997398--59999


No 308
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, 
Probab=60.67  E-value=12  Score=17.33  Aligned_cols=12  Identities=25%  Similarity=0.421  Sum_probs=4.6

Q ss_pred             HHHHHCCCCCEE
Q ss_conf             999858996789
Q gi|254780206|r   17 WKIAQSPLLSEL   28 (424)
Q Consensus        17 ~~l~~s~~~~~v   28 (424)
                      ..|.+.+.+.++
T Consensus        31 ~~l~~~~~i~e~   42 (311)
T cd05213          31 RRLLEKPGISEA   42 (311)
T ss_pred             HHHHCCCCCCEE
T ss_conf             998637997239


No 309
>KOG2741 consensus
Probab=60.56  E-value=12  Score=17.31  Aligned_cols=88  Identities=16%  Similarity=0.184  Sum_probs=48.8

Q ss_pred             EEEEECCC--HHHHHHHHHHHHCCCCCEEEE--E-CCCHHHHHCCEEEEC-CCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             58998865--889999999985899678999--5-498357511705512-87898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSG--GREHALAWKIAQSPLLSELWS--I-PGNPGIAQHAQCVAI-DIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsG--grEhAl~~~l~~s~~~~~v~~--~-pgN~g~~~~~~~~~i-~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      |+.++|-|  +|+|+.  +|..++......+  + |.---...+++...+ +++-+...-++++.-.+|.|++++-.|+-
T Consensus         8 r~Gi~g~g~ia~~f~~--al~~~p~s~~~Ivava~~s~~~A~~fAq~~~~~~~k~y~syEeLakd~~vDvVyi~~~~~qH   85 (351)
T KOG2741           8 RWGIVGAGRIARDFVR--ALHTLPESNHQIVAVADPSLERAKEFAQRHNIPNPKAYGSYEELAKDPEVDVVYISTPNPQH   85 (351)
T ss_pred             EEEEEEHHHHHHHHHH--HHCCCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCCCCHHHHHCCCCCCEEEECCCCCCH
T ss_conf             8988604677899999--72147545827999965527889999986599987425579988249876879967998008


Q ss_pred             HHHHHHHHHCCCCEEE
Q ss_conf             4899898605880670
Q gi|254780206|r   76 NGISDALNAAGFKVFG   91 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~G   91 (424)
                      .-++--.-..|-+|+.
T Consensus        86 ~evv~l~l~~~K~VL~  101 (351)
T KOG2741          86 YEVVMLALNKGKHVLC  101 (351)
T ss_pred             HHHHHHHHHCCCCEEE
T ss_conf             9999999975995786


No 310
>cd03466 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE.  NifN and nifE are structurally homologous to nitrogenase MoFe protein beta and alpha subunits respectively.  NifEN participates in the synthesis of the iron-molybdenum cofactor (FeMoco) of the MoFe protein.  NifB-co (an iron and sulfur containing precursor of the FeMoco) from NifB is transferred to the NifEN complex where it is further processed to FeMoco. The nifEN bound precursor of FeMoco has been identified as a molybdenum-free, iron- and sulfur- containing analog of FeMoco. It has been suggested that this nifEN bound precursor also acts as a cofactor precursor in nitrogenase systems which require a cofactor other than FeMoco: i.e. iron-vanadium cofactor (FeVco) or iron only cofactor (FeFeco). This group also contains the Clostidium fused NifN-NifB protein.
Probab=60.38  E-value=13  Score=17.29  Aligned_cols=96  Identities=8%  Similarity=0.145  Sum_probs=58.1

Q ss_pred             HHHHHHHHHHHCCCEEEECCC---HHH---HHHHHHHHHHCC----CCEE---ECCHHHHHHHHCCHHHHHHHHHHHHH-
Q ss_conf             899999998718979999795---578---748998986058----8067---01066655520102357888765310-
Q gi|254780206|r   51 HSAIIHFCQEKHIDLVVVGPE---LPL---VNGISDALNAAG----FKVF---GPSQRAAKLESSKSFAKKFCTKYGIP-  116 (424)
Q Consensus        51 ~~~i~~~a~~~~iDlvivgpE---~pL---~~gi~d~l~~~g----i~v~---Gp~~~aa~le~sK~~~K~~l~~~gIP-  116 (424)
                      .++|.+..+..+++++++-..   +-+   ..+++..+++..    +|++   .|+-..++..+-....+.+++..--+ 
T Consensus        73 ~~aI~~~~~~~~P~~i~V~sTC~~e~IGDDi~~v~k~~~~~~~~~~~~vi~v~tpgF~Gs~~~G~~~a~~ali~~~~~~~  152 (429)
T cd03466          73 KKGLKNVIEQYNPEVIGIATTCLSETIGEDVPRIIREFREEVDDSEPKIIPASTPGYGGTHVEGYDTAVRSIVKNIAVDP  152 (429)
T ss_pred             HHHHHHHHHHCCCCEEEEECCCHHHHHCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999999841998899965743865236399999999873478888379863898768678999999999999847798


Q ss_pred             CC--------CCCCCCCCHHHHHHHHCCCCEEEEEECC
Q ss_conf             11--------1122344011111210124202563046
Q gi|254780206|r  117 TA--------TYQHFSDPMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus       117 t~--------~~~~~~~~~ea~~~~~~~g~PvVVKp~~  146 (424)
                      .+        .|..-.|..++++.++.+|..+++=||-
T Consensus       153 ~~~~~vNli~~~~~~gD~~eik~ll~~~Gl~~~vlpd~  190 (429)
T cd03466         153 DKIEKINVIAGMMSPADIREIKEILREFGIEYILLPDT  190 (429)
T ss_pred             CCCCCEEECCCCCCHHHHHHHHHHHHHCCCCEEECCCC
T ss_conf             87885678179897666999999999829957971464


No 311
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223   This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. In Escherichia coli, the cell division site is determined by the cooperative activity of min operon products MinC, MinD, and MinE . MinD is a membrane-associated ATPase and is a septum site-determining factor through the activation and regulation of MinC and MinE. MinD is also known to undergo a rapid pole-to-pole oscillation movement in vivo as observed by fluorescent microscopy. In plants, chloroplast division requires the dimerisation of stromal MinD . The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model.; GO: 0016887 ATPase activity, 0000918 selection of site for barrier septum formation.
Probab=60.31  E-value=8.1  Score=18.67  Aligned_cols=30  Identities=27%  Similarity=0.583  Sum_probs=19.8

Q ss_pred             CCEEEEEEE--EEEEE-ECCE-EEEEEEE-EEECC
Q ss_conf             623566445--44898-5570-4899988-65147
Q gi|254780206|r  256 QNPFQGVLF--AGLMI-TEQG-PYLIEYN-VRFGD  285 (424)
Q Consensus       256 ~~~y~G~l~--~~~m~-t~~g-p~viE~N-~R~GD  285 (424)
                      .++-.|++=  -++++ |+.| |-||+=| |+-|.
T Consensus       203 ~i~LiGviPeD~~iI~stN~GEP~vl~~~L~~~g~  237 (272)
T TIGR01968       203 SIPLIGVIPEDEEIIVSTNKGEPVVLNKKLSRAGK  237 (272)
T ss_pred             CCCCEEEECCCCCEEEEECCCEEEEECCCCCHHHH
T ss_conf             88616863299865766456143544600261678


No 312
>PRK06101 short chain dehydrogenase; Provisional
Probab=60.22  E-value=13  Score=17.27  Aligned_cols=65  Identities=18%  Similarity=0.232  Sum_probs=39.4

Q ss_pred             CE-EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHH-H------CCEEEECCCCCHHHHHHHHHHHC--CCEEE
Q ss_conf             95-8998865-88999999998589967899954983575-1------17055128789899999998718--97999
Q gi|254780206|r    1 MR-VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIA-Q------HAQCVAIDIQNHSAIIHFCQEKH--IDLVV   67 (424)
Q Consensus         1 Mk-ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~-~------~~~~~~i~~~d~~~i~~~a~~~~--iDlvi   67 (424)
                      || |||.|+. |--.|+|..|.+...  +|+++--|.... .      ....+..|..|.+++.+...+..  +|..+
T Consensus         1 MktvlITGassGIG~a~A~~la~~G~--~Vi~~~R~~~~l~~~~~~~~~~~~~~~Dvtd~~~~~~~~~~~~~~~d~~i   76 (241)
T PRK06101          1 MTSVLITGATSGIGKQLALDYAKAGW--KVIACGRNEAVLDELHDQSSNIFTLAFDVTDYEETKAALSQLPFIPELWI   76 (241)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHCCCCCEEE
T ss_conf             99899922404999999999998799--89999899999999997328804898522679999999997187777899


No 313
>PRK05708 2-dehydropantoate 2-reductase; Provisional
Probab=59.70  E-value=13  Score=17.21  Aligned_cols=24  Identities=25%  Similarity=0.405  Sum_probs=20.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             958998865889999999985899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPL   24 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~   24 (424)
                      |||+|+|.|+----++..|++...
T Consensus         3 MkI~IiGaGAiG~~~a~~L~~ag~   26 (305)
T PRK05708          3 MTWHILGAGSLGSLWACRLARAGL   26 (305)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC
T ss_conf             889998823999999999984899


No 314
>PRK13190 putative peroxiredoxin; Provisional
Probab=59.63  E-value=9.1  Score=18.31  Aligned_cols=61  Identities=15%  Similarity=0.196  Sum_probs=39.2

Q ss_pred             CEEEECCCHH-HHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCH
Q ss_conf             7999979557-874899898605880670106665552010235788876531011112234401
Q gi|254780206|r   64 DLVVVGPELP-LVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPM  127 (424)
Q Consensus        64 DlvivgpE~p-L~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~  127 (424)
                      |++.+.|.+- -.+...+.|++.|..++|-|.++.  ++.+.|.+++-++.|+. ..|-.+.|..
T Consensus        38 DfTpvCttEl~~f~~~~~eF~~~~~~vigiS~Ds~--~sH~aW~~~~~~~~G~~-v~fPliaD~~   99 (202)
T PRK13190         38 DFTPVCTTEFIAFSRRYEDFKKLGVELVGLSVDSI--YSHIAWLRDIEERFGIK-IPFPVIADID   99 (202)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCEEEEEECCCH--HHHHHHHHCHHHHCCCC-CCCCCCCCCC
T ss_conf             88986717999999989999976988999967539--99999856879856933-1223433895


No 315
>PRK13131 consensus
Probab=59.55  E-value=12  Score=17.36  Aligned_cols=13  Identities=23%  Similarity=0.018  Sum_probs=5.2

Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             8887653101111
Q gi|254780206|r  108 KFCTKYGIPTATY  120 (424)
Q Consensus       108 ~~l~~~gIPt~~~  120 (424)
                      +.++++|+.....
T Consensus       134 ~~~~~~~l~~I~l  146 (257)
T PRK13131        134 KSAQKHQIKQIFI  146 (257)
T ss_pred             HHHHHCCCCEEEE
T ss_conf             9999779847997


No 316
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.
Probab=59.29  E-value=13  Score=17.26  Aligned_cols=78  Identities=18%  Similarity=0.215  Sum_probs=43.6

Q ss_pred             HHHHHHHHHHHHCCCCEEECCHHH--HHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE--EEEEECCCC
Q ss_conf             787489989860588067010666--5552010235788876531011112234401111121012420--256304653
Q gi|254780206|r   73 PLVNGISDALNAAGFKVFGPSQRA--AKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP--IVVKADGLC  148 (424)
Q Consensus        73 pL~~gi~d~l~~~gi~v~Gp~~~a--a~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P--vVVKp~~~a  148 (424)
                      |-...+...+.+.|+.++|-+...  ...+.+...+++++++++++-|-  .++...++.+...-...|  +||-|+|--
T Consensus        45 p~l~~l~~~~~~~gv~~lgVn~~~~~~~~~ds~~~~~~~~~~~~~~fPv--L~D~~g~va~~yg~~~tP~~fvID~~G~i  122 (171)
T cd02969          45 DRLNRLAKEYGAKGVAVVAINSNDIEAYPEDSPENMKAKAKEHGYPFPY--LLDETQEVAKAYGAACTPDFFLFDPDGKL  122 (171)
T ss_pred             HHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHCCCCEE--EEECCCHHHHHCCCCCCCEEEEECCCCEE
T ss_conf             7655677676347828999966874437556999999999870237179--99589749997499648807998899989


Q ss_pred             CCCC
Q ss_conf             4300
Q gi|254780206|r  149 AGKG  152 (424)
Q Consensus       149 gGkG  152 (424)
                      -.+|
T Consensus       123 ~YrG  126 (171)
T cd02969         123 VYRG  126 (171)
T ss_pred             EEEC
T ss_conf             9868


No 317
>PRK10116 universal stress protein UspC; Provisional
Probab=58.93  E-value=9.4  Score=18.20  Aligned_cols=85  Identities=9%  Similarity=0.141  Sum_probs=45.0

Q ss_pred             HHHHHHHHHHCCCE--EEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCC-C-CCH
Q ss_conf             99999998718979--9997955787489989860588067010666555201023578887653101111223-4-401
Q gi|254780206|r   52 SAIIHFCQEKHIDL--VVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHF-S-DPM  127 (424)
Q Consensus        52 ~~i~~~a~~~~iDl--vivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~-~-~~~  127 (424)
                      +.-..+|+..+-.+  +.+..+..+..++       ..|.+.. -+....|..|.+.+++..+.++|.-..... - -.+
T Consensus        21 ~kA~~lA~~~~AklslihV~~~~~~y~~~-------~~~~~~d-~~~~~~e~a~~~L~~l~~~~~~pi~~~~v~~G~~~~   92 (142)
T PRK10116         21 AKAVSIARPVNGKISLITLASDPEMYNQF-------AAPMLED-LRSVMQEETQSFLDELIQKADYPIEKTFIAYGELSE   92 (142)
T ss_pred             HHHHHHHHHCCCEEEEEEEECCHHHHHHC-------CCHHHHH-HHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCHHH
T ss_conf             99999999819989999993576665210-------2213788-999999999999999998749981589999658899


Q ss_pred             HHHHHHHCCCCEEEEEE
Q ss_conf             11112101242025630
Q gi|254780206|r  128 KAKQYVQNKSMPIVVKA  144 (424)
Q Consensus       128 ea~~~~~~~g~PvVVKp  144 (424)
                      +..+++++.+.-++|=-
T Consensus        93 ~I~~~a~e~~~DLIV~G  109 (142)
T PRK10116         93 HILEVCRKHHFDLVICG  109 (142)
T ss_pred             HHHHHHHHHCCCEEEEE
T ss_conf             99999999699999990


No 318
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated
Probab=58.73  E-value=13  Score=17.10  Aligned_cols=112  Identities=15%  Similarity=0.093  Sum_probs=51.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHCCEEEECCC-----CCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             5899886588999999998589967899954-9835751170551287-----898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP-GNPGIAQHAQCVAIDI-----QNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~~~~~~i~~-----~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      +|||+|-||=--..+.-|..+. +-++-++. +.-....+...+..+.     ...+...+..++.+++.-|..-...|.
T Consensus        44 ~VlvvG~GGLG~~~~~yLaaaG-vG~i~ivD~D~v~~sNL~RQil~~~~dvG~~K~~~a~~~l~~~Np~v~v~~~~~~l~  122 (392)
T PRK07878         44 RVLVIGAGGLGSPTLLYLAAAG-VGTIGIVEFDVVDESNLQRQIIHGQSDVGRSKAQSARDSIVEINPLVNVRLHEFRLE  122 (392)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHCCCCCCEEHHHCCC
T ss_conf             7899878757899999999828-975999878996745577200568433587079999999998789853121131378


Q ss_pred             H-HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCC
Q ss_conf             4-8998986058806701066655520102357888765310111
Q gi|254780206|r   76 N-GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT  119 (424)
Q Consensus        76 ~-gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~  119 (424)
                      . -..+.++...+-+=|..-..     .|...-+.+.++++|-..
T Consensus       123 ~~n~~~li~~~DvViD~tDN~~-----tR~lindac~~~~~PlV~  162 (392)
T PRK07878        123 PSNAVDLFAQYDLILDGTDNFA-----TRYLVNDAAVLAGKPYVW  162 (392)
T ss_pred             HHHHHHHHCCCCEEEECCCCHH-----HHHHHHHHHHHHCCCEEE
T ss_conf             8898764317768986689989-----999999999996998799


No 319
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair]
Probab=58.60  E-value=13  Score=17.08  Aligned_cols=43  Identities=19%  Similarity=0.333  Sum_probs=28.9

Q ss_pred             CCHHHHHHHHHHHCCCEEEECCC----------HH-HHHHHHHHHHHCCCCEEE
Q ss_conf             89899999998718979999795----------57-874899898605880670
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVVVGPE----------LP-LVNGISDALNAAGFKVFG   91 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlvivgpE----------~p-L~~gi~d~l~~~gi~v~G   91 (424)
                      ..++.+++.|+++++|+|+++-+          +- +.....-.|...|||+|.
T Consensus        27 ~~f~~~l~~a~~~~vD~vliAGDlFd~~~Ps~~a~~~~~~~l~~l~~~~Ipv~~   80 (390)
T COG0420          27 KAFDELLEIAKEEKVDFVLIAGDLFDTNNPSPRALKLFLEALRRLKDAGIPVVV   80 (390)
T ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             999999999997069999981555788999989999999999987546982899


No 320
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional
Probab=58.56  E-value=13  Score=17.08  Aligned_cols=116  Identities=14%  Similarity=0.216  Sum_probs=58.0

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHH
Q ss_conf             958998865889-9999999858996789995498357511705512878989999999871897999979557874899
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGIS   79 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~   79 (424)
                      |||||+=.---- ..|+..|++...  +|..+                 .|.++.++++.++.+|+++..-.-|=..   
T Consensus         1 mkILivEdd~~~~~~l~~~L~~~g~--~V~~a-----------------~~~~~al~~~~~~~~dlvilD~~lp~~~---   58 (223)
T PRK10816          1 MRVLVVEDNALLRHHLKVQLQDAGH--QVDAA-----------------EDAKEADYYLNEHLPDIAIVDLGLPDED---   58 (223)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCC--EEEEE-----------------CCHHHHHHHHHHCCCCEEEEECCCCCCC---
T ss_conf             9899995989999999999997899--99998-----------------9999999999757998999979998988---


Q ss_pred             HHHHHCCCCEEECCHHHHHHHHCCHHHHHHHH-HHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHH
Q ss_conf             89860588067010666555201023578887-65310111122344011111210124202563046534300023235
Q gi|254780206|r   80 DALNAAGFKVFGPSQRAAKLESSKSFAKKFCT-KYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAAT  158 (424)
Q Consensus        80 d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~-~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~  158 (424)
                            |+.                +++++=. ...+|.---....+.++..+.++.----+++||-            +
T Consensus        59 ------G~~----------------l~~~ir~~~~~~piI~lta~~~~~~~~~al~~Gaddyl~KP~------------~  104 (223)
T PRK10816         59 ------GLS----------------LIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPF------------H  104 (223)
T ss_pred             ------CCC----------------CCCCHHCCCCCCCEEEEECCCCHHHHHHHHHCCCCEEECCCC------------C
T ss_conf             ------640----------------012011048987689994445677899999869988641897------------7


Q ss_pred             HHHHHHHHHHHHCC
Q ss_conf             67788878875144
Q gi|254780206|r  159 VDEATSAIDRCFQQ  172 (424)
Q Consensus       159 ~~e~~~~~~~~~~~  172 (424)
                      .+|+...+......
T Consensus       105 ~~eL~arv~~~lrr  118 (223)
T PRK10816        105 IEEVMARMQALMRR  118 (223)
T ss_pred             HHHHHHHHHHHHCC
T ss_conf             78999999999665


No 321
>PRK06988 putative formyltransferase; Provisional
Probab=58.52  E-value=13  Score=17.07  Aligned_cols=35  Identities=9%  Similarity=0.044  Sum_probs=24.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC-CCEEEEECCCHH
Q ss_conf             58998865889999999985899-678999549835
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPL-LSELWSIPGNPG   36 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~-~~~v~~~pgN~g   36 (424)
                      ||...|+.........+|.++.. +.-|+.-|++|.
T Consensus         4 rivf~Gtp~fav~~L~~L~~~~~~v~~VvTqpD~p~   39 (313)
T PRK06988          4 RAVVFAYHNVGVRCLQVLLARGVDVALVVTHEDNPT   39 (313)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCC
T ss_conf             199979988999999999978996799989989976


No 322
>PRK10717 cysteine synthase A; Provisional
Probab=58.09  E-value=14  Score=17.02  Aligned_cols=18  Identities=11%  Similarity=0.333  Sum_probs=8.9

Q ss_pred             CCCEEEEEECCCCCCCCCCC
Q ss_conf             44206754225446687757
Q gi|254780206|r  320 AEYALTVVVATKGYPEEYPH  339 (424)
Q Consensus       320 ~~~~v~Vvlas~GYP~~~~k  339 (424)
                      ++..+.+|++..|.  +|..
T Consensus       296 ~g~~VV~Il~D~G~--rYls  313 (334)
T PRK10717        296 PGHTIVTILCDSGE--RYQS  313 (334)
T ss_pred             CCCEEEEEECCCCC--CCCC
T ss_conf             86979999798974--3453


No 323
>PRK07832 short chain dehydrogenase; Provisional
Probab=58.04  E-value=14  Score=17.02  Aligned_cols=78  Identities=28%  Similarity=0.492  Sum_probs=46.4

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCH-HHH----HC-------CEEEECCCCCHHHHHHHHHHH-----CC
Q ss_conf             58998865-88999999998589967899954983-575----11-------705512878989999999871-----89
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNP-GIA----QH-------AQCVAIDIQNHSAIIHFCQEK-----HI   63 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~-g~~----~~-------~~~~~i~~~d~~~i~~~a~~~-----~i   63 (424)
                      ++||-|.+ |---|+|..|.+...  +|++..-|. ...    ++       ...+..|..|.+++.+++++.     .+
T Consensus         2 ~alITGassGIG~a~A~~la~~Ga--~v~l~~r~~~~l~~~~~~l~~~g~~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~i   79 (272)
T PRK07832          2 RCFVTGAASGIGRATALRLAAQGA--ELFLTDRDADGLAQTVADARALGGTVPEHRALDISDYDAVAAFAADIHAAHPSM   79 (272)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             799947201999999999998899--899998988999999999984589714788566899999999999999972998


Q ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             799997955787489989860588067010666
Q gi|254780206|r   64 DLVVVGPELPLVNGISDALNAAGFKVFGPSQRA   96 (424)
Q Consensus        64 DlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~a   96 (424)
                      |..|               +.+|+..+||-.+.
T Consensus        80 DiLi---------------NNAGi~~~g~~~~~   97 (272)
T PRK07832         80 DVVM---------------NIAGISAWGTVDRL   97 (272)
T ss_pred             CEEE---------------ECCCCCCCCCCCCC
T ss_conf             8899---------------87876888873458


No 324
>PRK05600 thiamine biosynthesis protein ThiF; Validated
Probab=57.62  E-value=14  Score=16.97  Aligned_cols=22  Identities=36%  Similarity=0.534  Sum_probs=12.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC
Q ss_conf             5899886588999999998589
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSP   23 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~   23 (424)
                      +|||||-||=--..+.-|..+.
T Consensus        43 ~VlvvG~GGLG~p~~~yLaaaG   64 (370)
T PRK05600         43 RVLVIGAGGLGCPAMQSLASAG   64 (370)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC
T ss_conf             7899888757899999999828


No 325
>COG0205 PfkA 6-phosphofructokinase [Carbohydrate transport and metabolism]
Probab=57.33  E-value=14  Score=16.94  Aligned_cols=90  Identities=21%  Similarity=0.319  Sum_probs=48.3

Q ss_pred             CEEEEECCCHHH---HH----HHHHHHHCCCCCEEEEEC-CCHHHHH----------------------C-CEEEECC-C
Q ss_conf             958998865889---99----999998589967899954-9835751----------------------1-7055128-7
Q gi|254780206|r    1 MRVLLIGSGGRE---HA----LAWKIAQSPLLSELWSIP-GNPGIAQ----------------------H-AQCVAID-I   48 (424)
Q Consensus         1 MkILviGsGgrE---hA----l~~~l~~s~~~~~v~~~p-gN~g~~~----------------------~-~~~~~i~-~   48 (424)
                      +||.|+=|||-.   ||    +...+...  ..+||-.. |--|...                      . +.+..+. .
T Consensus         3 kkIaIlTSGGdaPGmNa~Iravvr~a~~~--g~eV~Gi~~Gy~GL~~~~i~~l~~~~v~~~~~~GGT~lgssr~~~~~~~   80 (347)
T COG0205           3 KKIAILTSGGDAPGMNAVIRAVVRTAIKE--GLEVFGIYNGYLGLLEGDIKPLTREDVDDLINRGGTFLGSARFPEFKTE   80 (347)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHHC--CCEEEEEECCHHHHCCCCCEECCHHHHHHHHHCCCEEEEECCCCCCCCH
T ss_conf             36999846889830769999999999976--9789999433234207861214420146798659868754788876567


Q ss_pred             CCHHHHHHHHHHHCCC-EEEECCCHHHHHHHHHHHHHCC-CCEEECCH
Q ss_conf             8989999999871897-9999795578748998986058-80670106
Q gi|254780206|r   49 QNHSAIIHFCQEKHID-LVVVGPELPLVNGISDALNAAG-FKVFGPSQ   94 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iD-lvivgpE~pL~~gi~d~l~~~g-i~v~Gp~~   94 (424)
                      ...+..++-.++++|| |+++|-+..+..  +..|.+++ ++|+|-++
T Consensus        81 e~~~~~~~~l~~~gId~LvvIGGDGS~~g--A~~Lae~~~i~vVGvPk  126 (347)
T COG0205          81 EGRKVAAENLKKLGIDALVVIGGDGSYTG--AALLAEEGGIPVVGVPK  126 (347)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCHHHH--HHHHHHHCCCCEEECCC
T ss_conf             79999999999839988999788873899--99999735986896688


No 326
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. This group includes the ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria. They are members of the LacI-GalR family of repressor proteins which are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=57.32  E-value=14  Score=16.94  Aligned_cols=39  Identities=13%  Similarity=0.220  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             999999987189799997955787489989860588067
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVF   90 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~   90 (424)
                      ...++....+++|.+|+-|-.-......+.+.+.|+|++
T Consensus        45 ~~~i~~l~~~~vDGiIi~~~~~~~~~~~~~l~~~~iPvV   83 (268)
T cd06289          45 EQLLSTMLEHGVAGIILCPAAGTSPDLLKRLAESGIPVV   83 (268)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEE
T ss_conf             999999996599989994688899999999997599899


No 327
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; InterPro: IPR012689    This entry represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde. The gene for enzyme is generally found adjacent to other genes for this pathway.; GO: 0018802 24-dihydroxyhept-2-ene-17-dioate aldolase activity, 0010124 phenylacetate catabolic process.
Probab=57.20  E-value=6.1  Score=19.57  Aligned_cols=147  Identities=20%  Similarity=0.229  Sum_probs=70.6

Q ss_pred             HHHHHHHCCCEEEECCC-HHH-HHHHHHHHHHC-C---CCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHH
Q ss_conf             99998718979999795-578-74899898605-8---806701066655520102357888765310111122344011
Q gi|254780206|r   55 IHFCQEKHIDLVVVGPE-LPL-VNGISDALNAA-G---FKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMK  128 (424)
Q Consensus        55 ~~~a~~~~iDlvivgpE-~pL-~~gi~d~l~~~-g---i~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~e  128 (424)
                      .++|---..|+..+--| +|- +.-|...|+.. .   -||+=|    +  .+|=..-|+| -.-|.-|-=-=.+.|.|+
T Consensus        26 aEi~A~AGfDWLL~DgEHAPnDv~~~l~QLQa~A~y~~~PvVRP----~--~~~~~lIK~l-LDIGAQTLLvPmi~~aeq   98 (249)
T TIGR02311        26 AEIVAGAGFDWLLIDGEHAPNDVRTLLSQLQALASYPSSPVVRP----A--IGDPVLIKQL-LDIGAQTLLVPMIETAEQ   98 (249)
T ss_pred             HHHHHCCCCCEEEECCCCCCHHHHHHHHHHCCCCCCCCCCEEEC----C--CCCCEEEEHH-HHHHHHHHHHHHHCCHHH
T ss_conf             46533147631101476581468999987102256799973436----7--7882021013-223456643103037789


Q ss_pred             HHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHH--HH--HHHHHHCCCCCEEEECCCCCCCCCCC
Q ss_conf             111210124202563046534300023235677888788751445317--77--88775205752344215776310352
Q gi|254780206|r  129 AKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST--VI--IEEYLEGFEVSFFALCDGKTAIPFTT  204 (424)
Q Consensus       129 a~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~--Vl--iEefl~G~E~Sv~~i~dG~~~~~l~~  204 (424)
                      |++.++..-||    |.|   =|||--+=.+.-...-+-.....++++  ||  ||-.--=..+.-.+-++|=.=++++|
T Consensus        99 A~~~V~A~rYP----P~G---iRGVGSALARASrwNrIp~Ylq~AdeeiClLlQVEtr~al~NL~~Ia~VeGVDGVFiGP  171 (249)
T TIGR02311        99 AEAAVKATRYP----PKG---IRGVGSALARASRWNRIPDYLQQADEEICLLLQVETREALENLEEIAAVEGVDGVFIGP  171 (249)
T ss_pred             HHHHHHHHCCC----CCC---CCCCHHHHHHHHHCCCHHHHHCCHHHHEEHHHHHHHHHHHHHHHHHHCCCCCCCEEECC
T ss_conf             99999850695----195---13400787763221761257605213202323265799886215775017866247571


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             00011135665444443443000
Q gi|254780206|r  205 ARDHKRIHDGDIGPNTGGMGACS  227 (424)
Q Consensus       205 ~~dyKr~~~~d~GpnTGGMGa~~  227 (424)
                      +         |.   .+-||..-
T Consensus       172 A---------DL---aasmGH~G  182 (249)
T TIGR02311       172 A---------DL---AASMGHLG  182 (249)
T ss_pred             H---------HH---HHHCCCCC
T ss_conf             2---------44---34015688


No 328
>PRK07411 hypothetical protein; Validated
Probab=56.51  E-value=14  Score=16.85  Aligned_cols=66  Identities=17%  Similarity=0.055  Sum_probs=36.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEE-CCCHHHHHCCEEEECC-----CCCHHHHHHHHHHHCCCEEEE
Q ss_conf             589988658899999999858996789995-4983575117055128-----789899999998718979999
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSI-PGNPGIAQHAQCVAID-----IQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~-pgN~g~~~~~~~~~i~-----~~d~~~i~~~a~~~~iDlviv   68 (424)
                      +|||+|-||=--.++.-|..+. +-++-++ ++.-....+...+...     ....+...+..++.+++.-|.
T Consensus        40 ~VlvvG~GGLG~p~~~yLaaaG-vG~i~ivD~D~ve~sNL~RQ~l~~~~~vG~~K~~~a~~~l~~lnp~~~i~  111 (390)
T PRK07411         40 SVLCIGTGGLGSPLLLYLAAAG-IGRIGIVDFDIVDSSNLQRQVIHGTSWVGKPKIESAKNRILEINPYCQVD  111 (390)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCCCCCCCCCCHHCCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             7899888723799999999838-97599974899462347854366620079718999999999868986421


No 329
>TIGR00504 pyro_pdase pyrrolidone-carboxylate peptidase; InterPro: IPR000816   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad .    This group of cysteine peptidases belong to MEROPS peptidase family C15 (pyroglutamyl peptidase I, clan CF). The type example being pyroglutamyl peptidase I of Bacillus amyloliquefaciens.    Pyroglutamyl/pyrrolidone carboxyl peptidase (Pcp or PYRase) is an exopeptidase that hydrolytically removes the pGlu from pGlu-peptides or pGlu-proteins , . PYRase has been found in prokaryotes and eukaryotes where at least two different classes have been characterised: the first containing bacterial and animal type I PYRases, and the second containing animal type II and serum PYRases. Type I and bacterial PYRases are soluble enzymes, while type II PYRases are membrane-bound. The primary application of PYRase has been its utilisation for protein or peptide sequencing, and bacterial diagnosis . The conserved residues Cys-144 and His-168 have been identified by inhibition and mutagenesis studies , .; GO: 0004219 pyroglutamyl-peptidase I activity, 0006508 proteolysis.
Probab=56.47  E-value=14  Score=16.96  Aligned_cols=88  Identities=24%  Similarity=0.299  Sum_probs=48.8

Q ss_pred             CCHHHHHHHHHHHCCCEEEE-C---------CCHHHHHHHHHHHHHCCCCEE-------------ECCHHHHHHHHCCHH
Q ss_conf             89899999998718979999-7---------955787489989860588067-------------010666555201023
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVVV-G---------PELPLVNGISDALNAAGFKVF-------------GPSQRAAKLESSKSF  105 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlviv-g---------pE~pL~~gi~d~l~~~gi~v~-------------Gp~~~aa~le~sK~~  105 (424)
                      +-.+.+.+...++++|+||. |         +|- ++.-+.|+ +..|||=.             ||-+..+.|=..+ .
T Consensus        47 ~A~~~l~~~i~~~~P~~vI~~G~~PGR~~IsvER-vA~N~~DA-RryGipDn~G~qp~De~~~~~GPaAYfat~Pvr~-m  123 (220)
T TIGR00504        47 EALEALRQAIDEVEPDIVIALGLAPGRSQISVER-VAINLNDA-RRYGIPDNEGEQPIDEPIVPDGPAAYFATLPVRA-M  123 (220)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHH-HHHHHHHH-CCCCCCCCCCCCCCCCCCCCCCCCEEECCCCHHH-H
T ss_conf             9999999999850954488515767987650888-87735762-0357887888868887568888720543270899-9


Q ss_pred             HHHHHHHHHHHCCCCCCCC----CCH--HHHHHHHCCCCEE
Q ss_conf             5788876531011112234----401--1111210124202
Q gi|254780206|r  106 AKKFCTKYGIPTATYQHFS----DPM--KAKQYVQNKSMPI  140 (424)
Q Consensus       106 ~K~~l~~~gIPt~~~~~~~----~~~--ea~~~~~~~g~Pv  140 (424)
                      . +-|+|+|||-.-+.++-    |+-  -.+..+.+.|+|+
T Consensus       124 v-~~mk~~GipA~vS~tAGTFvCN~~~Yl~lh~~A~~G~p~  163 (220)
T TIGR00504       124 V-KAMKKAGIPAAVSYTAGTFVCNYLMYLLLHHLAQKGLPV  163 (220)
T ss_pred             H-HHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             9-999866997212235347899999999999874058971


No 330
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=56.10  E-value=15  Score=16.80  Aligned_cols=15  Identities=13%  Similarity=0.463  Sum_probs=6.1

Q ss_pred             HHHHHHHHCCCEEEE
Q ss_conf             999998718979999
Q gi|254780206|r   54 IIHFCQEKHIDLVVV   68 (424)
Q Consensus        54 i~~~a~~~~iDlviv   68 (424)
                      +++...+.++|.+|+
T Consensus        50 ~~~~l~~~~vdGiI~   64 (268)
T cd06277          50 LPSFLEDGKVDGIIL   64 (268)
T ss_pred             HHHHHHHCCCCEEEE
T ss_conf             999999489878999


No 331
>PRK09982 universal stress protein UspD; Provisional
Probab=55.98  E-value=11  Score=17.61  Aligned_cols=44  Identities=14%  Similarity=0.153  Sum_probs=24.6

Q ss_pred             HHCCHHHHHHHHHHHHHCCCCCCCC-C-CHHHHHHHHCCCCEEEEE
Q ss_conf             2010235788876531011112234-4-011111210124202563
Q gi|254780206|r  100 ESSKSFAKKFCTKYGIPTATYQHFS-D-PMKAKQYVQNKSMPIVVK  143 (424)
Q Consensus       100 e~sK~~~K~~l~~~gIPt~~~~~~~-~-~~ea~~~~~~~g~PvVVK  143 (424)
                      |.++.++++|..+.+-|.....+.+ + .+++..++++.+.-+||=
T Consensus        64 e~~~~~L~~L~~~~~YPI~~~~v~~Gdl~~~L~~~v~~~~iDLlIc  109 (142)
T PRK09982         64 NKSDNKLYKLTKNIQWPKTKLRIERGEMPETLLEIMQKEQCDLLVC  109 (142)
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCHHHHHHHHHHHHCCCEEEE
T ss_conf             9999999999984799824789984488999999999849988996


No 332
>PRK06953 short chain dehydrogenase; Provisional
Probab=55.92  E-value=15  Score=16.78  Aligned_cols=65  Identities=17%  Similarity=0.276  Sum_probs=41.3

Q ss_pred             CEE-EEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH-HH----CCEEEECCCCCHHHHHHHHHHH---CCCEEE
Q ss_conf             958-998865-8899999999858996789995498357-51----1705512878989999999871---897999
Q gi|254780206|r    1 MRV-LLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI-AQ----HAQCVAIDIQNHSAIIHFCQEK---HIDLVV   67 (424)
Q Consensus         1 MkI-LviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~-~~----~~~~~~i~~~d~~~i~~~a~~~---~iDlvi   67 (424)
                      ||+ ||.|+. |--.|+++.|.+...  +|+..--|+.. ..    ..+.+..|..|.+++..++.+.   .+|..|
T Consensus         1 MK~~LVTGas~GIG~a~a~~la~~G~--~V~~~~R~~~~l~~l~~~~~~~~~~Dv~d~~~v~~~~~~~~~~~ldili   75 (222)
T PRK06953          1 MKTVLIVGASRGIGLEFVRQYRADGW--RVIATARDAAGLAALRALGAEALALDVADPESIAGLGWKLDGEALDAAV   75 (222)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCCEEE
T ss_conf             99999947572999999999998889--9999968888899988421517774058999999999862367767899


No 333
>COG2740 Predicted nucleic-acid-binding protein implicated in transcription termination [Transcription]
Probab=55.51  E-value=12  Score=17.36  Aligned_cols=44  Identities=18%  Similarity=0.224  Sum_probs=31.8

Q ss_pred             CCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             34401111121012420256304653430002323567788878
Q gi|254780206|r  123 FSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI  166 (424)
Q Consensus       123 ~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~  166 (424)
                      -....+++.++..-+--+++=|.+..-|||.+|+.+.+.+..+.
T Consensus        17 ~~~k~eLlR~v~~~eg~v~~d~~~k~~GRGaYv~~~~~~~~~a~   60 (95)
T COG2740          17 RGPKKELLRFVAVKEGEVVIDPTGKLPGRGAYVCPDRECIEKAK   60 (95)
T ss_pred             CCCHHHEEEEEECCCCEEEECCCCCCCCCEEEEECCHHHHHHHH
T ss_conf             06865838999648980787655677896389837789999999


No 334
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Probab=55.13  E-value=15  Score=16.69  Aligned_cols=28  Identities=25%  Similarity=0.477  Sum_probs=20.1

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEE
Q ss_conf             958998865889-9999999858996789
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSEL   28 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v   28 (424)
                      |||+|.|..||- .+++..+.+++...-+
T Consensus         1 ikV~i~Ga~GrMG~~i~~~i~~~~~~~lv   29 (122)
T pfam01113         1 IKVAVVGASGRMGRELIKAILEAPDFELV   29 (122)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEE
T ss_conf             98999889887899999999858996899


No 335
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase; InterPro: IPR010110   This entry represents a clade of shikimate-5-dehydrogenases found in Corynebacterium, Mycobacteria and fungi. The fungal sequences are pentafunctional proteins known as AroM which contain the central five seven steps in the chorismate biosynthesis pathway. The Corynebacterium and Mycobacterial sequences represent the sole shikimate-5-dehydrogenases in species which otherwise have every enzyme of the chorismate biosynthesis pathway.; GO: 0004764 shikimate 5-dehydrogenase activity, 0005737 cytoplasm.
Probab=55.00  E-value=15  Score=16.68  Aligned_cols=41  Identities=10%  Similarity=0.129  Sum_probs=21.2

Q ss_pred             CHHHHHC---CEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             8357511---7055128789899999998718979999795578
Q gi|254780206|r   34 NPGIAQH---AQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus        34 N~g~~~~---~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      |.|..-+   .+...+...|.+++.+....-..+++=+.-.-||
T Consensus        25 n~gyeiLgLp~k~~~f~~~sa~elke~l~~~~~~fgGasVTiPl   68 (291)
T TIGR01809        25 NAGYEILGLPDKYDKFETESAEELKEVLSDFGKEFGGASVTIPL   68 (291)
T ss_pred             HHHHHHHCCCCHHHHHHHCCHHHHHHHHHCCCCCCCEEEEECCH
T ss_conf             89999834840454443204786479870578652117886303


No 336
>PRK12749 quinate/shikimate dehydrogenase; Reviewed
Probab=54.76  E-value=15  Score=16.65  Aligned_cols=15  Identities=7%  Similarity=0.020  Sum_probs=5.5

Q ss_pred             CHHHHHHHHHHHCCC
Q ss_conf             989999999871897
Q gi|254780206|r   50 NHSAIIHFCQEKHID   64 (424)
Q Consensus        50 d~~~i~~~a~~~~iD   64 (424)
                      +++..++..+...+.
T Consensus        48 ~l~~~~~~l~~~~~~   62 (288)
T PRK12749         48 SFPGAIEGLKALKMR   62 (288)
T ss_pred             HHHHHHHHHHHCCCC
T ss_conf             899999998757998


No 337
>PTZ00137 2-Cys peroxiredoxin; Provisional
Probab=54.75  E-value=10  Score=17.86  Aligned_cols=61  Identities=26%  Similarity=0.232  Sum_probs=31.9

Q ss_pred             CEEEECCCHHH-HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             79999795578-7489989860588067010666555201023578887653101111223440
Q gi|254780206|r   64 DLVVVGPELPL-VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDP  126 (424)
Q Consensus        64 DlvivgpE~pL-~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~  126 (424)
                      |++.+.|.+-. .+...+.|++.|..++|-|.++.  ++.+.|.+.--++.|+-..+|-.++|.
T Consensus        44 dFT~VCttEl~~~~~~~~eF~~~~~~v~giS~Ds~--~sH~aW~~~~~~~~gi~~i~fPllaD~  105 (194)
T PTZ00137         44 DFTFVCPSELLGFSKRLDEFEERNVKVLGCSVDSK--FSHLAWKKTDLRKGGVGNLKHPLFSDI  105 (194)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCH--HHHHHHHHCHHHHCCCCCCCCCEEECC
T ss_conf             78875508999999999999975988999967838--889999623486588677334456367


No 338
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional
Probab=54.67  E-value=15  Score=16.64  Aligned_cols=51  Identities=14%  Similarity=0.146  Sum_probs=31.8

Q ss_pred             CEEEEECCCH-HHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECC
Q ss_conf             9589988658-899999999858996789995498357511705512878989999999871897999979
Q gi|254780206|r    1 MRVLLIGSGG-REHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGP   70 (424)
Q Consensus         1 MkILviGsGg-rEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgp   70 (424)
                      ||||+|-.-- --..|+..|.+...  .|+.+                 .+.++..++++++.+|++++..
T Consensus         1 mkILlVEDd~~~~~~l~~~L~~~g~--~V~~a-----------------~~~~ea~~~~~~~~~DlvilDi   52 (222)
T PRK10643          1 MKILIVEDDTLLLQGLILAAQTEGY--ACDGV-----------------STAREAEQSLESGHYSLVVLDL   52 (222)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCC--EEEEE-----------------CCHHHHHHHHHHCCCCEEEEEC
T ss_conf             9799992889999999999997899--99998-----------------9999999999748998999968


No 339
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase. Members of this family are the methionine salvage enzyme MnxX, a member of the HAD-superfamily hydrolases, subfamily IB (see TIGR01488). Members are found in Bacillus subtilis and related species, paired with MtnW (TIGR03332). In most species that recycle methionine from methylthioadenosine, the single protein MtnC replaces the MtnW/MtnX pair. In B. subtilis, mtnX was first known as ykrX.
Probab=54.55  E-value=13  Score=17.14  Aligned_cols=17  Identities=24%  Similarity=0.393  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHCCCEEE
Q ss_conf             89999999871897999
Q gi|254780206|r   51 HSAIIHFCQEKHIDLVV   67 (424)
Q Consensus        51 ~~~i~~~a~~~~iDlvi   67 (424)
                      +.+.+++|+++++.++|
T Consensus        75 F~eF~~~~~~~~ip~~I   91 (214)
T TIGR03333        75 FREFVAFINEHGIPFYV   91 (214)
T ss_pred             HHHHHHHHHHCCCCEEE
T ss_conf             99999999985997899


No 340
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]
Probab=54.33  E-value=16  Score=16.60  Aligned_cols=31  Identities=32%  Similarity=0.509  Sum_probs=25.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEE
Q ss_conf             9589988658899999999858996789995
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSI   31 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~   31 (424)
                      |||.|||+|+--.|||..|.+......+|.-
T Consensus         2 ~kI~ViGaGswGTALA~~la~ng~~V~lw~r   32 (329)
T COG0240           2 MKIAVIGAGSWGTALAKVLARNGHEVRLWGR   32 (329)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             6189981783799999999966984699962


No 341
>PRK05805 phosphate butyryltransferase; Validated
Probab=54.23  E-value=16  Score=16.59  Aligned_cols=74  Identities=14%  Similarity=0.155  Sum_probs=51.5

Q ss_pred             CCCHHHHHHHHHHHCCC-EEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             78989999999871897-99997955787489989860588067010666555201023578887653101111223440
Q gi|254780206|r   48 IQNHSAIIHFCQEKHID-LVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDP  126 (424)
Q Consensus        48 ~~d~~~i~~~a~~~~iD-lvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~  126 (424)
                      +.+++.+++-+++.++. .+++..|+|-+..=+..+.+.|+-.  |-     |-+++..-++.+++.|+....+..++..
T Consensus         2 i~~~~~i~~~ak~~~pkrIv~~eg~d~rvl~AA~~~~~~gia~--pI-----LiG~~~~I~~~~~~~gl~l~~~eiid~~   74 (301)
T PRK05805          2 IKNFDEILSKAKEQGPKTISVAVAQDEPVLEAVKEAKELGIAN--AI-----LVGDEEKIKEIAKEIGMDLEDFEIIDEK   74 (301)
T ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHCCCEE--EE-----EECCHHHHHHHHHHCCCCCCCCEEECCC
T ss_conf             3549999999862798969990899979999999999879979--99-----9859999999999879996667773564


Q ss_pred             HH
Q ss_conf             11
Q gi|254780206|r  127 MK  128 (424)
Q Consensus       127 ~e  128 (424)
                      ++
T Consensus        75 ~~   76 (301)
T PRK05805         75 DN   76 (301)
T ss_pred             CH
T ss_conf             62


No 342
>pfam00148 Oxidored_nitro Nitrogenase component 1 type Oxidoreductase.
Probab=54.17  E-value=16  Score=16.59  Aligned_cols=91  Identities=10%  Similarity=0.062  Sum_probs=48.2

Q ss_pred             HHHHHHHHHHCCCEEEECCC--HHH----HHHHHHHHHHC-CCCEEE---CCHHHHHHHHCCHHHHHHHHHHH----HHC
Q ss_conf             99999998718979999795--578----74899898605-880670---10666555201023578887653----101
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPE--LPL----VNGISDALNAA-GFKVFG---PSQRAAKLESSKSFAKKFCTKYG----IPT  117 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE--~pL----~~gi~d~l~~~-gi~v~G---p~~~aa~le~sK~~~K~~l~~~g----IPt  117 (424)
                      +.|.+..++.+++++++-+.  .-+    ..+++..++.. |+|++-   |.-.....++-....+.+++..-    -+.
T Consensus        64 ~~i~~~~~~~~p~~I~v~~tc~~eiIGdDi~~v~~~~~~~~~~~vi~v~~~gf~g~~~~G~~~a~~al~~~~~~~~~~~~  143 (398)
T pfam00148        64 EAIREADKRYKPKAIFVYTTCVSELIGDDIEAVAREAEEELGIPVIPVNTPGFGGSHSTGYDAALEALVEQLIGKPTGKK  143 (398)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCHHHHCCCHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99999997359978999756718872878899999988874993799867986666889999999999998343678889


Q ss_pred             C--------C-CCCCCCCHHHHHHHHCCCCEEEE
Q ss_conf             1--------1-12234401111121012420256
Q gi|254780206|r  118 A--------T-YQHFSDPMKAKQYVQNKSMPIVV  142 (424)
Q Consensus       118 ~--------~-~~~~~~~~ea~~~~~~~g~PvVV  142 (424)
                      .        . +..+.|..+.++.++.+|..+..
T Consensus       144 ~~~~VNlig~~~~~~~d~~ei~~ll~~~Gi~v~~  177 (398)
T pfam00148       144 EPGTVNIIGGFNLGPGDLREIKRLLEKLGIEVNA  177 (398)
T ss_pred             CCCCEEEECCCCCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             9981899888789956699999999983993578


No 343
>PRK07085 diphosphate--fructose-6-phosphate 1-phosphotransferase; Provisional
Probab=54.02  E-value=16  Score=16.57  Aligned_cols=94  Identities=19%  Similarity=0.270  Sum_probs=54.9

Q ss_pred             CEEEEECCCHHH---HHHHH----HHHHCCCCCEEEEEC-CCHHHH----------------------HCC-EEEEC-CC
Q ss_conf             958998865889---99999----998589967899954-983575----------------------117-05512-87
Q gi|254780206|r    1 MRVLLIGSGGRE---HALAW----KIAQSPLLSELWSIP-GNPGIA----------------------QHA-QCVAI-DI   48 (424)
Q Consensus         1 MkILviGsGgrE---hAl~~----~l~~s~~~~~v~~~p-gN~g~~----------------------~~~-~~~~i-~~   48 (424)
                      +||.|+=|||-.   |-..|    .|++-....++|=.- |-.|..                      .+. ....+ ..
T Consensus        73 lriGvvlsGgqAPGghNVI~Gl~d~lk~~n~~s~l~GF~~G~~Gl~~~~~~elt~~~i~~~rN~GGFd~lgs~r~ki~t~  152 (557)
T PRK07085         73 LKVGVILSGGQAPGGHNVIAGLFDGLKKFNPDSKLFGFIGGPLGLLNNKYIELTEEVIDEYRNTGGFDMIGSGRTKIETE  152 (557)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHCCCCEEEECHHHHHHHHCCCCCCEECCCCCCCCCH
T ss_conf             17999962799983788899999999976899779998777044406977994899999876288852430686545899


Q ss_pred             CCHHHHHHHHHHHCCC-EEEECCCHHH--HHHHHHHHHHCC--CCEEECCH
Q ss_conf             8989999999871897-9999795578--748998986058--80670106
Q gi|254780206|r   49 QNHSAIIHFCQEKHID-LVVVGPELPL--VNGISDALNAAG--FKVFGPSQ   94 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iD-lvivgpE~pL--~~gi~d~l~~~g--i~v~Gp~~   94 (424)
                      .+++...+.|++.+.| |||||-+...  ++=+++.|.+.+  +.|+|-++
T Consensus       153 e~~~~~~~t~~~l~LdgLviiGGd~sntnAa~LAEyf~~~~~~t~VIGvPk  203 (557)
T PRK07085        153 EQKEACLQTVKKLKLDGLVIIGGDDSNTNAAILAEYFAKHNCKTQVIGVPK  203 (557)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             999999999998599879997988721638999999998299837993352


No 344
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]
Probab=54.02  E-value=16  Score=16.57  Aligned_cols=80  Identities=16%  Similarity=0.197  Sum_probs=44.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHH--HHHHHCCCEEEECCCHHHHHHH
Q ss_conf             95899886588999999998589967899954983575117055128789899999--9987189799997955787489
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIH--FCQEKHIDLVVVGPELPLVNGI   78 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~--~a~~~~iDlvivgpE~pL~~gi   78 (424)
                      |+|+|+|-|.--..++..|++......++-...+.+....+...  +..|-- ..+  ..-...-|+||+.-.......+
T Consensus         4 ~~v~IvG~GliG~s~a~~l~~~g~~v~i~g~d~~~~~~~~a~~l--gv~d~~-~~~~~~~~~~~aDlVivavPi~~~~~~   80 (279)
T COG0287           4 MKVGIVGLGLMGGSLARALKEAGLVVRIIGRDRSAATLKAALEL--GVIDEL-TVAGLAEAAAEADLVIVAVPIEATEEV   80 (279)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHC--CCCHHH-CCCHHHHHCCCCCEEEEECCHHHHHHH
T ss_conf             48999877467799999999769847997247746778776635--853010-011555413569989995778899999


Q ss_pred             HHHHH
Q ss_conf             98986
Q gi|254780206|r   79 SDALN   83 (424)
Q Consensus        79 ~d~l~   83 (424)
                      .+.+.
T Consensus        81 l~~l~   85 (279)
T COG0287          81 LKELA   85 (279)
T ss_pred             HHHHC
T ss_conf             99863


No 345
>cd00763 Bacterial_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to a subfamily of the PFKA family (cd00363) and include bacterial ATP-dependent phosphofructokinases. These are allosrterically regulated homotetramers; the subunits are of about 320 amino acids.
Probab=53.68  E-value=16  Score=16.53  Aligned_cols=37  Identities=30%  Similarity=0.409  Sum_probs=17.8

Q ss_pred             HHHHHHHHHCCC-EEEECCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             999999871897-999979557874899898605880670
Q gi|254780206|r   53 AIIHFCQEKHID-LVVVGPELPLVNGISDALNAAGFKVFG   91 (424)
Q Consensus        53 ~i~~~a~~~~iD-lvivgpE~pL~~gi~d~l~~~gi~v~G   91 (424)
                      .+++..++++|| |+++|-+..+.  -+..|.+.++||+|
T Consensus        83 ~~~~~l~~~~Id~Li~IGGdgS~~--~a~~l~e~~i~vig  120 (317)
T cd00763          83 KAIEQLKKHGIDALVVIGGDGSYM--GAMRLTEHGFPCVG  120 (317)
T ss_pred             HHHHHHHHHCCCEEEEECCCHHHH--HHHHHHHCCCCEEE
T ss_conf             999999982999899956945899--99999974997797


No 346
>cd01980 Chlide_reductase_Y Chlide_reductase_Y : Y subunit of chlorophyllide (chlide) reductase (BchY).  Chlide reductase participates in photosynthetic pigment synthesis playing a role in the conversion of chlorophylls(Chl) into bacteriochlorophylls (BChl). Chlide reductase catalyzes the reduction of the B-ring of the tetrapyrolle. Chlide reductase is a three subunit enzyme (subunits are designated BchX, BchY and BchZ). The similarity between these three subunits and the subunits for nitrogenase suggests that BchX serves as an electron donor for the BchY-BchY catalytic subunits.
Probab=53.54  E-value=16  Score=16.52  Aligned_cols=39  Identities=15%  Similarity=0.318  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHCCCEEE-ECCCHHHHHHHHHHH---HHCCCCEE
Q ss_conf             9999999871897999-979557874899898---60588067
Q gi|254780206|r   52 SAIIHFCQEKHIDLVV-VGPELPLVNGISDAL---NAAGFKVF   90 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvi-vgpE~pL~~gi~d~l---~~~gi~v~   90 (424)
                      +.+.++++..+++.++ +|.=.+=+.|+...+   +..|++|+
T Consensus        81 ~~~~~ia~~~~~~~I~vigtC~~E~ig~~lell~~~~~gv~Ii  123 (416)
T cd01980          81 EAIRKLADPPAYTFIPVISLCVAETAGVAEELLPKQIDGVRVI  123 (416)
T ss_pred             HHHHHHHCCCCCCEEEEECCCCHHHHCCCHHHCHHHCCCCEEE
T ss_conf             9999860768888899965661765376743375551896599


No 347
>PRK07577 short chain dehydrogenase; Provisional
Probab=53.51  E-value=16  Score=16.51  Aligned_cols=64  Identities=19%  Similarity=0.201  Sum_probs=39.7

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHH----HCCCEEE
Q ss_conf             58998865-889999999985899678999549835751170551287898999999987----1897999
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE----KHIDLVV   67 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~----~~iDlvi   67 (424)
                      .+||-|++ |---|++..|.++..  +|+..-.|+--..-.+.+..|..|.+.+.++.++    ..||..|
T Consensus         5 ~alITGas~GIG~aia~~la~~G~--~Vv~~~r~~~~~~~~~~~~~D~~d~~~~~~~~~~~~~~~~id~LV   73 (234)
T PRK07577          5 TVLVTGATKGIGLALSLRLANLGH--QVIGIARSAIDDFPGELFACDLADIEQTAATLAQINEIHPVDAIV   73 (234)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             899937788899999999998799--999963475447897699995799999999999999769998999


No 348
>KOG0822 consensus
Probab=53.48  E-value=14  Score=17.02  Aligned_cols=10  Identities=10%  Similarity=0.607  Sum_probs=3.7

Q ss_pred             HHCCCEEEEC
Q ss_conf             7189799997
Q gi|254780206|r   60 EKHIDLVVVG   69 (424)
Q Consensus        60 ~~~iDlvivg   69 (424)
                      +.+.+.+|.|
T Consensus       259 ~~~a~~iI~~  268 (649)
T KOG0822         259 KVNAQIIILG  268 (649)
T ss_pred             HCCCCEEEEC
T ss_conf             1166389947


No 349
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component; InterPro: IPR014350   The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) ,  is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars.   The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC . These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).    The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.    An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose , , , .    According to structural and sequence analyses, the PTS EIIB domain (2.7.1.69 from EC) can be divided in five groups , , :  The PTS EIIB type 1 domain, which is found in the Glucose class of PTS, has an average length of about 80 amino acids. It forms a split alpha/beta sandwich composed of an antiparallel sheet (beta 1 to beta 4) and three alpha helices superimposed onto one side of the sheet. The phosphorylation site (Cys) is located at the end of the first beta strand on a protrusion formed by the edge of beta 1 and the reverse turn between beta 1 and beta 2 . The PTS EIIB type 2 domain, which is found in the Mannitol class of PTS, has an average length of about 100 amino acids. It consists of a four stranded parallel beta sheet flanked by two alpha helices (alpha 1 and 3) on one face and helix alpha 2 on the opposite face, with a characteristic Rossmann fold comprising two right-handed beta-alpha-beta motifs. The phosphorylation site (Cys) is located at the N-terminus of the domain, in the first beta strand.  The PTS EIIB type 3 domain, which is found in the Lactose class of PTS, has an average length of about 100 amino acids. It is composed of a central four-stranded parallel open twisted beta sheet, which is flanked by three alpha helices on the concave side and two on the convex side of the beta sheet. The phosphorylation site (Cys) is located in the C-terminal end of the first beta strand . The PTS EIIB type 4 domain, which is found in the Mannose class of PTS, has an average length of about 160 amino acids. It has a central core of seven parallel beta strands surrounded by a total of six alpha-helices. Three helices cover the front face, one the back face with the remaining two capping the central beta sheet at the top and bottom. The phosphorylation site (His) is located at the suface exposed loop between strand 1 and helix 1 .  The PTS EIIB type 5 domain, which is found in the Sorbitol class of PTS, has an average length of about 190 amino acids. The phosphorylation site (Cys) is located in the N-terminus of the domain.      The EIIB type 3 protein is often found downstream of EIIC type 3. This entry hits fewer proteins than IPR013012 from INTERPRO. .
Probab=53.48  E-value=16  Score=16.51  Aligned_cols=56  Identities=18%  Similarity=0.176  Sum_probs=33.0

Q ss_pred             HHHHHHHHHHCCCEEEE-CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             99999998718979999-795578748998986058806701066655520102357888765310
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVV-GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        52 ~~i~~~a~~~~iDlviv-gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP  116 (424)
                      ..+-+.|++.+++..+- +++.-    ..|.+....+=++||     |++..+.-+|+...+.|||
T Consensus        64 ~~l~k~A~~~~~~~~i~A~~~~~----~~e~~~~~d~VlLaP-----Q~~~~~~~lk~~t~~~Gip  120 (142)
T TIGR00853        64 NKLNKAAKEYGVPVKIAAVSYGA----AMEILDDADVVLLAP-----QVAYMLPDLKKETDKKGIP  120 (142)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCH----HHHHHHHHCEEEEHH-----HHHHHHHHHHHHCCCCCCC
T ss_conf             99999998459975888405763----443353504311203-----2675579999851358975


No 350
>pfam06973 DUF1297 Domain of unknown function (DUF1297). This family represents the C-terminus (approximately 200 residues) of a number of archaeal proteins of unknown function. One member is annotated as being a possible carboligase enzyme.
Probab=53.41  E-value=16  Score=16.50  Aligned_cols=106  Identities=20%  Similarity=0.270  Sum_probs=55.8

Q ss_pred             HHHHHHHHHHCCCCCEEEECC--CCCCCCCCCCCCCCCCCCC-------C---CC--C---CCCCCCEEECCCCCCCCCC
Q ss_conf             177788775205752344215--7763103520001113566-------5---44--4---4434430000123443222
Q gi|254780206|r  175 STVIIEEYLEGFEVSFFALCD--GKTAIPFTTARDHKRIHDG-------D---IG--P---NTGGMGACSPALGMSQELY  237 (424)
Q Consensus       175 ~~VliEefl~G~E~Sv~~i~d--G~~~~~l~~~~dyKr~~~~-------d---~G--p---nTGGMGa~~p~~~~~~~~~  237 (424)
                      +...||||+-|.-+-++-|..  -+++-.|..-+-|..--|+       |   .+  |   -||-    .|. .+-+++.
T Consensus        21 ~~a~IeEyv~G~~~~~~yFySpl~~~lEllg~D~R~esniDg~~Rlpa~~Ql~~~~~p~~vvvGn----~p~-vlRESLL   95 (188)
T pfam06973        21 EKARIEEYVIGAPFNFHYFYSPLKDRVELLGIDRRYESNLDGLVRLPAKQQLELNIEPTYVVVGN----IPA-VLRESLL   95 (188)
T ss_pred             HHCEEEEEECCCEEEEEEECCCCCCCEEEEECCCEEECCCHHHHCCCCHHHHHCCCCCCEEEECC----CCC-EEEHHHH
T ss_conf             01267666337546654410300063236631110232603442288277861689860799888----431-4407657


Q ss_pred             EEEECCHHHHHHHHHHHC-CCEEEEEEEEEEEEECCE-EEEEEEEEEE-CCC
Q ss_conf             010000089999986204-623566445448985570-4899988651-477
Q gi|254780206|r  238 STVIQKIILPTIEGMQKE-QNPFQGVLFAGLMITEQG-PYLIEYNVRF-GDP  286 (424)
Q Consensus       238 ~~i~~~i~~~~~~~l~~~-~~~y~G~l~~~~m~t~~g-p~viE~N~R~-GDP  286 (424)
                      .++.+ .=+..+++.+++ .-...|.+..+.++|++. -+|-|+.+|. |.|
T Consensus        96 ~~vfe-~ge~fV~ask~l~~PG~iGPFcLq~ivt~dle~vvFevS~RI~ggt  146 (188)
T pfam06973        96 EKVFE-MGEKFVEASKELVPPGIIGPFCLQSIVTDDLEFVVFEVSARIVGGT  146 (188)
T ss_pred             HHHHH-HHHHHHHHHHHHCCCCCCCCCEEEEEECCCCEEEEEEEECCCCCCC
T ss_conf             99999-9999999999856998613444667887986199999853004888


No 351
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated
Probab=53.41  E-value=16  Score=16.50  Aligned_cols=71  Identities=24%  Similarity=0.268  Sum_probs=42.0

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHHH-
Q ss_conf             8998865-88999999998589967899954983575117055128789899999998718979999--7955787489-
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNGI-   78 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~gi-   78 (424)
                      ||||-++ ...|-|++.|++-..  .+.+.+             .|..+.+++    ++.++|.+|.  ||..|-.+|. 
T Consensus         2 ILlIDn~DsFT~ni~~~l~~~g~--~~~v~~-------------~d~~~~~~i----~~~~pd~IiLSpGPg~p~~~~~~   62 (195)
T PRK07649          2 ILMIDNYDSFTYNLVQYLGELGQ--ELVVKR-------------NDEVTISDI----ENMKPDFLMISPGPCSPNEAGIS   62 (195)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCC--EEEEEC-------------CCCCCHHHH----HHCCCCEEEECCCCCCHHHCCCC
T ss_conf             99995898079999999997899--799988-------------996899999----84198989988999995784761


Q ss_pred             ---HHHHHHCCCCEEECC
Q ss_conf             ---989860588067010
Q gi|254780206|r   79 ---SDALNAAGFKVFGPS   93 (424)
Q Consensus        79 ---~d~l~~~gi~v~Gp~   93 (424)
                         .+.+ ..++|++|=.
T Consensus        63 ~~~~~~~-~~~iPILGIC   79 (195)
T PRK07649         63 MEVIRYF-AGKIPIFGVC   79 (195)
T ss_pred             HHHHHHH-CCCCCEEEEC
T ss_conf             4679975-2899784302


No 352
>PRK10586 hypothetical protein; Provisional
Probab=53.38  E-value=16  Score=16.50  Aligned_cols=39  Identities=15%  Similarity=0.295  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHCCCEEE-ECCCHHH--HHHHHHHHHHCCCCEEE-CC
Q ss_conf             89999999871897999-9795578--74899898605880670-10
Q gi|254780206|r   51 HSAIIHFCQEKHIDLVV-VGPELPL--VNGISDALNAAGFKVFG-PS   93 (424)
Q Consensus        51 ~~~i~~~a~~~~iDlvi-vgpE~pL--~~gi~d~l~~~gi~v~G-p~   93 (424)
                      ++.+.+.+.+ +.|.|| +|--..+  +..+++.   .++|++- ||
T Consensus        76 i~rl~~~~~~-~~d~IigvGGGK~iDtaK~vA~~---~~~pvv~vPT  118 (362)
T PRK10586         76 VAQLAAESGD-DRQVVIGVGGGALLDTAKALARR---LGLPFVAIPT  118 (362)
T ss_pred             HHHHHHHHCC-CCCEEEEECCCHHHHHHHHHHHH---CCCCEEEEEC
T ss_conf             9999997355-88789995571999999999998---1999899605


No 353
>PRK06398 aldose dehydrogenase; Validated
Probab=53.28  E-value=16  Score=16.49  Aligned_cols=63  Identities=21%  Similarity=0.329  Sum_probs=39.3

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCC-HHHHHCCEEEECCCCCHHHHHHHHHHH-----CCCEEE
Q ss_conf             8998865-8899999999858996789995498-357511705512878989999999871-----897999
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGN-PGIAQHAQCVAIDIQNHSAIIHFCQEK-----HIDLVV   67 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN-~g~~~~~~~~~i~~~d~~~i~~~a~~~-----~iDlvi   67 (424)
                      +||-|++ |--.|++.+|.+...  +|+++.-+ +......+.+..|.+|.+++.+++.+.     ++|..|
T Consensus         9 alVTGgs~GIG~aia~~la~~Ga--~V~~~~~~~~~~~~~~~~i~~Dvt~~~~v~~~v~~~~~~~G~iDiLV   78 (256)
T PRK06398          9 VIVTGGSSGIGLAIVSRFVDEGS--KVVSISRSEPEDINKSDHIKCDVTNEDEVKNAINEISKKYGRIDVLV   78 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCC--EEEEEECCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99968787899999999998699--99999487512517223898547999999999999999839997999


No 354
>PRK00048 dihydrodipicolinate reductase; Provisional
Probab=53.23  E-value=16  Score=16.48  Aligned_cols=29  Identities=21%  Similarity=0.241  Sum_probs=19.9

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEE
Q ss_conf             958998865889-99999998589967899
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELW   29 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~   29 (424)
                      |||.|.|.-||- .+|+..+.+++...-+.
T Consensus         3 ikI~i~Ga~GrMG~~i~~~i~~~~~~~l~~   32 (265)
T PRK00048          3 IKVGVAGASGRMGRELIEAVEAAEDLELVA   32 (265)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             599998888877999999998689979999


No 355
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445    This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria. Members are typically encoded next to a gene that encodes a glucose-1-phosphate cytidylyltransferase, which produces the substrate CDP-D-glucose. This is used by the proteins in this entry to produce CDP-4-keto-6-deoxyglucose..
Probab=53.01  E-value=7.7  Score=18.84  Aligned_cols=32  Identities=22%  Similarity=0.213  Sum_probs=24.7

Q ss_pred             EECCCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             51287898999999987189799997955787
Q gi|254780206|r   44 VAIDIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus        44 ~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      +.-|++|.++|.+++++.+||.||==--.|||
T Consensus        63 ~~gDIrD~~~L~~~~~~~~PeIvFHlAAQPLV   94 (361)
T TIGR02622        63 IFGDIRDAAKLEKAIAEFKPEIVFHLAAQPLV   94 (361)
T ss_pred             EEECCCCHHHHHHHHHHCCCCEEEHHHHHHHH
T ss_conf             33032327899999997289898333542788


No 356
>PRK05637 anthranilate synthase component II; Provisional
Probab=52.78  E-value=17  Score=16.43  Aligned_cols=72  Identities=19%  Similarity=0.201  Sum_probs=41.0

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHH
Q ss_conf             958998865-88999999998589967899954983575117055128789899999998718979999--795578748
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNG   77 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~g   77 (424)
                      +|||+|-+. ...|-|++-|.....  ++.+.+ |             ..+.+++    ++.++|.+|+  ||-.|--+|
T Consensus         2 ~~ILlIDnyDSFT~Nl~~~l~~~g~--~v~V~r-n-------------~~~~~~~----~~~~pd~ivlSPGPg~P~d~g   61 (208)
T PRK05637          2 THVVLIDNHDSFVYNLVDAFAVAGY--KCTVFR-N-------------TVPVETI----LAANPDLICLSPGPGYPADAG   61 (208)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCC--EEEEEE-C-------------CCCHHHH----HHCCCCEEEECCCCCCHHHCC
T ss_conf             7799994889759999999986799--079996-9-------------9999999----851999599999999957775


Q ss_pred             HH-HHHHH--CCCCEEEC
Q ss_conf             99-89860--58806701
Q gi|254780206|r   78 IS-DALNA--AGFKVFGP   92 (424)
Q Consensus        78 i~-d~l~~--~gi~v~Gp   92 (424)
                      .. +.++.  ..+|++|-
T Consensus        62 ~~~~~~~~~~~~iPILGI   79 (208)
T PRK05637         62 NMMALIERTLGQIPLLGI   79 (208)
T ss_pred             CHHHHHHHHHCCCCEEEH
T ss_conf             749999997356982211


No 357
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089   This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , . In most species this protein is bifunctional, existing as fused alpha-beta domains. In Pyrococcus and related species, however, the domains exist as separate polypeptides. This entry represents the alpha (N-terminal) domain. In Pyrococcus and related species there appears to have been the development of a paralogous family such that four other proteins are close relatives. One of these (along with its beta-domain partner) was characterised as ACS-II showing specificity for phenylacetyl-CoA . This entry excludes non-ACS-I paralogs. .
Probab=52.48  E-value=17  Score=16.40  Aligned_cols=104  Identities=19%  Similarity=0.292  Sum_probs=48.7

Q ss_pred             EEEEECCCH----HHHHHHHHHHHCCCCCEEEEECCCHH-HHHC-CEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             589988658----89999999985899678999549835-7511-70551287898999999987189799997955787
Q gi|254780206|r    2 RVLLIGSGG----REHALAWKIAQSPLLSELWSIPGNPG-IAQH-AQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         2 kILviGsGg----rEhAl~~~l~~s~~~~~v~~~pgN~g-~~~~-~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
                      .|-|||-=-    +=|++..-|.++..--+||=.+-+.+ .-.. -+|++ ++.+.       ....|||+|+---+-++
T Consensus         9 SvAVIGAS~~~gKVGy~i~~NL~~~Gy~G~~YPVNpk~~i~i~Gr~k~Y~-~~~~~-------dP~~VDLAVivvPa~~v   80 (457)
T TIGR02717         9 SVAVIGASRDEGKVGYAIMKNLIEGGYKGKIYPVNPKAGIEILGRVKAYP-SVLEI-------DPDEVDLAVIVVPAKLV   80 (457)
T ss_pred             CEEEECCCCCCCCCCHHHHEEEECCCCEEEEEEECCCCCEEEEECCCCCC-CHHHC-------CCCCCCEEEEECCHHHH
T ss_conf             15897124889851002200000378303687622788714630114578-71114-------89973479997285679


Q ss_pred             HHHHHHHHHCCCCEE-----E---CCHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             489989860588067-----0---1066655520102357888765310
Q gi|254780206|r   76 NGISDALNAAGFKVF-----G---PSQRAAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~-----G---p~~~aa~le~sK~~~K~~l~~~gIP  116 (424)
                      -.+++.+-+.|++-.     |   ...+.++|| +|.  ++.++|+|++
T Consensus        81 p~v~eECG~KGVkg~vvI~AGF~E~G~eG~~LE-~~l--~~~a~kYg~R  126 (457)
T TIGR02717        81 PQVVEECGEKGVKGAVVITAGFKEVGEEGAELE-QKL--VEIARKYGMR  126 (457)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHH-HHH--HHHHHHCCCE
T ss_conf             999999861795189997148645316789999-999--9999767881


No 358
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Many archaeal species lack cysteinyl-tRNA synthetase, an essential enzyme that provides Cys-tRNA(Cys) in other organisms. Instead, in a two step pathway, tRNA-Cys is acylated with O-phosphoserine (Sep) to form Sep-tRNA(Cys), which is subsequently converted to Cys-tRNA(Cys) . This pathway is also thought to function as the sole route of cysteine biosynthesis in these organisms. Several other archaeal species use both this pathway and direct tRNA(Cys) aminoacylation to synthesize Cys-tRNA(Cys), but this pathway appears to be the only route for cysteine biosynthesis. Proteins in this entry catalyse the second step in this pathway using pyridoxal phosphate and a sulphur donor to synthesize Cys from Sep while attached to the tRNA..
Probab=52.38  E-value=17  Score=16.39  Aligned_cols=82  Identities=16%  Similarity=0.253  Sum_probs=44.5

Q ss_pred             ECCCHHH------HHHHHHHHHCCCCCEEEEECCCHHHHHC------------------CEEEECCCCCHHHHHHHHHHH
Q ss_conf             8865889------9999999858996789995498357511------------------705512878989999999871
Q gi|254780206|r    6 IGSGGRE------HALAWKIAQSPLLSELWSIPGNPGIAQH------------------AQCVAIDIQNHSAIIHFCQEK   61 (424)
Q Consensus         6 iGsGgrE------hAl~~~l~~s~~~~~v~~~pgN~g~~~~------------------~~~~~i~~~d~~~i~~~a~~~   61 (424)
                      +=.|+||      ||||    +..   .+.|+.+|++....                  ...+.+++.....+++=..+.
T Consensus        72 ~t~GARe~KfaVMhalC----~~G---D~vV~D~~AHYtsyvAAEragl~v~eVPy~~g~P~Y~v~~e~Y~~viee~~d~  144 (381)
T TIGR02539        72 VTHGAREGKFAVMHALC----KEG---DVVVLDGLAHYTSYVAAERAGLNVKEVPYETGHPEYKVDPEGYKEVIEEVEDE  144 (381)
T ss_pred             CCCCCCHHHHHHHHHHC----CCC---CEEEECCCCCHHHHHHHHHCCCEEEECCCCCCCCEEEECHHHHHHHHHHHHCC
T ss_conf             06775024578876408----998---98998587454458999754972788165588860764166788888655202


Q ss_pred             ---CCCEEEE---CCC---HHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             ---8979999---795---57874899898605880670106
Q gi|254780206|r   62 ---HIDLVVV---GPE---LPLVNGISDALNAAGFKVFGPSQ   94 (424)
Q Consensus        62 ---~iDlviv---gpE---~pL~~gi~d~l~~~gi~v~Gp~~   94 (424)
                         ++-|++.   -.|   -+=+.++++..++.|+|.+=-.+
T Consensus       145 ~G~~~~LallThvDG~YGNL~DA~kva~vc~~~gvPlLLNCA  186 (381)
T TIGR02539       145 SGKPVALALLTHVDGEYGNLADAKKVAKVCREKGVPLLLNCA  186 (381)
T ss_pred             CCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEECCC
T ss_conf             798834899840268867511245687665420786221245


No 359
>cd03110 Fer4_NifH_child This protein family's function is unkown. It contains nucleotide binding site. It uses NTP as energy source to transfer electron or ion.
Probab=52.35  E-value=17  Score=16.39  Aligned_cols=18  Identities=39%  Similarity=0.682  Sum_probs=8.7

Q ss_pred             EEEEE-CCCH--HH---HHHHHHH
Q ss_conf             58998-8658--89---9999999
Q gi|254780206|r    2 RVLLI-GSGG--RE---HALAWKI   19 (424)
Q Consensus         2 kILvi-GsGg--rE---hAl~~~l   19 (424)
                      ||.|. |.||  ..   -+||.++
T Consensus         1 kIaV~SgKGGVGKTT~a~nLA~~l   24 (179)
T cd03110           1 QIAVISGKGGTGKTTVTAALAALL   24 (179)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHC
T ss_conf             989995899860999999999974


No 360
>cd01979 Pchlide_reductase_N Pchlide_reductase_N: N protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase. Pchlide reductase catalyzes the reductive formation of chlorophyllide (chlide) from protochlorophyllide (pchlide) during biosynthesis of chlorophylls and bacteriochlorophylls. This group contains both the light-independent Pchlide reductase (DPOR) and light-dependent Pchlide reductase (LPOR).  Angiosperms contain only LPOR, cyanobacteria, algae and gymnosperms contain both DPOR and LPOR, primitive anoxygenic photosynthetic bacteria contain only DPOR. NB is structurally similar to the FeMo protein of nitrogenase, forming an N2B2 heterotetramer. N and B are homologous to the FeMo alpha and beta subunits respectively. Also in common with nitrogenase in vitro DPOR activity requires ATP hydrolysis and dithoionite or ferredoxin as electron donor. The NB protein complex may serve as a catalytic site for Pchlide reduction similar to MoFe for nitrogen reduction.
Probab=51.83  E-value=17  Score=16.33  Aligned_cols=105  Identities=14%  Similarity=0.264  Sum_probs=45.1

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEEC--CCCCHHHHHHHHH----HHCCCEE-EEC--CCHH
Q ss_conf             89988658899999999858996789995498357511705512--8789899999998----7189799-997--9557
Q gi|254780206|r    3 VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAI--DIQNHSAIIHFCQ----EKHIDLV-VVG--PELP   73 (424)
Q Consensus         3 ILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i--~~~d~~~i~~~a~----~~~iDlv-ivg--pE~p   73 (424)
                      -||+|+=+=.|=     .||-.-.-+|--| .-+|+.+.+. ++  -..+.+++.+.+.    ++++-.+ ++|  |..-
T Consensus        29 fLVvG~~tCah~-----~q~a~Gvmifaep-Rf~ta~leE~-Dl~~~~~~~~eL~r~v~~i~~~r~p~~iFlvgtCpseV  101 (396)
T cd01979          29 FLVVGTKTCAHF-----LQNALGVMIFAEP-RFAMAELEEG-DLSALLNDYAELDRVVTQIKRDRNPSVIFLIGSCTTEV  101 (396)
T ss_pred             EEEECCCHHHHH-----HHHHHCCEEECCC-CCCCCCCCCH-HHHHCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHH
T ss_conf             364337506767-----6641024543574-3222304620-55423696699999999999748994799972585777


Q ss_pred             H---HHHHHHHHHH-CCCCEEECCHHHHHHHHCCHHHHHHHHHHHHH
Q ss_conf             8---7489989860-58806701066655520102357888765310
Q gi|254780206|r   74 L---VNGISDALNA-AGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP  116 (424)
Q Consensus        74 L---~~gi~d~l~~-~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIP  116 (424)
                      +   ..+++..|+. .|+||+  +..+.=||+.+.-.-+-+-++=+|
T Consensus       102 Ik~DLe~~A~rls~~~~v~Vv--~vs~sGiettFTQGEDa~LaAlvp  146 (396)
T cd01979         102 IKMDLEGAAPRLSAEIGVPIL--VASASGLDYTFTQGEDTVLAALVP  146 (396)
T ss_pred             HHHHHHHHHHHHHHCCCCEEE--EEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             752499998875326795599--952687547576799999999986


No 361
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. coli this enzyme (GarL, ) 2-dehydro-3-deoxyglucarate aldolase acts in the catabolism of several sugars including D-galactarate, D-glucarate and L-idarate. In fact, 5-dehydro-4-deoxy-D-glucarate aldolase is a synonym for this enzyme as it is unclear in the literature whether the enzyme acts on only one of these or, as seems likely, has no preference. (Despite the apparent large difference in substrate stucture indicated by their names, 2-DH-3DO- and 5-DH-4DO-glucarate differ only by the chirality of most central hydroxyl-bearing carbon and is alternately named 2-DH-3DO-galactarate.) The reported product of D-galactarate dehydratase (4.2.1.42) is the 5DH-4DO-glucarate isomer and this enzyme is found proximal to the aldolase in many genomes (GenProp0714) where no epimerase is known. Similarly, the product of D-glucarate dehydratase (4.2.1.40) is again the 5-DH-4DO isomer, so the provenance of the 2-DH-3DO-glucarate isomer for which
Probab=51.77  E-value=17  Score=16.33  Aligned_cols=87  Identities=14%  Similarity=0.135  Sum_probs=49.5

Q ss_pred             HHHHHHHHHHCCCEEEECCCH-HH----HHHHHHHHHHCCCCEEECCHHHHHHH-HCCHHHHHHHHH--HHHHCCCCCCC
Q ss_conf             999999987189799997955-78----74899898605880670106665552-010235788876--53101111223
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPEL-PL----VNGISDALNAAGFKVFGPSQRAAKLE-SSKSFAKKFCTK--YGIPTATYQHF  123 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE~-pL----~~gi~d~l~~~gi~v~Gp~~~aa~le-~sK~~~K~~l~~--~gIPt~~~~~~  123 (424)
                      ..+.+++-....|++++--|- |+    ..-+.-+.+..|.+.+      .|+- .+....+..|..  .||=.|   .+
T Consensus        23 p~~~Ei~a~~G~D~v~iD~EHg~~~~~~~~~~~~a~~~~g~~~i------VRvp~~~~~~i~~~LD~Ga~GiivP---~V   93 (249)
T TIGR03239        23 PITTEVLGLAGFDWLLLDGEHAPNDVLTFIPQLMALKGSASAPV------VRPPWNEPVIIKRLLDIGFYNFLIP---FV   93 (249)
T ss_pred             HHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCCE------EECCCCCHHHHHHHHCCCCCEEEEC---CC
T ss_conf             89999997189699998104489999999999999984699848------9799998789999970899878951---74


Q ss_pred             CCCHHHHHHHHCCCCEEEEEECCCCCCCCCC
Q ss_conf             4401111121012420256304653430002
Q gi|254780206|r  124 SDPMKAKQYVQNKSMPIVVKADGLCAGKGVV  154 (424)
Q Consensus       124 ~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~  154 (424)
                      ++.++|.++++...||    |.   |.||+.
T Consensus        94 ~t~eea~~~v~a~kyp----P~---G~Rg~~  117 (249)
T TIGR03239        94 ESAEEAERAVAATRYP----PE---GIRGVS  117 (249)
T ss_pred             CCHHHHHHHHHHHCCC----CC---CCCCCC
T ss_conf             5599999999973449----99---998887


No 362
>TIGR00097 HMP-P_kinase phosphomethylpyrimidine kinase; InterPro: IPR004399 Phosphomethylpyrimidine kinase (2.7.4.7 from EC), also known as HMP-phosphate kinase, catalyses the phosphorylation of HMP-P to HMP-PP in the reaction: ATP + 4-amino-2-methyl-5-phosphomethylpyrimidine = ADP + 4-amino-2-methyl-5-diphosphomethylpyrimidine during the biosynthesis of thiamine.; GO: 0008972 phosphomethylpyrimidine kinase activity, 0009228 thiamin biosynthetic process.
Probab=51.60  E-value=8.2  Score=18.62  Aligned_cols=145  Identities=21%  Similarity=0.252  Sum_probs=90.7

Q ss_pred             HHHHHHHHHHCCCEEEEC--CCHHHHHHHHHHHHHCCC--CEEE-C---CHHHHHHHHCCHHHHHHHHHHHHHCCCCCCC
Q ss_conf             999999987189799997--955787489989860588--0670-1---0666555201023578887653101111223
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVG--PELPLVNGISDALNAAGF--KVFG-P---SQRAAKLESSKSFAKKFCTKYGIPTATYQHF  123 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivg--pE~pL~~gi~d~l~~~gi--~v~G-p---~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~  123 (424)
                      +++...+.+..||-+=+|  .+.-++.-|+..|++..+  +++= |   ++..++|-.+-..  +.++++=+|-+.=-+ 
T Consensus        57 aQl~aV~~D~~~~a~KtGML~saeIve~Va~~l~~y~~~~~~VvDPVMVAksG~~Ll~~~a~--~~l~~~LLP~A~~~T-  133 (264)
T TIGR00097        57 AQLDAVLSDIKVDAVKTGMLASAEIVEAVAKKLREYDVQIPIVVDPVMVAKSGAALLEEEAV--EALKKRLLPLATLVT-  133 (264)
T ss_pred             HHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEEECCCEEECCCCCCCCHHHH--HHHHHHHCCCEEEEC-
T ss_conf             99999861089655886245670777866776540488303897672165287546547899--999997387114306-


Q ss_pred             CCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCHHHHHHH-HHH--CCCCCEEEECCCCCC
Q ss_conf             44011111210124202563046534300023235677888788751-44531777887-752--057523442157763
Q gi|254780206|r  124 SDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-QQINSTVIIEE-YLE--GFEVSFFALCDGKTA  199 (424)
Q Consensus       124 ~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~-~~~~~~VliEe-fl~--G~E~Sv~~i~dG~~~  199 (424)
                      =|.-||...+                  |..-++|.+|+.+|.+++. +-..+.|||=- -++  +.|.+++++.+|+.+
T Consensus       134 PN~pEAe~L~------------------g~~~I~~~~dm~~AAk~l~~~lG~~~vl~KGGHl~hf~~~~~~Dv~~~~~~~  195 (264)
T TIGR00097       134 PNLPEAEALL------------------GATKIRTEEDMIKAAKKLREELGPKAVLIKGGHLEHFGDEDAVDVLYDGGEI  195 (264)
T ss_pred             CCHHHHHHHC------------------CCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCEEEEECCEE
T ss_conf             8979999980------------------8966589899999999998851788089827734446777763168867838


Q ss_pred             C-CCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             1-0352000111356654444434430
Q gi|254780206|r  200 I-PFTTARDHKRIHDGDIGPNTGGMGA  225 (424)
Q Consensus       200 ~-~l~~~~dyKr~~~~d~GpnTGGMGa  225 (424)
                      . .|..    +|+-    .|||.|=||
T Consensus       196 ~~~l~~----~rI~----TkNTHGTGC  214 (264)
T TIGR00097       196 HFILKA----PRIE----TKNTHGTGC  214 (264)
T ss_pred             EEEEEC----CCCC----CCCCCCCHH
T ss_conf             999805----7558----788767112


No 363
>COG1378 Predicted transcriptional regulators [Transcription]
Probab=51.57  E-value=13  Score=17.15  Aligned_cols=70  Identities=20%  Similarity=0.246  Sum_probs=46.8

Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCC-CCCCCCCHHHHHHHHC-CCCEEEEEECCC
Q ss_conf             8998986058806701066655520102357888765310111-1223440111112101-242025630465
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT-YQHFSDPMKAKQYVQN-KSMPIVVKADGL  147 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~-~~~~~~~~ea~~~~~~-~g~PvVVKp~~~  147 (424)
                      .+...|++.|+.-.=.....+-+.....-++++.+..|||.|+ |.++.+.++ +-+++. -|-|-.-+|...
T Consensus         4 ~~~~~L~~lGlt~yEa~vY~aLl~~g~~tA~eis~~sgvP~~kvY~vl~sLe~-kG~v~~~~g~P~~y~av~p   75 (247)
T COG1378           4 ELEENLQKLGLTEYEAKVYLALLCLGEATAKEISEASGVPRPKVYDVLRSLEK-KGLVEVIEGRPKKYRAVPP   75 (247)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHCCCCCHHHHHHHHHHHH-CCCEEECCCCCCEEEECCH
T ss_conf             79999998199788999999999818877999998659993229999999987-8877840799844885799


No 364
>PRK10507 bifunctional glutathionylspermidine amidase/glutathionylspermidine synthetase; Provisional
Probab=51.52  E-value=11  Score=17.69  Aligned_cols=25  Identities=28%  Similarity=0.189  Sum_probs=14.3

Q ss_pred             CCCEEEEECCCC-----CCHHHHHHHHHCC
Q ss_conf             751044332654-----4115666542013
Q gi|254780206|r  286 PECQAMMMRLES-----DILEILNSCVHGN  310 (424)
Q Consensus       286 PE~q~ilp~L~~-----dl~~il~~~~~g~  310 (424)
                      ||+.++=|+=+.     -++++|.+..-+.
T Consensus       482 ~~v~v~EPlWK~IlSNKAILPlLW~~fP~H  511 (619)
T PRK10507        482 PEVLVFEPLWTVIPGNKAILPILWSLFPHH  511 (619)
T ss_pred             CCCEEECCCHHHHCCCCHHHHHHHHHCCCC
T ss_conf             772574431342425524889999867998


No 365
>PRK08099 nicotinamide-nucleotide adenylyltransferase; Provisional
Probab=51.47  E-value=12  Score=17.45  Aligned_cols=10  Identities=40%  Similarity=0.634  Sum_probs=6.3

Q ss_pred             HHHHHHHHHH
Q ss_conf             7888765310
Q gi|254780206|r  107 KKFCTKYGIP  116 (424)
Q Consensus       107 K~~l~~~gIP  116 (424)
                      |+++.+.+++
T Consensus       162 k~l~~~~~~~  171 (411)
T PRK08099        162 KAFMAEKGIQ  171 (411)
T ss_pred             HHHHHHCCCC
T ss_conf             9999733789


No 366
>PRK11517 transcriptional regulatory protein YedW; Provisional
Probab=51.43  E-value=17  Score=16.29  Aligned_cols=50  Identities=12%  Similarity=0.260  Sum_probs=29.2

Q ss_pred             CEEEEECCCHH-HHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             95899886588-9999999985899678999549835751170551287898999999987189799997
Q gi|254780206|r    1 MRVLLIGSGGR-EHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         1 MkILviGsGgr-EhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      ||||||-.--. -..|...|.+...  +|.++                 .|.++.++.+.++++|+++..
T Consensus         1 MkILiVEDd~~l~~~l~~~L~~~g~--~V~~a-----------------~~g~~al~~~~~~~~DlvilD   51 (223)
T PRK11517          1 MKILLIEDNQRTQEWVTQGLSEAGY--VIDAV-----------------SDGRDGLYLALKDDYALIILD   51 (223)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCC--EEEEE-----------------CCHHHHHHHHHCCCCCEEEEC
T ss_conf             9899996989999999999998899--99998-----------------999999999852899999984


No 367
>pfam06134 RhaA L-rhamnose isomerase (RhaA). This family consists of several bacterial L-rhamnose isomerase proteins (EC:5.3.1.14).
Probab=51.34  E-value=17  Score=16.28  Aligned_cols=88  Identities=15%  Similarity=0.191  Sum_probs=48.2

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEE---ECCCCCCCCCCC--HHHHHHHHHHHHHHHCCC-CH
Q ss_conf             102357888765310111122344011111210124202563---046534300023--235677888788751445-31
Q gi|254780206|r  102 SKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVK---ADGLCAGKGVVV--AATVDEATSAIDRCFQQI-NS  175 (424)
Q Consensus       102 sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVK---p~~~agGkGV~i--~~~~~e~~~~~~~~~~~~-~~  175 (424)
                      ||.. |+|.-+|++.+-+        =+..|.+++|-|+|.-   |||   .|-+-+  ..-+.-+.+.++++|... +.
T Consensus       149 D~~I-R~FWIeH~k~~R~--------Ia~~fg~~lg~~cv~NiWipDG---~KD~pvDR~~pR~Rl~~SLD~I~ae~~d~  216 (416)
T pfam06134       149 DKEI-RQFWIDHCKASRK--------ISEYFGKELGTPSLTNIWIPDG---YKDIPSDRLTPRKRLKEALDEVFSEKLDE  216 (416)
T ss_pred             CHHH-HHHHHHHHHHHHH--------HHHHHHHHHCCCCEEEEECCCC---CCCCCCCCHHHHHHHHHHHHHHHHCCCCH
T ss_conf             8789-9999999799999--------9999999849971355434887---76785210118999999899998542687


Q ss_pred             ---HHHHHHHHHCCCCCEEEECCCCCCCCCC
Q ss_conf             ---7778877520575234421577631035
Q gi|254780206|r  176 ---TVIIEEYLEGFEVSFFALCDGKTAIPFT  203 (424)
Q Consensus       176 ---~VliEefl~G~E~Sv~~i~dG~~~~~l~  203 (424)
                         .--||--|-|.-  +++.+-|.+=..|.
T Consensus       217 ~~~~daVEsKlFGIG--~EsytVGShEFy~g  245 (416)
T pfam06134       217 AYNLDAVESKLFGIG--AESYTVGSHEFYMG  245 (416)
T ss_pred             HHHHHHHHHHHHCCC--CEEEEECCHHHHHH
T ss_conf             650567767540144--20365151899989


No 368
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated
Probab=51.08  E-value=17  Score=16.25  Aligned_cols=85  Identities=18%  Similarity=0.262  Sum_probs=49.1

Q ss_pred             CEEEEECCC---HHHHHHHHHHHHCCCCCEEEEEC-CCHHHHHC--------CEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             958998865---88999999998589967899954-98357511--------7055128789899999998718979999
Q gi|254780206|r    1 MRVLLIGSG---GREHALAWKIAQSPLLSELWSIP-GNPGIAQH--------AQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         1 MkILviGsG---grEhAl~~~l~~s~~~~~v~~~p-gN~g~~~~--------~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      |||.|+|.-   |+|  |..-|.+-|.++-++++- .+.|...-        .....+...|.+.+     ..++|+++-
T Consensus         2 ~kVaIvGAtG~vG~e--li~lL~~hp~~ei~~las~~saGk~i~~~~p~l~~~~~~~~~~~~~~~~-----~~~~Divf~   74 (345)
T PRK00436          2 IKVAIVGASGYTGGE--LLRLLLNHPEVEIVYLTSRSSAGKPLSDLHPHLRGLVDLVLEPLDPEEI-----AAGADVVFL   74 (345)
T ss_pred             CEEEEECCCCHHHHH--HHHHHHCCCCCEEEEEECCCCCCCCHHHHCCCCCCCCCCEEEECCHHHH-----CCCCCEEEE
T ss_conf             199998966188999--9999980998679999757868973778581103777874764998894-----269999998


Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             795578748998986058806701
Q gi|254780206|r   69 GPELPLVNGISDALNAAGFKVFGP   92 (424)
Q Consensus        69 gpE~pL~~gi~d~l~~~gi~v~Gp   92 (424)
                      .-..-.+..++..+.++|++|+=-
T Consensus        75 alp~~~S~~~~~~~~~~g~~VID~   98 (345)
T PRK00436         75 ALPHGVSMELAPQLLEAGVKVIDL   98 (345)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             898389999999998669879989


No 369
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family. This family of proteins utilize NAD as a cofactor. The proteins in this family use nucleotide-sugar substrates for a variety of chemical reactions.
Probab=51.01  E-value=18  Score=16.24  Aligned_cols=63  Identities=19%  Similarity=0.223  Sum_probs=40.4

Q ss_pred             EEEECCCH-HHHHHHHHHHHCCCCCEEEEEC-CC-HHH----HHCCEEEECCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             89988658-8999999998589967899954-98-357----511705512878989999999871897999
Q gi|254780206|r    3 VLLIGSGG-REHALAWKIAQSPLLSELWSIP-GN-PGI----AQHAQCVAIDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus         3 ILviGsGg-rEhAl~~~l~~s~~~~~v~~~p-gN-~g~----~~~~~~~~i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      |||.|+-| --..|+..|.+...  +|...- .+ ...    ....+.+..|..|.+.+.++.++.++|.||
T Consensus         1 ILItGasGfiG~~l~~~L~~~g~--~v~~~~r~~~~~~~~~~~~~~~~~~~dl~~~~~~~~~~~~~~~D~Vi   70 (235)
T pfam01370         1 ILVTGGTGFIGSALVRRLLQEGY--EVIVLGRRRRSESLNTGRIRFRFHEGDLTDPDALERLLAEVQPDAVI   70 (235)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCC--EEEEEECCCCHHHHHHCCCCCEEEEEECCCHHHHHHHHHHCCCCEEE
T ss_conf             79972897999999999997879--89999899730122211467659996588999999998538998999


No 370
>cd00765 Pyrophosphate_PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to a subfamily of the PFKA family (cd00363) and include pyrophosphate-dependent phosphofructokinases. These are found in bacteria as well as plants. These may be dimeric nonallosteric enzymes as in bacteria or allosteric heterotetramers as in plants.
Probab=50.84  E-value=18  Score=16.23  Aligned_cols=94  Identities=20%  Similarity=0.330  Sum_probs=56.2

Q ss_pred             CEEEEECCCHHH---HHHH----HHHHHCCCCCEEEEECCCH-HHH----------------------HCC-EEEEC-CC
Q ss_conf             958998865889---9999----9998589967899954983-575----------------------117-05512-87
Q gi|254780206|r    1 MRVLLIGSGGRE---HALA----WKIAQSPLLSELWSIPGNP-GIA----------------------QHA-QCVAI-DI   48 (424)
Q Consensus         1 MkILviGsGgrE---hAl~----~~l~~s~~~~~v~~~pgN~-g~~----------------------~~~-~~~~i-~~   48 (424)
                      +||.|+=|||..   |-..    .+|++-..-..+|=.-|.| |..                      .+. -...| ..
T Consensus        73 l~vGvvlsGgqAPGGHNVI~Gl~d~lk~~n~~s~l~GF~~Gp~Gl~~~~~~eit~~~i~~yrN~GGfdmi~sgr~ki~t~  152 (550)
T cd00765          73 LKIGIVLSGGQAPGGHNVISGLFDYLKERAKGSTLYGFKGGPAGILKCDYIELNAEYIQPYRNTGGFDMICSGRTKIETE  152 (550)
T ss_pred             EEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHCCCCEEEECHHHHHHHHCCCCCCCCCCCCCCCCCH
T ss_conf             18999985799995157498799999964988779997578423206967980899998765188851036885624899


Q ss_pred             CCHHHHHHHHHHHCCC-EEEECCCHHH--HHHHHHHHHHCC--CCEEECCH
Q ss_conf             8989999999871897-9999795578--748998986058--80670106
Q gi|254780206|r   49 QNHSAIIHFCQEKHID-LVVVGPELPL--VNGISDALNAAG--FKVFGPSQ   94 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iD-lvivgpE~pL--~~gi~d~l~~~g--i~v~Gp~~   94 (424)
                      .+++...+.|++.+.| |||||-+...  ++=+++.|.+.+  ..|+|-++
T Consensus       153 eq~~~~~~~~~~l~LdgLVIiGGddSnTnaa~LAEyf~~~~~~t~VIGvPk  203 (550)
T cd00765         153 DQFKQAEETAKKLDLDALVVIGGDDSNTNAALLAENFRSKGLKTRVIGVPK  203 (550)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEECCE
T ss_conf             999999999998599879996898734879999999996499955993453


No 371
>TIGR02352 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727   This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as Escherichia coli that instead use tyrosine and the ThiH protein .; GO: 0016491 oxidoreductase activity, 0050660 FAD binding.
Probab=50.83  E-value=17  Score=16.34  Aligned_cols=52  Identities=27%  Similarity=0.399  Sum_probs=31.1

Q ss_pred             EEEECCC--HHHHHHHHHHHHCCCCCEEEEEC---CC------HHH-HHCCEEEECCCCCHHHHHHHHHH
Q ss_conf             8998865--88999999998589967899954---98------357-51170551287898999999987
Q gi|254780206|r    3 VLLIGSG--GREHALAWKIAQSPLLSELWSIP---GN------PGI-AQHAQCVAIDIQNHSAIIHFCQE   60 (424)
Q Consensus         3 ILviGsG--grEhAl~~~l~~s~~~~~v~~~p---gN------~g~-~~~~~~~~i~~~d~~~i~~~a~~   60 (424)
                      |+|||+|  |.  ++||.|++......|+.-.   |.      +|| +..+|+..    ..+.+.+++.+
T Consensus         1 ~~ViGGGvIGL--~~A~~L~~~G~~V~l~~~~~~~g~~AS~~AaGMLAP~aE~~~----~~~~~f~L~~~   64 (357)
T TIGR02352         1 VLVIGGGVIGL--SVAVELAERGHSVTLLDRDPTVGGGASWAAAGMLAPVAEVEY----AEDPLFDLALE   64 (357)
T ss_pred             CEEECCHHHHH--HHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCC----CCCHHHHHHHH
T ss_conf             97845318789--999999974993899965860456778866433243266746----76747899999


No 372
>PRK08267 short chain dehydrogenase; Provisional
Probab=50.75  E-value=18  Score=16.22  Aligned_cols=65  Identities=23%  Similarity=0.286  Sum_probs=37.3

Q ss_pred             CEEEEE-CCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHH-H----C----CEEEECCCCCHHHHHH----HHHHH--CC
Q ss_conf             958998-865-88999999998589967899954983575-1----1----7055128789899999----99871--89
Q gi|254780206|r    1 MRVLLI-GSG-GREHALAWKIAQSPLLSELWSIPGNPGIA-Q----H----AQCVAIDIQNHSAIIH----FCQEK--HI   63 (424)
Q Consensus         1 MkILvi-GsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~-~----~----~~~~~i~~~d~~~i~~----~a~~~--~i   63 (424)
                      ||+-+| |.+ |--.|+|..|.+...  +|+++.-|.... .    +    ...+..|.+|.+++.+    ++++.  ++
T Consensus         1 MK~vlITGassGIG~a~A~~~a~~G~--~V~~~~r~~~~l~~~~~~l~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~i   78 (258)
T PRK08267          1 MKSIFITGAASGIGRATARLFAARGW--RVGAYDINEDGLAALAAELGAERAWTGALDVTDRAAWDAALADFCAATGGRL   78 (258)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             99899907226899999999998799--9999988899999999983699679999117999999999999999958998


Q ss_pred             CEEE
Q ss_conf             7999
Q gi|254780206|r   64 DLVV   67 (424)
Q Consensus        64 Dlvi   67 (424)
                      |..|
T Consensus        79 DiLV   82 (258)
T PRK08267         79 DVLF   82 (258)
T ss_pred             CEEE
T ss_conf             6899


No 373
>KOG3851 consensus
Probab=50.62  E-value=18  Score=16.20  Aligned_cols=63  Identities=19%  Similarity=0.237  Sum_probs=36.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEE---------EEECC----CHHHHHCC----EEEECCCCCHHHHHHHHHHHCCC
Q ss_conf             589988658899999999858996789---------99549----83575117----05512878989999999871897
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSEL---------WSIPG----NPGIAQHA----QCVAIDIQNHSAIIHFCQEKHID   64 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v---------~~~pg----N~g~~~~~----~~~~i~~~d~~~i~~~a~~~~iD   64 (424)
                      ||||+|+|+---++|-++.+--.-.+|         |.-||    -+|+..++    +...+-+.+..-|.+++++.++|
T Consensus        41 kvLVvGGGsgGi~~A~k~~rkl~~g~vgIvep~e~HyYQPgfTLvGgGl~~l~~srr~~a~liP~~a~wi~ekv~~f~P~  120 (446)
T KOG3851          41 KVLVVGGGSGGIGMAAKFYRKLGSGSVGIVEPAEDHYYQPGFTLVGGGLKSLDSSRRKQASLIPKGATWIKEKVKEFNPD  120 (446)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCEEEECCHHHCCCCCCEEEECCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCC
T ss_conf             89998678630578999986568985577552153245765178643044465536741111567758999888750877


No 374
>PRK08857 para-aminobenzoate synthase component II; Provisional
Probab=50.57  E-value=18  Score=16.20  Aligned_cols=71  Identities=20%  Similarity=0.210  Sum_probs=41.5

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHHH-
Q ss_conf             8998865-88999999998589967899954983575117055128789899999998718979999--7955787489-
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNGI-   78 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~gi-   78 (424)
                      ||||-++ ...|-|++.|++-..  .+-+.|             .|..+.+.+.    +.++|.+|.  ||..|..++. 
T Consensus         2 iLiiDn~DsfT~ni~~~l~~lg~--~v~vv~-------------~d~~~~~~i~----~~~p~~IilS~GPg~p~~~~~~   62 (192)
T PRK08857          2 LLMIDNYDSFTYNLYQYFCELGA--EVKVVR-------------NDEIDIAGIE----ALNPSHLVISPGPCTPNEAGIS   62 (192)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCC--EEEEEE-------------CCCCCHHHHH----HCCCCEEEECCCCCCHHHCCCC
T ss_conf             99997999779999999987799--289996-------------9989999998----4297959998999996782861


Q ss_pred             ---HHHHHHCCCCEEECC
Q ss_conf             ---989860588067010
Q gi|254780206|r   79 ---SDALNAAGFKVFGPS   93 (424)
Q Consensus        79 ---~d~l~~~gi~v~Gp~   93 (424)
                         .+.+ ..++|++|=.
T Consensus        63 ~~~~~~~-~~~iPILGIC   79 (192)
T PRK08857         63 LQAIEHF-AGKLPILGVC   79 (192)
T ss_pred             HHHHHHH-CCCCCEEEEC
T ss_conf             4669973-5799989987


No 375
>PRK07310 consensus
Probab=50.54  E-value=13  Score=17.24  Aligned_cols=24  Identities=21%  Similarity=0.055  Sum_probs=16.7

Q ss_pred             EEEEEECCCHHHHHHHHHHHHHCC
Q ss_conf             999996289899999999998525
Q gi|254780206|r  375 LSATALGKTITESRELAYHMVENI  398 (424)
Q Consensus       375 L~vv~~g~~l~eA~~~ay~~i~~I  398 (424)
                      +++...-+++++|.++.-+.+++-
T Consensus       370 l~~a~~~~~l~eal~RL~~~l~s~  393 (395)
T PRK07310        370 LSYATDLETLKEAVRRLHVFMESN  393 (395)
T ss_pred             EEECCCHHHHHHHHHHHHHHHHHC
T ss_conf             998099999999999999999877


No 376
>PRK01322 6-carboxyhexanoate--CoA ligase; Provisional
Probab=50.42  E-value=18  Score=16.18  Aligned_cols=62  Identities=21%  Similarity=0.402  Sum_probs=32.3

Q ss_pred             CCCCCCCC--CEEEEEECCC-CCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCEEEECCCCEEEEEEECCCHHHHHHH
Q ss_conf             21234444--2067542254-46687757976248766689868998335877887998188079999962898999999
Q gi|254780206|r  314 THINWKAE--YALTVVVATK-GYPEEYPHGTIISKIPQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESREL  390 (424)
Q Consensus       314 ~~~~~~~~--~~v~Vvlas~-GYP~~~~kg~~I~~l~~~~~~~~ifhagt~~~~g~l~t~GGRVL~vv~~g~~l~eA~~~  390 (424)
                      .++.|+++  |..+.|.+.. ||       .-|.++.+ .++                ..||||+.|-. ..+++++.+.
T Consensus       176 AELC~SDDP~YtTGYVA~~~~GY-------~RI~~lK~-~G~----------------~~GGRvffv~~-~~d~~~~i~y  230 (243)
T PRK01322        176 AELCWSDDPDYTTGYVATKKLGY-------FRITNLKE-KGT----------------EYGGRIFFVDD-SIDLEELISF  230 (243)
T ss_pred             EEEEECCCCCCEEEEEEECCCCE-------EECCCCCC-CCC----------------CCCCEEEEEEC-CCCHHHHHHH
T ss_conf             99995379997037998288775-------96745300-379----------------88778999948-9999999999


Q ss_pred             HHHHHHCCCC
Q ss_conf             9999852589
Q gi|254780206|r  391 AYHMVENIDW  400 (424)
Q Consensus       391 ay~~i~~I~~  400 (424)
                      -.+.--.|.|
T Consensus       231 Le~~pVLI~~  240 (243)
T PRK01322        231 LENKPVLVVY  240 (243)
T ss_pred             HHCCCEEEEE
T ss_conf             8248689998


No 377
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed
Probab=50.24  E-value=18  Score=16.16  Aligned_cols=64  Identities=16%  Similarity=0.210  Sum_probs=38.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC-CCCEEEEECCCHHHHH-CCEEEECCC-CCHHHHHHHHHHHCCCEEEEC
Q ss_conf             95899886588999999998589-9678999549835751-170551287-898999999987189799997
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSP-LLSELWSIPGNPGIAQ-HAQCVAIDI-QNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~-~~~~v~~~pgN~g~~~-~~~~~~i~~-~d~~~i~~~a~~~~iDlvivg   69 (424)
                      |||++||.|-=-.||+..|.++. ...++++..-|+.... +.+...+.. .|..++   +  .+-|+||.+
T Consensus         3 ~kI~~IG~G~Mg~Aii~gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~v~~~~~~~~~---~--~~~diIiLa   69 (267)
T PRK11880          3 KKIGFIGGGNMASAIIGGLLASGVPAKDIIVSDPSPEKRAALAEEYGVRAATDNQEA---A--QEADVVVLA   69 (267)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCEEECCHHHH---H--HCCCEEEEE
T ss_conf             879998668999999999997798945289977999999999997396785786988---7--219999997


No 378
>KOG1201 consensus
Probab=50.23  E-value=18  Score=16.16  Aligned_cols=59  Identities=29%  Similarity=0.486  Sum_probs=35.4

Q ss_pred             EEEEECCC---HHHHHHHHHHHHCCCCCEEEEEC--CCHHHHHC------CEEEECCCCCHHHHHHHHHHHC
Q ss_conf             58998865---88999999998589967899954--98357511------7055128789899999998718
Q gi|254780206|r    2 RVLLIGSG---GREHALAWKIAQSPLLSELWSIP--GNPGIAQH------AQCVAIDIQNHSAIIHFCQEKH   62 (424)
Q Consensus         2 kILviGsG---grEhAl~~~l~~s~~~~~v~~~p--gN~g~~~~------~~~~~i~~~d~~~i~~~a~~~~   62 (424)
                      .|||-|+|   ||+  +|.-+.+-...--+|-.+  +|..|...      +..+..|++|.+++.+.+++.+
T Consensus        40 ~vLITGgg~GlGr~--ialefa~rg~~~vl~Din~~~~~etv~~~~~~g~~~~y~cdis~~eei~~~a~~Vk  109 (300)
T KOG1201          40 IVLITGGGSGLGRL--IALEFAKRGAKLVLWDINKQGNEETVKEIRKIGEAKAYTCDISDREEIYRLAKKVK  109 (300)
T ss_pred             EEEEECCCCHHHHH--HHHHHHHHCCEEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             89996898607899--99999970784899955651239999999844852589955898899999999999


No 379
>pfam04321 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose is a saccharide required for the virulence of some bacteria. Its precursor, dTDP-L-rhamnose, is synthesized by four different enzymes the final one of which is RmlD. The RmlD substrate binding domain is responsible for binding a sugar nucleotide.
Probab=50.11  E-value=18  Score=16.15  Aligned_cols=54  Identities=22%  Similarity=0.420  Sum_probs=38.1

Q ss_pred             EEEECCCHH-HHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             899886588-999999998589967899954983575117055128789899999998718979999
Q gi|254780206|r    3 VLLIGSGGR-EHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         3 ILviGsGgr-EhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      |||.|+-|. -..|+..|.+...  +|++.. .         ...|..|.+.+.++.++.++|.||-
T Consensus         1 ILVtG~~GfiGs~l~~~L~~~g~--~v~~~~-r---------~~~D~~d~~~l~~~~~~~~pd~Vih   55 (284)
T pfam04321         1 ILVTGANGQLGRELTRLLAERGV--EVVALD-R---------PELDLTDPEAVAALVREARPDVVVN   55 (284)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCC--EEEEEC-C---------CCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             69964899899999999986899--899954-8---------6257889999999998649979997


No 380
>PRK10786 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional
Probab=50.06  E-value=18  Score=16.14  Aligned_cols=76  Identities=20%  Similarity=0.214  Sum_probs=45.9

Q ss_pred             EECCC-----HHHHHHHHHHHHCC---CCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHH--H
Q ss_conf             98865-----88999999998589---96789995498357511705512878989999999871897999979557--8
Q gi|254780206|r    5 LIGSG-----GREHALAWKIAQSP---LLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELP--L   74 (424)
Q Consensus         5 viGsG-----grEhAl~~~l~~s~---~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~p--L   74 (424)
                      |||.|     |+.||=+.||.+..   .-..+||.        +-.|...-  ...-=.+...+.+|.-||+|..+|  .
T Consensus        37 iig~G~h~~~G~~HAEv~Al~~a~~~~~gatlYVT--------LEPC~H~G--kTpPC~~aIi~agI~rVvia~~DPnp~  106 (367)
T PRK10786         37 IVGEGYHQRAGEPHAEVHALRMAGEKAKGATAYVT--------LEPCSHHG--RTPPCCDALIAAGVARVVAAMQDPNPQ  106 (367)
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEE--------ECCCCCCC--CCCHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             99999578899989999999971343149769998--------35734679--894599999982898899968898821


Q ss_pred             HHH-HHHHHHHCCCCEE
Q ss_conf             748-9989860588067
Q gi|254780206|r   75 VNG-ISDALNAAGFKVF   90 (424)
Q Consensus        75 ~~g-i~d~l~~~gi~v~   90 (424)
                      ++| =...|+++||.|.
T Consensus       107 v~GkGi~~L~~aGI~V~  123 (367)
T PRK10786        107 VAGRGLYRLQQAGIDVS  123 (367)
T ss_pred             CCCCHHHHHHHCCCEEE
T ss_conf             24636999987698899


No 381
>cd01487 E1_ThiF_like E1_ThiF_like. Member of superfamily of activating enzymes (E1) of the ubiquitin-like proteins. The common reaction mechanism catalyzed by E1-like enzymes begins with a nucleophilic attack of the C-terminal carboxylate of the ubiquitin-like substrate, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of the substrate. The exact function of this family is unknown.
Probab=49.91  E-value=18  Score=16.13  Aligned_cols=30  Identities=27%  Similarity=0.366  Sum_probs=23.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             5899886588999999998589967899954
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      ||||+|-||--..++.-|.++. +.++..+.
T Consensus         1 kV~IvG~GGLG~~~a~~La~aG-vg~i~lvD   30 (174)
T cd01487           1 KVGIAGAGGLGSNIAVLLARSG-VGNLKLVD   30 (174)
T ss_pred             CEEEECCCHHHHHHHHHHHHHC-CCEEEEEE
T ss_conf             9899876788999999999818-97399998


No 382
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=49.84  E-value=18  Score=16.12  Aligned_cols=64  Identities=13%  Similarity=0.108  Sum_probs=42.7

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHH--CCCEEE
Q ss_conf             58998865-8899999999858996789995498357511705512878989999999871--897999
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEK--HIDLVV   67 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~--~iDlvi   67 (424)
                      .+||-|++ |--.|++..|.+...  +|++..-|.-.......+..|..|.+.+.+++.+.  ++|..+
T Consensus         7 ~alVTG~s~GIG~aia~~la~~GA--~V~~~d~~~~~~~~~~~~~~D~~~~~~v~~~v~~~~g~id~lv   73 (261)
T PRK12428          7 TIVVTGVASGIGAEVARLLRFLGA--RVIGLDRRPPGMTLDGFHQADLGDPASIDAAVAALPGRIDALF   73 (261)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCCCCCCCCCEEECCCCCHHHHHHHHHHHCCCCCEEE
T ss_conf             899978577999999999998699--9999968855456131767378999999999998379887899


No 383
>PRK08644 thiamine biosynthesis protein ThiF; Provisional
Probab=49.79  E-value=18  Score=16.11  Aligned_cols=30  Identities=27%  Similarity=0.385  Sum_probs=23.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             5899886588999999998589967899954
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      +|||+|-||=-..+++-|..+. +.++.++.
T Consensus        29 ~VlivG~GGLG~~~a~~La~aG-VG~i~lvD   58 (209)
T PRK08644         29 KVGIAGAGGLGSNIAVALARSG-VGNLKLVD   58 (209)
T ss_pred             CEEEECCCHHHHHHHHHHHHHC-CCEEEEEE
T ss_conf             6899888788999999999938-98189988


No 384
>pfam04392 ABC_sub_bind ABC transporter substrate binding protein. This family contains many hypothetical proteins and some ABC transporter substrate binding proteins.
Probab=49.75  E-value=18  Score=16.11  Aligned_cols=96  Identities=18%  Similarity=0.221  Sum_probs=49.0

Q ss_pred             CCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHH---HHHHHHCCCC--CCCCCCHHHHHHHHCCC
Q ss_conf             979999795578748998986058806701066655520102357888---7653101111--22344011111210124
Q gi|254780206|r   63 IDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC---TKYGIPTATY--QHFSDPMKAKQYVQNKS  137 (424)
Q Consensus        63 iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l---~~~gIPt~~~--~~~~~~~ea~~~~~~~g  137 (424)
                      +-.|+.+-.+|..+|+++.+...|-.+.|-+-. .-++..=.++|+++   ++.|+..-..  ......+++++++++.|
T Consensus        81 iPIVf~~v~dPv~aglv~s~~~pg~NvTGvs~~-~~~~~~l~ll~~l~P~~k~igviyn~~e~~s~~~~~~~~~~a~~~g  159 (292)
T pfam04392        81 IPIVFAAVTDPVGAKLVPSKEQPGENVTGVSDL-VDVEQTIELIKKLLPNVKSIGVYYSPSEANSVSLVEEIKKYAKKSG  159 (292)
T ss_pred             CCEEEEEECCHHHHCCCCCCCCCCCEEEEEECC-CCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCC
T ss_conf             998999726856606644566899826785277-4799999999986889858999957998657999999999999769


Q ss_pred             CEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             202563046534300023235677888788751
Q gi|254780206|r  138 MPIVVKADGLCAGKGVVVAATVDEATSAIDRCF  170 (424)
Q Consensus       138 ~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~  170 (424)
                      +-++..+.           .+..|...++....
T Consensus       160 i~l~~~~v-----------~~~~ei~~a~~~l~  181 (292)
T pfam04392       160 IKVVEASV-----------PSSNDVPSAMSSMA  181 (292)
T ss_pred             CEEEEEEC-----------CCHHHHHHHHHHHH
T ss_conf             98999966-----------88667999999743


No 385
>PRK10610 chemotaxis regulatory protein CheY; Provisional
Probab=49.58  E-value=18  Score=16.09  Aligned_cols=88  Identities=14%  Similarity=0.184  Sum_probs=46.1

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHH---HHHHHCCCCCCC
Q ss_conf             87898999999987189799997955787489989860588067010666555201023578887---653101111223
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCT---KYGIPTATYQHF  123 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~---~~gIPt~~~~~~  123 (424)
                      ...|-.+.++.++++.+|+++..-.-|-..|+-                         ++|.+-+   ...+|.---...
T Consensus        35 ~a~~g~~al~~~~~~~~Dlil~D~~MP~~dG~e-------------------------l~~~ir~~~~~~~~Pii~~T~~   89 (129)
T PRK10610         35 EAEDGVDALNKLQAGGFGFVISDWNMPNMDGLE-------------------------LLKTIRADGAMSALPVLMVTAE   89 (129)
T ss_pred             EECCHHHHHHHHHHCCCCEEEEECCCCCCCHHH-------------------------HHHHHHHCCCCCCCCEEEEECC
T ss_conf             989999999999858999999818999998999-------------------------9999985777789968999886


Q ss_pred             CCCHHHHHHHHCCCC-EEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             440111112101242-0256304653430002323567788878875144
Q gi|254780206|r  124 SDPMKAKQYVQNKSM-PIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ  172 (424)
Q Consensus       124 ~~~~ea~~~~~~~g~-PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~  172 (424)
                      .+.+...++.+ .|. -++.||-            +.+++.+.+.+.++.
T Consensus        90 ~~~~~~~~a~~-~Ga~~yl~KP~------------~~~~L~~~i~~vl~r  126 (129)
T PRK10610         90 AKKENIIAAAQ-AGASGYVVKPF------------TAATLEEKLNKIFEK  126 (129)
T ss_pred             CCHHHHHHHHH-CCCCEEEECCC------------CHHHHHHHHHHHHHH
T ss_conf             89999999998-69988998989------------999999999999976


No 386
>PRK03147 thiol-disulfide oxidoreductase; Provisional
Probab=49.58  E-value=18  Score=16.09  Aligned_cols=93  Identities=13%  Similarity=0.216  Sum_probs=51.6

Q ss_pred             CHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCE--EEEEECCCC
Q ss_conf             557874899898605880670106665552010235788876531011112234401111121012420--256304653
Q gi|254780206|r   71 ELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMP--IVVKADGLC  148 (424)
Q Consensus        71 E~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~P--vVVKp~~~a  148 (424)
                      |.|....+.+.+...|+.++|-+.+     .++...++++++++++-|-.  ++...++.....-.+.|  ++|-++|--
T Consensus        80 E~P~L~~l~~~~~~~~v~vi~i~~d-----~~~~~v~~f~~~~~~~~pv~--~D~~~~~~~~~~v~~~P~t~lId~~G~I  152 (176)
T PRK03147         80 EMPYMNELYPKYKEKGVEIIAVNVD-----ETDIAVKNFVNQYGLKFPVA--IDKGRQVIDAYGVGPLPTTFLIDKDGKV  152 (176)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCC-----CCHHHHHHHHHHCCCCCEEE--ECCCCHHHHHCCCCCCCEEEEECCCCEE
T ss_conf             7155999999853064478522078-----87888988898709962289--8797358987699988869999799979


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             43000232356778887887514
Q gi|254780206|r  149 AGKGVVVAATVDEATSAIDRCFQ  171 (424)
Q Consensus       149 gGkGV~i~~~~~e~~~~~~~~~~  171 (424)
                      -.+=+. .-+.+++++.++++..
T Consensus       153 ~~~~~G-~i~~~~l~~~i~~lk~  174 (176)
T PRK03147        153 VKVITG-EMTEEMLEEYLNKIKP  174 (176)
T ss_pred             EEEEEC-CCCHHHHHHHHHHHHC
T ss_conf             999978-9999999999998744


No 387
>KOG3974 consensus
Probab=49.46  E-value=18  Score=16.08  Aligned_cols=71  Identities=27%  Similarity=0.361  Sum_probs=31.5

Q ss_pred             HHHHHHHCCCEEEE-CCCHHHHHHHHH-HHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             99998718979999-795578748998-9860588067010666555201023578887653101111223440111112
Q gi|254780206|r   55 IHFCQEKHIDLVVV-GPELPLVNGISD-ALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQY  132 (424)
Q Consensus        55 ~~~a~~~~iDlviv-gpE~pL~~gi~d-~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~  132 (424)
                      ...++...+|++|- .-..+-...+.+ .|.....-|+||.     |-+|-...|                 +..+..+|
T Consensus        70 a~vIKsYsPdLIVHP~l~~~~av~~i~k~L~RlhavVIGPG-----LGRdp~~~k-----------------~i~~iley  127 (306)
T KOG3974          70 AVVIKSYSPDLIVHPVLDQENAVDIIEKLLQRLHAVVIGPG-----LGRDPAILK-----------------EIAKILEY  127 (306)
T ss_pred             HHHHHHCCCCEEECCCCCCCCHHHHHHHHHHHEEEEEECCC-----CCCCHHHHH-----------------HHHHHHHH
T ss_conf             77876429750641342577637678987743538997798-----889878999-----------------99999999


Q ss_pred             HHCCCCEEEEEECCC
Q ss_conf             101242025630465
Q gi|254780206|r  133 VQNKSMPIVVKADGL  147 (424)
Q Consensus       133 ~~~~g~PvVVKp~~~  147 (424)
                      +..-+.|+||-+||+
T Consensus       128 ~~~~dvP~VIDaDGL  142 (306)
T KOG3974         128 LRGKDVPLVIDADGL  142 (306)
T ss_pred             HHCCCCCEEECCCCE
T ss_conf             864898679807736


No 388
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homologou
Probab=49.41  E-value=19  Score=16.07  Aligned_cols=30  Identities=30%  Similarity=0.476  Sum_probs=20.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
Q ss_conf             5899886588999999998589967899954
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~p   32 (424)
                      ||||+|.||----+++-|..++ +.++.+..
T Consensus         1 KVlvvGaGglGce~~k~La~~G-vg~i~iiD   30 (234)
T cd01484           1 KVLLVGAGGIGCELLKNLALMG-FGQIHVID   30 (234)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEC
T ss_conf             9899948887999999999839-98699975


No 389
>PRK09444 pntB pyridine nucleotide transhydrogenase; Provisional
Probab=49.31  E-value=6.9  Score=19.19  Aligned_cols=14  Identities=7%  Similarity=0.057  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHCCCE
Q ss_conf             89999986204623
Q gi|254780206|r  245 ILPTIEGMQKEQNP  258 (424)
Q Consensus       245 ~~~~~~~l~~~~~~  258 (424)
                      +....+.|++.|.+
T Consensus       323 v~el~~~L~~~g~~  336 (459)
T PRK09444        323 VAEITEKLRARGIN  336 (459)
T ss_pred             HHHHHHHHHHCCCE
T ss_conf             99999999977985


No 390
>pfam07991 IlvN Acetohydroxy acid isomeroreductase, catalytic domain. Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine.
Probab=49.08  E-value=19  Score=16.04  Aligned_cols=60  Identities=17%  Similarity=0.244  Sum_probs=32.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEE-CCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             589988658899999999858996789995-4983575117055128789899999998718979999
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSI-PGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~-pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      ||.|||.|..-||=|.-|+.|..  .|.+. ..+......++.--+...++++..++     -|++++
T Consensus         6 ~iaViGYGsQG~AhAlNLrDSG~--~V~vglr~~s~S~~kA~~dGf~v~~~~eA~~~-----aDiim~   66 (165)
T pfam07991         6 KIAVIGYGSQGHAHALNLRDSGV--NVIVGLRPGSKSWEKAKKDGFEVYTVAEAVKK-----ADVVMI   66 (165)
T ss_pred             EEEEEEECCHHHHHHHHHHHCCC--CEEEEECCCCHHHHHHHHCCCCCCCHHHHHHH-----CCEEEE
T ss_conf             89999346164888723053499--78999789986799999789700489999865-----789998


No 391
>TIGR01127 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789    Serine and threonine dehydratases ,  are functionally and structurally related pyridoxal-phosphate dependent enzymes. L-serine dehydratase () and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown  that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue.    A form of threonine dehydratase with two copies of the C-terminal domain  is described by . This model describes a phylogenetically distinct which branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any  domain. Many members of this model are found in species with other isoleucine biosynthetic enzymes.; GO: 0004794 L-threonine ammonia-lyase activity.
Probab=49.05  E-value=19  Score=16.03  Aligned_cols=155  Identities=19%  Similarity=0.203  Sum_probs=84.7

Q ss_pred             HH--HHHHHHHCCCCCEEEEECCCHH------HHHC-CEEEECCCCCHHHHHHHHHHH----------------------
Q ss_conf             99--9999985899678999549835------7511-705512878989999999871----------------------
Q gi|254780206|r   13 HA--LAWKIAQSPLLSELWSIPGNPG------IAQH-AQCVAIDIQNHSAIIHFCQEK----------------------   61 (424)
Q Consensus        13 hA--l~~~l~~s~~~~~v~~~pgN~g------~~~~-~~~~~i~~~d~~~i~~~a~~~----------------------   61 (424)
                      ||  .|.+-+.+. ++.+.|+|.-.-      |... +| +.+.=.|+|+--++|.+.                      
T Consensus        59 HAQGVA~AA~~~G-i~a~IVMPE~aP~~Kv~AT~~yGAE-ViL~G~~~DEA~~~A~~~~~~~g~~fvHpF~D~~vmAGQG  136 (381)
T TIGR01127        59 HAQGVALAAKVFG-IKAKIVMPEYAPLSKVKATKSYGAE-VILHGADYDEAYALAEELAEEEGRVFVHPFDDEYVMAGQG  136 (381)
T ss_pred             HHHHHHHHHHHCC-CCCEEECCCCCHHHHHHHHHHCCCE-EEECCCCHHHHHHHHHHHHHHCCCEEEEECCCCEEEECCC
T ss_conf             3789999987618-7746878876735789997626961-8980887078999999999860987874058877861674


Q ss_pred             -----------CCCEEEE--CCCHHHHHHHHHHHHHC--CCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             -----------8979999--79557874899898605--88067010666555201023578887653101111223440
Q gi|254780206|r   62 -----------HIDLVVV--GPELPLVNGISDALNAA--GFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDP  126 (424)
Q Consensus        62 -----------~iDlviv--gpE~pL~~gi~d~l~~~--gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~  126 (424)
                                 .+|.||+  |-= =|..|++-.++..  +++|+|-.++.+-     .+ .+=|++=.+-...  ...+.
T Consensus       137 TigLEi~ed~pd~D~viVPVGGG-GLISGv~~a~K~~~P~VkvIGV~aE~ap-----~m-~~Sl~~Gk~~~v~--~~~ti  207 (381)
T TIGR01127       137 TIGLEIMEDLPDVDTVIVPVGGG-GLISGVASAAKKLNPEVKVIGVEAEGAP-----SM-VESLREGKIKAVE--SVDTI  207 (381)
T ss_pred             HHHHHHHHCCCCCCEEEEEECCC-CHHHHHHHHHHHHCCCCEEEEEECCCCH-----HH-HHHHHCCCEEEEC--CCCEE
T ss_conf             89999996479813799841787-1287999999872899479986027855-----89-9998519905604--56414


Q ss_pred             HHH--HHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCC-------C---HHHHHHHHHH
Q ss_conf             111--11210124202563046534300023235677888788751445-------3---1777887752
Q gi|254780206|r  127 MKA--KQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-------N---STVIIEEYLE  184 (424)
Q Consensus       127 ~ea--~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~-------~---~~VliEefl~  184 (424)
                      .|-  -+....+.||+|-+-.+-      .|.=|.+|.-.|+-..|+..       +   =..|+|+-++
T Consensus       208 ADGIaVk~pG~lTF~i~k~~VD~------~V~V~eeEIA~A~~~LLEr~Ki~aEGAGA~gvAA~L~~K~~  271 (381)
T TIGR01127       208 ADGIAVKKPGDLTFNIVKEYVDE------VVAVDEEEIAKAILLLLERAKIVAEGAGAVGVAAVLEDKVD  271 (381)
T ss_pred             ECCCEECCCCCCCHHHHHHHCCC------EEEECHHHHHHHHHHHHCCCCEEECCCHHHHHHHHHHHHCC
T ss_conf             15211637887674789974797------08847377999999986077478827458999999975403


No 392
>PRK13289 nitric oxide dioxygenase; Provisional
Probab=48.99  E-value=19  Score=16.03  Aligned_cols=14  Identities=21%  Similarity=0.380  Sum_probs=6.5

Q ss_pred             CCCCHHHHHHHHHH
Q ss_conf             87898999999987
Q gi|254780206|r   47 DIQNHSAIIHFCQE   60 (424)
Q Consensus        47 ~~~d~~~i~~~a~~   60 (424)
                      ++.|.+.+..+.++
T Consensus        67 ~id~~~~l~~~~~~   80 (399)
T PRK13289         67 NIDNLEALLPAVER   80 (399)
T ss_pred             CCCCHHHHHHHHHH
T ss_conf             47887787999999


No 393
>PRK05670 anthranilate synthase component II; Provisional
Probab=48.91  E-value=19  Score=16.02  Aligned_cols=72  Identities=22%  Similarity=0.252  Sum_probs=41.6

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHHH
Q ss_conf             58998865-88999999998589967899954983575117055128789899999998718979999--7955787489
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNGI   78 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~gi   78 (424)
                      .||||-++ ...|-|+..|++-..  .+.+.|.             +..+.+.+    +..++|.+|.  ||-.|-.++.
T Consensus         1 miLiiD~~dsfT~nI~~~lr~~g~--~v~V~~~-------------d~~~~~~i----~~~~pdgiiLS~GPg~P~~~~~   61 (192)
T PRK05670          1 MILLIDNYDSFTYNLVQYLGELGA--EVVVYRN-------------DEITLEEI----EALAPDAIVLSPGPGTPAEAGI   61 (192)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCC--EEEEEEC-------------CCCCHHHH----HHCCCCEEEECCCCCCHHHCCC
T ss_conf             999996898689999999986899--6999989-------------98999999----8509898999999999366055


Q ss_pred             ----HHHHHHCCCCEEECC
Q ss_conf             ----989860588067010
Q gi|254780206|r   79 ----SDALNAAGFKVFGPS   93 (424)
Q Consensus        79 ----~d~l~~~gi~v~Gp~   93 (424)
                          ...+ ..++|++|=.
T Consensus        62 ~~~~i~~~-~~~iPiLGIC   79 (192)
T PRK05670         62 SLELIREF-AGKVPILGVC   79 (192)
T ss_pred             HHHHHHHH-CCCCCEEEEE
T ss_conf             49999973-4699789984


No 394
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated
Probab=48.80  E-value=19  Score=16.01  Aligned_cols=66  Identities=14%  Similarity=0.145  Sum_probs=35.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECC-CHHHHHCCEE-----EECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             58998865889999999985899678999549-8357511705-----5128789899999998718979999
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPG-NPGIAQHAQC-----VAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pg-N~g~~~~~~~-----~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      +|||||-||---.++.-|..+. +-++-++.+ .-....+...     -.+-....+...+.+++.+++..|.
T Consensus        30 ~VlvvG~GGLG~~~~~yLa~aG-vG~i~i~D~D~ve~sNL~RQ~l~~~~~iG~~K~~~a~~~l~~~np~i~i~  101 (355)
T PRK05597         30 KVSVIGAGGLGSPALLYLAGAG-VGHITIIDDDVVDLSNLHRQVIHTTAGVGTPKAESAREAMLALNPDVKVT  101 (355)
T ss_pred             CEEEECCCHHHHHHHHHHHHCC-CCEEEEEECCCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCEE
T ss_conf             6899877766899999999849-97599972999261213377565412179797999999999878997427


No 395
>COG0796 MurI Glutamate racemase [Cell envelope biogenesis, outer membrane]
Probab=48.77  E-value=19  Score=16.01  Aligned_cols=124  Identities=16%  Similarity=0.167  Sum_probs=61.9

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCH-------HHHHHHHHHHCCCEEEECCC
Q ss_conf             958998865--889999999985899678999549835751170551287898-------99999998718979999795
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNH-------SAIIHFCQEKHIDLVVVGPE   71 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~-------~~i~~~a~~~~iDlvivgpE   71 (424)
                      |+|+|.-||  |-- -+-...++-|...-+|++. |..       .+--....       -++++|..++.++++|+.--
T Consensus         6 ~~IgvFDSGVGGLs-Vlrei~~~LP~e~~iY~~D-~a~-------~PYG~ks~e~I~~~~~~i~~~l~~~~ik~lVIACN   76 (269)
T COG0796           6 PPIGVFDSGVGGLS-VLREIRRQLPDEDIIYVGD-TAR-------FPYGEKSEEEIRERTLEIVDFLLERGIKALVIACN   76 (269)
T ss_pred             CEEEEEECCCCHHH-HHHHHHHHCCCCCEEEEEC-CCC-------CCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             81899978987089-9999999789986899814-778-------99998999999999999999999729988999665


Q ss_pred             HHHHHHHHHHHHH-CCCCEEE--CCHHHH-HHHHCCHHHHHHHHHHHHH-CCCCCCCCCCHHHHHHHHCCCCEEEEEEC
Q ss_conf             5787489989860-5880670--106665-5520102357888765310-11112234401111121012420256304
Q gi|254780206|r   72 LPLVNGISDALNA-AGFKVFG--PSQRAA-KLESSKSFAKKFCTKYGIP-TATYQHFSDPMKAKQYVQNKSMPIVVKAD  145 (424)
Q Consensus        72 ~pL~~gi~d~l~~-~gi~v~G--p~~~aa-~le~sK~~~K~~l~~~gIP-t~~~~~~~~~~ea~~~~~~~g~PvVVKp~  145 (424)
                      ..=+. .-+.|++ -.+||+|  |..++| +...+|        +-|+= |+.  ++.+. --.+.++++.-.+.|+.-
T Consensus        77 TASa~-al~~LR~~~~iPVvGviPaik~A~~~t~~~--------~IgViaT~~--Tvks~-~y~~~i~~~~~~~~V~~l  143 (269)
T COG0796          77 TASAV-ALEDLREKFDIPVVGVIPAIKPAVALTRNG--------RIGVIATPA--TVKSN-AYRDLIARFAPDCEVESL  143 (269)
T ss_pred             HHHHH-HHHHHHHHCCCCEEEECCCHHHHHHHCCCC--------EEEEEECCC--HHHHH-HHHHHHHHHCCCCEEEEE
T ss_conf             17899-999999867999899531549999731387--------589995511--24018-999999985899879970


No 396
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism]
Probab=48.68  E-value=19  Score=16.00  Aligned_cols=30  Identities=13%  Similarity=0.385  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHC----CCCCCCCCCHHHHHHHHCC
Q ss_conf             78887653101----1112234401111121012
Q gi|254780206|r  107 KKFCTKYGIPT----ATYQHFSDPMKAKQYVQNK  136 (424)
Q Consensus       107 K~~l~~~gIPt----~~~~~~~~~~ea~~~~~~~  136 (424)
                      .++++++|.+.    +.+...-+.++..+++++.
T Consensus        96 ~~ia~~~g~~v~~~~~~wg~~v~p~~v~~~L~~~  129 (383)
T COG0075          96 AEIAERYGAEVVVLEVEWGEAVDPEEVEEALDKD  129 (383)
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHCC
T ss_conf             9999982996699847888879999999998528


No 397
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases. aviGT4 in Streptomyces viridochromogenes has been shown to be involved in biosynthesis of oligosaccharide antibiotic avilamycin A. Inactivation of aviGT4 resulted in a mutant that accumulated a novel avilamycin derivative lacking the terminal eurekanate residue.
Probab=48.65  E-value=19  Score=15.99  Aligned_cols=85  Identities=16%  Similarity=0.143  Sum_probs=40.7

Q ss_pred             CEEEEEC----------CCHHHH---HHHHHHHHCCCCCEEEEECCCHHHH-HC----CEEEEC--------CCCCHHHH
Q ss_conf             9589988----------658899---9999998589967899954983575-11----705512--------87898999
Q gi|254780206|r    1 MRVLLIG----------SGGREH---ALAWKIAQSPLLSELWSIPGNPGIA-QH----AQCVAI--------DIQNHSAI   54 (424)
Q Consensus         1 MkILviG----------sGgrEh---Al~~~l~~s~~~~~v~~~pgN~g~~-~~----~~~~~i--------~~~d~~~i   54 (424)
                      ||||+|.          -||-|.   .|+..|.+.+.-..|++ +++.... ..    ......        ...-...+
T Consensus         1 MkI~~v~~~~~p~pP~~~GG~e~~~~~La~~L~~~Gh~V~v~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   79 (335)
T cd03802           1 MRIALVAPPREPVPPPAYGGTERVVAALTEGLVARGHEVTLFA-SGDSKTAAPLVPVVPEPLRLDAPGRDRAEAEALALA   79 (335)
T ss_pred             CEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE-CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
T ss_conf             9869988840036999989799999999999997699899996-289877885004567665445442212456899999


Q ss_pred             HHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             999987189799997955787489989860588067
Q gi|254780206|r   55 IHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVF   90 (424)
Q Consensus        55 ~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~   90 (424)
                      ..+.+..++|++..-...++    .-.....++|++
T Consensus        80 ~~~~~~~~~Dvvh~~~~~~~----~~~~~~~~~p~v  111 (335)
T cd03802          80 ERALAAGDFDIVHNHSLHLP----LPFARPLPVPVV  111 (335)
T ss_pred             HHHHHHCCCCEEEECCCHHH----HHHHHHCCCCEE
T ss_conf             99997579858998971789----999862799789


No 398
>CHL00073 chlN photochlorophyllide reductase subunit N
Probab=48.64  E-value=15  Score=16.65  Aligned_cols=90  Identities=19%  Similarity=0.337  Sum_probs=47.4

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEEC--CCCCHHHHHHHHHHH---CCC--EEEEC--CCHH
Q ss_conf             89988658899999999858996789995498357511705512--878989999999871---897--99997--9557
Q gi|254780206|r    3 VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAI--DIQNHSAIIHFCQEK---HID--LVVVG--PELP   73 (424)
Q Consensus         3 ILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i--~~~d~~~i~~~a~~~---~iD--lvivg--pE~p   73 (424)
                      -||||+---.|     |.||..-.-+|.-|- -+|+.+-+. ++  -..+.+++.+.|.+.   ..|  ++++|  |.+-
T Consensus        40 FLVVGsrTCah-----llQsA~GVMIFAEPR-fatAiLEE~-Dlag~ad~~~EL~Rvv~qi~~~R~~~~i~~vGSCpsEV  112 (457)
T CHL00073         40 FLVVGTKTCGY-----FLQNALGVMIFAEPR-YAMAELEEG-DISAQLNDYEELKRLCLQIKKDRNPSVIVWIGTCTTEI  112 (457)
T ss_pred             EEEEECCHHHH-----HHHHHCCCEEEECCC-CCEEECCCC-HHHCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHH
T ss_conf             47752421787-----876402538970465-111232432-12125773688999999998408980799962686687


Q ss_pred             H---HHHHHHHHHHC-CCCEEECCHHHHHHHH
Q ss_conf             8---74899898605-8806701066655520
Q gi|254780206|r   74 L---VNGISDALNAA-GFKVFGPSQRAAKLES  101 (424)
Q Consensus        74 L---~~gi~d~l~~~-gi~v~Gp~~~aa~le~  101 (424)
                      +   -+|++..|+.. ++||+  ...++-||.
T Consensus       113 IKlDL~~~A~rL~~~~~v~Vl--~~sgsGiet  142 (457)
T CHL00073        113 IKMDLEGMAPRLEAEIGIPIV--VARANGLDY  142 (457)
T ss_pred             HHHHHHHHHHHHHHCCCCEEE--EECCCCCCC
T ss_conf             333087777875013585389--851787543


No 399
>PRK10046 dpiA two-component response regulator DpiA; Provisional
Probab=48.55  E-value=19  Score=15.98  Aligned_cols=114  Identities=15%  Similarity=0.145  Sum_probs=56.1

Q ss_pred             CEEEEECCCHHHH-HHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHH
Q ss_conf             9589988658899-999999858996789995498357511705512878989999999871897999979557874899
Q gi|254780206|r    1 MRVLLIGSGGREH-ALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGIS   79 (424)
Q Consensus         1 MkILviGsGgrEh-Al~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~   79 (424)
                      ||||||-.--.-- .+..-|.+.+....|+.                 ..+..+-.++.+++++|+++.--.-|=..|+ 
T Consensus         5 i~VLIVEDd~~v~~~l~~~L~~~~gf~~V~~-----------------A~~~~eA~~~l~~~~pDLvLLDi~LPd~~Gl-   66 (225)
T PRK10046          5 LTLLIVEDETPLAEMHAEYIRHIPGFSQILL-----------------AGNLAQARMMIERFKPGLILLDNYLPDGRGI-   66 (225)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEE-----------------ECCHHHHHHHHHHCCCCEEEEECCCCCCCHH-
T ss_conf             8699995989999999999972899549999-----------------8999999999973599999982898999799-


Q ss_pred             HHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCC--CCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHH
Q ss_conf             8986058806701066655520102357888765310111--12234401111121012420256304653430002323
Q gi|254780206|r   80 DALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT--YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAA  157 (424)
Q Consensus        80 d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~--~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~  157 (424)
                                              .+.+++ .+.+.+++-  -..+++.+.+.++++.=-+-+++||-            
T Consensus        67 ------------------------ell~~l-r~~~~~~~VI~iTA~~d~~~~~~Al~~Ga~DYLvKPf------------  109 (225)
T PRK10046         67 ------------------------NLLHEL-VQAHYPGDVVFTTAASDMETVSEAVRCGVFDYLIKPI------------  109 (225)
T ss_pred             ------------------------HHHHHH-HHHCCCCCEEEEECCCCHHHHHHHHHCCCCCCEECCC------------
T ss_conf             ------------------------999999-9648799889996899999999999749983102899------------


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             567788878875
Q gi|254780206|r  158 TVDEATSAIDRC  169 (424)
Q Consensus       158 ~~~e~~~~~~~~  169 (424)
                      +.+++.+++++.
T Consensus       110 ~~erl~~~L~~y  121 (225)
T PRK10046        110 AYERLGQTLTRF  121 (225)
T ss_pred             CHHHHHHHHHHH
T ss_conf             999999999999


No 400
>KOG2156 consensus
Probab=48.49  E-value=18  Score=16.20  Aligned_cols=59  Identities=20%  Similarity=0.308  Sum_probs=39.0

Q ss_pred             CCCCCCCCHHHHHHHHCC-CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCC
Q ss_conf             112234401111121012-42025630465343000232356778887887514453177788775205
Q gi|254780206|r  119 TYQHFSDPMKAKQYVQNK-SMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGF  186 (424)
Q Consensus       119 ~~~~~~~~~ea~~~~~~~-g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~  186 (424)
                      .|..=.+.++++++.++- ..-++|||-..|-|-|+.+.....+.         -...+.++++||+-+
T Consensus       286 tyilP~d~e~lrk~w~~nasr~wIVkppasaRg~gIrv~~kw~q~---------pk~rpLvvQ~yieRP  345 (662)
T KOG2156         286 TYILPADREELRKYWEKNASRLWIVKPPASARGIGIRVINKWSQF---------PKDRPLVVQKYIERP  345 (662)
T ss_pred             EEECCCCHHHHHHHHHHCCCCCEEECCCCCCCCCCEEECCCHHHC---------CCCCCHHHHHHHHCC
T ss_conf             335640099999987647442077558600267635742536448---------876648999976343


No 401
>PTZ00253 tryparedoxin peroxidase; Provisional
Probab=48.29  E-value=15  Score=16.84  Aligned_cols=16  Identities=25%  Similarity=0.204  Sum_probs=7.0

Q ss_pred             EEEEECCE-EEEEEEEE
Q ss_conf             48985570-48999886
Q gi|254780206|r  266 GLMITEQG-PYLIEYNV  281 (424)
Q Consensus       266 ~~m~t~~g-p~viE~N~  281 (424)
                      -|++..+| .+.+.+|.
T Consensus       130 ~FIIDp~giIr~~~v~~  146 (199)
T PTZ00253        130 LFIIDPKGMLRQITVND  146 (199)
T ss_pred             EEEECCCCEEEEEEECC
T ss_conf             99988998499999779


No 402
>TIGR01828 pyru_phos_dikin pyruvate, phosphate dikinase; InterPro: IPR010121   Pyruvate phosphate dikinase (PPDK, or pyruvate orthophosphate dikinase) is found in plants, bacteria and archaea. The amino acid sequence identity between bacterial and plant enzymes is high, and they are similar in sequence to other PEP-utilizing enzymes. PPDK catalyses the reversible conversion of ATP and pyruvate to AMP and PEP (phosphoenolpyruvate). In bacteria such as Clostridium symbiosum, PPDK uses Mg2+ and NH4+ ions as cofactors . The enzyme has three domains: the N- and C-terminal domains each have an active site centre that catalyses a different step in the reaction, and the middle domain has a carrier histidine residue that moves between the two active centres.   In plants, PPDK is localised predominantly in chloroplast stroma where it catalyses the rate-limiting step in the C4 photosynthetic pathway, namely the synthesis of PEP, which acts as the primary CO2 acceptor in C4 photosynthesis . PPDK activity in C4 plants is strictly regulated by light, its activity decreasing in darkness. This response is regulated by phosphorylation and dephosphorylation of the enzyme using ADP; such regulation is not seen in the bacterial form of the enzyme. PPDK is also found in C3 plants, but it is not known to have a photosynthetic role .; GO: 0050242 pyruvate phosphate dikinase activity.
Probab=48.19  E-value=9  Score=18.32  Aligned_cols=170  Identities=16%  Similarity=0.236  Sum_probs=81.2

Q ss_pred             CC-CCHHHHHHHHHHHHHHHCCC-CHHHHHHH-HH------HCCCCCEEEECCCC----CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00-23235677888788751445-31777887-75------20575234421577----631035200011135665444
Q gi|254780206|r  152 GV-VVAATVDEATSAIDRCFQQI-NSTVIIEE-YL------EGFEVSFFALCDGK----TAIPFTTARDHKRIHDGDIGP  218 (424)
Q Consensus       152 GV-~i~~~~~e~~~~~~~~~~~~-~~~VliEe-fl------~G~E~Sv~~i~dG~----~~~~l~~~~dyKr~~~~d~Gp  218 (424)
                      |. +-.+-.+|+..|+...|.++ +.+.++=. -+      -|.=++++..+-|+    +-.=...+||          |
T Consensus       199 G~~FPqDP~eQL~~Ai~AVF~SW~n~RA~~YRr~~n~Ip~~~GTAVNiQ~MVFGN~G~dSgTGV~FTRn----------P  268 (920)
T TIGR01828       199 GKDFPQDPKEQLELAIKAVFDSWNNPRAVVYRRRLNDIPEDLGTAVNIQSMVFGNMGEDSGTGVAFTRN----------P  268 (920)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCEEEEEEEECCCCCCCCCEEEEECC----------C
T ss_conf             898773318999999999831568730788867632584103871578752206788887441467528----------7


Q ss_pred             CCCCCC-EE-----------------ECCCCCCCCC---------C---EEEECCHHHHHHHHHHH-CCCEEEEEEEEEE
Q ss_conf             443443-00-----------------0012344322---------2---01000008999998620-4623566445448
Q gi|254780206|r  219 NTGGMG-AC-----------------SPALGMSQEL---------Y---STVIQKIILPTIEGMQK-EQNPFQGVLFAGL  267 (424)
Q Consensus       219 nTGGMG-a~-----------------~p~~~~~~~~---------~---~~i~~~i~~~~~~~l~~-~~~~y~G~l~~~~  267 (424)
                      +||-=+ -|                 ||-|.-.-..         .   +..+-+..+-.+.-..+ |+ .|+-.--++|
T Consensus       269 ~TGEk~ylfGEfL~NAQGEDVVAGIRTP~~i~~~~~dareE~Gd~~~s~~~~mP~~Y~eL~~~~~~LE~-HYrDMqDIEF  347 (920)
T TIGR01828       269 STGEKKYLFGEFLINAQGEDVVAGIRTPEPISELKEDAREEMGDDENSMEADMPEVYKELLDIAEKLEG-HYRDMQDIEF  347 (920)
T ss_pred             CCCCCCEEHHHHHHCCCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH-HHHHCCCCEE
T ss_conf             887664034314202477525324338800665457767632788068987428999999999999874-4333076414


Q ss_pred             EEECCEEEEEEEEEEECCCCCEEE----EECCCCCCH---HHHHHHHHCCCCC-CCCCCCCCCEE--EEEECCCCCCCC
Q ss_conf             985570489998865147751044----332654411---5666542013333-21234444206--754225446687
Q gi|254780206|r  268 MITEQGPYLIEYNVRFGDPECQAM----MMRLESDIL---EILNSCVHGNLHN-THINWKAEYAL--TVVVATKGYPEE  336 (424)
Q Consensus       268 m~t~~gp~viE~N~R~GDPE~q~i----lp~L~~dl~---~il~~~~~g~L~~-~~~~~~~~~~v--~Vvlas~GYP~~  336 (424)
                      =|=++.-|+|  -||=|=-.+.+-    +-+.+..++   +.+..+-..+|++ ....|++.+.-  .|+  .+|=|.|
T Consensus       348 TIE~gKLYmL--QTR~GKRTA~AA~rIAvDmv~Eg~It~eeA~~Rv~p~~ldQLLHp~f~~~~~~~~~vl--a~GLPAS  422 (920)
T TIGR01828       348 TIERGKLYML--QTRNGKRTAKAAVRIAVDMVKEGLITKEEAIMRVEPESLDQLLHPRFDPSAKEAGEVL--AKGLPAS  422 (920)
T ss_pred             EEECCCEEEE--ECCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHCCCHHHHHHHHCCCCCCHHHHCCCCE--EECCCCC
T ss_conf             7652750133--3555223558899999998735887757864215747875650788780445218710--1046887


No 403
>PRK00973 glucose-6-phosphate isomerase; Provisional
Probab=48.09  E-value=19  Score=15.93  Aligned_cols=46  Identities=17%  Similarity=0.389  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHHCCCCCCC-CCCH--HHHHHHHCCCCEEEEEECCCCCCC
Q ss_conf             3578887653101111223-4401--111121012420256304653430
Q gi|254780206|r  105 FAKKFCTKYGIPTATYQHF-SDPM--KAKQYVQNKSMPIVVKADGLCAGK  151 (424)
Q Consensus       105 ~~K~~l~~~gIPt~~~~~~-~~~~--ea~~~~~~~g~PvVVKp~~~agGk  151 (424)
                      ..|+.|+++|.-..+..++ ++.+  .+...+++.+++...=|+. -|||
T Consensus       155 ~~r~~l~~~g~~~~~h~vaiT~~~~~~l~~~a~~~g~~~f~ipd~-VGGR  203 (454)
T PRK00973        155 IVRGLLEKYGLDPKKHLVFTTDPEKGELKKIAEEEGYKTLEIPEN-VGGR  203 (454)
T ss_pred             HHHHHHHHCCCCHHHCEEEECCCCCCHHHHHHHHCCEEEECCCCC-CCCH
T ss_conf             999999964956765657752675115677788749107248999-7636


No 404
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT).
Probab=47.89  E-value=19  Score=15.91  Aligned_cols=14  Identities=21%  Similarity=0.218  Sum_probs=7.1

Q ss_pred             CEEEEEEEEEEECC
Q ss_conf             70489998865147
Q gi|254780206|r  272 QGPYLIEYNVRFGD  285 (424)
Q Consensus       272 ~gp~viE~N~R~GD  285 (424)
                      .|-+|||+-|=-|.
T Consensus        73 ~g~~VLeIGtGsGY   86 (205)
T pfam01135        73 PGMRVLEIGSGSGY   86 (205)
T ss_pred             CCCEEEEECCCCCH
T ss_conf             99989996699659


No 405
>TIGR00065 ftsZ cell division protein FtsZ; InterPro: IPR000158   In bacteria, FtsZ , ,  is an essential cell division protein which appears to be involved in the initiation of this event. It assembles into a cytokinetic ring on the inner surface of the cytoplasmic membrane at the place where division will occur. The ring serves as a scaffold that is disassembled when septation is completed. FtsZ ring formation is initiated at a single site on one side of the bacterium and appears to grow bidirectionally. In Escherichia coli, MinCD IPR005526 from INTERPRO, encoded by the MinB locus, form a complex which appears to block the formation of FtsZ rings at the cell poles, at the ancient mid cell division sites, whilst MinE, encoded at the same locus, specifically prevents the action of MinCD at mid cell.    FtsZ is a GTP binding protein PDOC00199 from PROSITEDOC with a GTPase activity. It undergoes GTP-dependent polymerization into filaments (or tubules) that seem to form a cytoskeleton involved in septum synthesis. The structure and the properties of FtsZ clearly provide it with the capacity for the cytoskeletal, perhaps motor role, necessary for "contraction" along the division plane. In addition, however, the FtsZ ring structure provides the framework for the recruitment or assembly of the ten or so membrane and cytoplasmic proteins, uniquely required for cell division in E. coli or Bacillus subtilis, some of which are required for biogenesis of the new hemispherical poles of the two daughter cells. FtsZ can polymerize into various structures, for example a single linear polymer of FtsZ monomers, called a protofilament. Protofilaments can associate laterally to form pairs (sometimes called thick filaments, bundles (ill-defined linear associations of multiple protofilaments or thick filaments, sheets (parallel or anti-parallel two-dimensional associations of thick filaments and tubes (anti-parallel associations of thick filaments in a circular fashion to form a tubular structure). In addition, small circles of FtsZ monomers (a short protofilament bent around to join itself, apparently head to tail) have been observed and termed mini-rings.    FtsZ is a protein of about 400 residues which is well conserved across bacterial species and which is also present in the chloroplast of plants  as well as in archaebacteria . FtsZ shows structural similarity with eukaryotic tubulins. This similarity is probably both evolutionary and functionally significant.; GO: 0005525 GTP binding, 0005737 cytoplasm.
Probab=47.76  E-value=20  Score=15.90  Aligned_cols=96  Identities=22%  Similarity=0.347  Sum_probs=52.2

Q ss_pred             EEEEECCCHHH---------H----HH-----------HHHHHHCC-CCCEEEE---------ECCCHHHHHCCEEEECC
Q ss_conf             58998865889---------9----99-----------99998589-9678999---------54983575117055128
Q gi|254780206|r    2 RVLLIGSGGRE---------H----AL-----------AWKIAQSP-LLSELWS---------IPGNPGIAQHAQCVAID   47 (424)
Q Consensus         2 kILviGsGgrE---------h----Al-----------~~~l~~s~-~~~~v~~---------~pgN~g~~~~~~~~~i~   47 (424)
                      ||-|||-||-=         |    .+           +|+|..+. --.++..         |=|||..-+-+     -
T Consensus        19 kI~ViGvGGgGnN~v~rm~~~~p~l~~~g~~fiA~NTD~Q~L~~~~~A~~kilIG~~~TrGLGAGG~P~iG~~A-----A   93 (365)
T TIGR00065        19 KIKVIGVGGGGNNAVNRMVEEYPELGVEGVEFIAINTDAQHLKTTKYAPKKILIGKKLTRGLGAGGNPEIGRKA-----A   93 (365)
T ss_pred             EEEEEEECCCCHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHH-----H
T ss_conf             89999855882358999987055322376269997483785411556241356157335567679983888999-----8


Q ss_pred             CCCHHHHHHHHHHHCCCEEEE--C-------CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHH
Q ss_conf             789899999998718979999--7-------95578748998986058806701066655520102357
Q gi|254780206|r   48 IQNHSAIIHFCQEKHIDLVVV--G-------PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAK  107 (424)
Q Consensus        48 ~~d~~~i~~~a~~~~iDlviv--g-------pE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K  107 (424)
                      .++.+++.+..  ..-|+|||  |       --+|-+   ++..++.|+-++|=--.=...|+.|...|
T Consensus        94 ees~d~i~~~l--~GaDmVFitAGmGGGTGTGAAPVv---A~~AK~~GaLTvavVT~PF~~EG~kr~~~  157 (365)
T TIGR00065        94 EESRDEIRELL--EGADMVFITAGMGGGTGTGAAPVV---AKIAKELGALTVAVVTKPFKFEGKKRRKK  157 (365)
T ss_pred             HHHHHHHHHHC--CCCCEEEEEECCCCCCCCCCHHHH---HHHHHHCCEEEEEEECCCCCCHHHHHHHH
T ss_conf             98899999970--388818997258668666635789---99997579069998428741015899999


No 406
>TIGR03219 salicylate_mono salicylate 1-monooxygenase. Members of this protein family are salicylate 1-monooxygenase, also called salicylate hydroxylase. This enzyme converts salicylate to catechol, which is a common intermediate in the degradation of a number of aromatic compounds (phenol, toluene, benzoate, etc.). The gene for this protein may occur in catechol degradation genes, such as those of the meta-cleavage pathway.
Probab=47.72  E-value=20  Score=15.89  Aligned_cols=25  Identities=36%  Similarity=0.510  Sum_probs=18.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCC
Q ss_conf             9589988658899999999858996
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLL   25 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~   25 (424)
                      |||+|||.|=---++|.+|.+...+
T Consensus         1 mkV~IVGaGiaGL~lA~~L~r~g~i   25 (414)
T TIGR03219         1 LRVAIIGGGIAGVALALNLCKHSHL   25 (414)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCC
T ss_conf             9899999448999999999853999


No 407
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type I periplasmic binding protein-like fold.  As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.
Probab=47.64  E-value=20  Score=15.89  Aligned_cols=39  Identities=15%  Similarity=0.290  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             999999987189799997955787489989860588067
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVF   90 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~   90 (424)
                      .+.++...+.++|.+|+.|.......+.+.+++.++|++
T Consensus        45 ~~~l~~l~~~~vdGiIi~~~~~~~~~~~~~~~~~~iPvV   83 (269)
T cd06281          45 LEILRSFEQRRMDGIIIAPGDERDPELVDALASLDLPIV   83 (269)
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCEE
T ss_conf             999999985799899976777799999999984799889


No 408
>COG0774 LpxC UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane]
Probab=47.64  E-value=12  Score=17.45  Aligned_cols=42  Identities=26%  Similarity=0.566  Sum_probs=32.9

Q ss_pred             CCCHHHHHHHHHHHCCCEEEE---CCCHHHHHH----HHHHHHHCCCCE
Q ss_conf             789899999998718979999---795578748----998986058806
Q gi|254780206|r   48 IQNHSAIIHFCQEKHIDLVVV---GPELPLVNG----ISDALNAAGFKV   89 (424)
Q Consensus        48 ~~d~~~i~~~a~~~~iDlviv---gpE~pL~~g----i~d~l~~~gi~v   89 (424)
                      +..+|.+.....-..||=++|   |||.|+.+|    +++.++++||.-
T Consensus        74 I~TVEHLmaAl~~lgIDN~~Iev~g~EiPImDGSa~~Fv~li~~aGi~~  122 (300)
T COG0774          74 ISTVEHLMAALAGLGIDNLIIEVDGPEIPIMDGSAAPFVELIDEAGIKE  122 (300)
T ss_pred             EEEHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHCCHH
T ss_conf             8539999999985798648999658867645786289999999718311


No 409
>PRK00881 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase; Provisional
Probab=47.49  E-value=20  Score=15.87  Aligned_cols=33  Identities=18%  Similarity=0.164  Sum_probs=16.8

Q ss_pred             CCEEEECCCCEEEEEEECCCHHHHHHHHHHHHH
Q ss_conf             887998188079999962898999999999985
Q gi|254780206|r  364 NNNLTANGGRVLSATALGKTITESRELAYHMVE  396 (424)
Q Consensus       364 ~g~l~t~GGRVL~vv~~g~~l~eA~~~ay~~i~  396 (424)
                      |.-.++.++.++.+=+--.+.-+|.+.|-+..+
T Consensus       415 NAIv~ak~~~tvGiGaGQ~sRVda~~iA~~ka~  447 (514)
T PRK00881        415 NAIVYAKDGQTVGIGAGQMSRVDSAKIALEKAG  447 (514)
T ss_pred             CEEEEEECCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             569999489389867897568999999999988


No 410
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of eukaryotic LDHs. Vertebrate LDHs are non-allosteric. This is in contrast to some bacterial LDHs that are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=47.48  E-value=20  Score=15.87  Aligned_cols=117  Identities=21%  Similarity=0.213  Sum_probs=61.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHH-----HC-------CEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             95899886588999999998589967899954983575-----11-------7055128789899999998718979999
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA-----QH-------AQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~-----~~-------~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      +||-|||.|.---++|+.|...+.++++.+..-|+..+     .+       ..+......|.+.+      ..-|.||+
T Consensus         4 ~Kv~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~h~~~~~~~~~v~~~~d~~~~------~~aDvVVi   77 (312)
T cd05293           4 NKVTVVGVGQVGMACAISILAKGLADELVLVDVVEDKLKGEAMDLQHGSAFLKNPKIEADKDYSVT------ANSKVVIV   77 (312)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCHHHH------CCCCEEEE
T ss_conf             869998978889999999996699887999938898332688886604012798559937999996------89999998


Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHH---HHHHHHCCCCCCCCCCHHHHHHHH--CCCCE
Q ss_conf             795578748998986058806701066655520102357888---765310111122344011111210--12420
Q gi|254780206|r   69 GPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC---TKYGIPTATYQHFSDPMKAKQYVQ--NKSMP  139 (424)
Q Consensus        69 gpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l---~~~gIPt~~~~~~~~~~ea~~~~~--~~g~P  139 (424)
                      ....|-         +.     |.+ +...++.+-...|++.   .+++ |.+..-.++|.-++..++-  ..|||
T Consensus        78 tAG~~~---------k~-----g~~-R~dLl~~N~~I~~~i~~~i~~~~-p~~ivivvsNPvDv~t~~~~k~sg~p  137 (312)
T cd05293          78 TAGARQ---------NE-----GES-RLDLVQRNVDIFKGIIPKLVKYS-PNAILLVVSNPVDIMTYVAWKLSGLP  137 (312)
T ss_pred             CCCCCC---------CC-----CCC-HHHHHHHHHHHHHHHHHHHHHCC-CCCEEEECCCCHHHHHHHHHHHCCCC
T ss_conf             899999---------98-----988-89999988999999999988419-98469966891899999999962998


No 411
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]
Probab=47.48  E-value=20  Score=15.87  Aligned_cols=64  Identities=16%  Similarity=0.181  Sum_probs=38.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--CCEEEEECCCHHHHH-CCEEEECC-CCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             958998865889999999985899--678999549835751-17055128-7898999999987189799997
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPL--LSELWSIPGNPGIAQ-HAQCVAID-IQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~--~~~v~~~pgN~g~~~-~~~~~~i~-~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      |||.+||.|---.||+..|.+++.  ...|++..-|+.... +.+...+. ..|.+..   +  .+-|.+|.+
T Consensus         2 ~~IgfIG~G~Mg~Ai~~gl~~~g~~~~~~I~v~~~~~e~~~~l~~~~g~~~~~~~~~~---~--~~advv~La   69 (266)
T COG0345           2 MKIGFIGAGNMGEAILSGLLKSGALPPEEIIVTNRSEEKRAALAAEYGVVTTTDNQEA---V--EEADVVFLA   69 (266)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCCHHHH---H--HHCCEEEEE
T ss_conf             6589984688999999999966899802389837999999999998498556867988---7--408989998


No 412
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB; InterPro: IPR014149   This entry represents TrbB, a protein, which is encoded in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer . TrbB is a homologue of the vir system VirB11 ATPase , and the Flp pilus system ATPase TadA ..
Probab=47.46  E-value=20  Score=15.87  Aligned_cols=157  Identities=20%  Similarity=0.210  Sum_probs=76.8

Q ss_pred             HHHHH---HHHHCCCCCEEEEECCCHHH---HHC---CE-EEE-CCCCCHHHHHHHHHHHC---C--CEEEECCCHHHHH
Q ss_conf             99999---99858996789995498357---511---70-551-28789899999998718---9--7999979557874
Q gi|254780206|r   13 HALAW---KIAQSPLLSELWSIPGNPGI---AQH---AQ-CVA-IDIQNHSAIIHFCQEKH---I--DLVVVGPELPLVN   76 (424)
Q Consensus        13 hAl~~---~l~~s~~~~~v~~~pgN~g~---~~~---~~-~~~-i~~~d~~~i~~~a~~~~---i--DlvivgpE~pL~~   76 (424)
                      |++..   ++..++.+.+|=.-|+  |.   ..+   .+ +-. +++.+.+.|+..+-.+-   +  |-=++--|-||- 
T Consensus         8 ~~lG~~i~~~LdD~~vvEIMLNpD--G~Lwve~Lg~G~~~~G~t~~~~~a~~Ii~~vA~~l~~~V~~~~PivegELPld-   84 (315)
T TIGR02782         8 RALGPEIAAALDDPKVVEIMLNPD--GKLWVERLGEGMEPLGKTVSPADAERIIGLVADYLGTEVDRDKPIVEGELPLD-   84 (315)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCC--CHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCEEECCCCEEEECCCCC-
T ss_conf             998999999737988389986698--70105006797300166117899999999998764460435786266107511-


Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCH
Q ss_conf             89989860588067010666555201023578887653101111223440111112101242025630465343000232
Q gi|254780206|r   77 GISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVA  156 (424)
Q Consensus        77 gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~  156 (424)
                      -+-..|+=.==||+--+..+.|.--.+.|+=+=.-++||=|+.=     .+-+.+++.... -++|     +||-|--  
T Consensus        85 flGsRFeGl~PPVV~~p~F~IRkkA~~vfTLDdYV~~gimtaaQ-----~d~l~~Av~ar~-NIlv-----~GGTGSG--  151 (315)
T TIGR02782        85 FLGSRFEGLLPPVVEAPSFAIRKKAVRVFTLDDYVEAGIMTAAQ-----RDVLREAVAARK-NILV-----VGGTGSG--  151 (315)
T ss_pred             HHHCCCCCCCCCCCCCCCCHHCCCCCCCCCCHHHHHHCCCCHHH-----HHHHHHHHHHCC-CEEE-----ECCCCCC--
T ss_conf             12011004687755655101110224104707776404455789-----999999997129-8899-----8145885--


Q ss_pred             HHHHHHHHH-HHHHHC--CCCHH-HHHHHHHHCCCCCE
Q ss_conf             356778887-887514--45317-77887752057523
Q gi|254780206|r  157 ATVDEATSA-IDRCFQ--QINST-VIIEEYLEGFEVSF  190 (424)
Q Consensus       157 ~~~~e~~~~-~~~~~~--~~~~~-VliEefl~G~E~Sv  190 (424)
                        +.-+-+| +.++-.  ..+++ ||||.=   .|+-|
T Consensus       152 --KTTLaNAlla~I~~l~~P~dR~vIiEDT---~ElQC  184 (315)
T TIGR02782       152 --KTTLANALLAEIAKLNDPDDRVVIIEDT---AELQC  184 (315)
T ss_pred             --HHHHHHHHHHHHHHCCCCCCEEEEEECC---HHHHH
T ss_conf             --7999999999885216999618998547---13201


No 413
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IPR005737   DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis , . DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA .   Type II topoisomerases are ATP-dependent enzymes, and can be subdivided according to their structure and reaction mechanisms: type IIA (topoisomerase II or gyrase, and topoisomerase IV) and type IIB (topoisomerase VI). These enzymes are responsible for relaxing supercoiled DNA as well as for introducing both negative and positive supercoils .   This entry represents subunit B (parE) of topoisomerase IV from Gram negative bacteria. Topoisomerase IV primarily decatenates DNA and relaxes positive supercoils, which is important in bacteria, where the circular chromosome becomes catenated, or linked, during replication . Topoisomerase IV consists of two polypeptide subunits, parC (subunit A), which is homologous to gyrA of topoisomerase II, and parE (subunit B), which is homologous to gyrB of topoisomerase II.   More information about this protein can be found at Protein of the Month: DNA Topoisomerase .; GO: 0003677 DNA binding, 0003918 DNA topoisomerase (ATP-hydrolyzing) activity, 0005524 ATP binding, 0006265 DNA topological change, 0005694 chromosome.
Probab=47.42  E-value=20  Score=15.86  Aligned_cols=51  Identities=20%  Similarity=0.286  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHC--CCCEEECCH---------HHHHHHHCCHH----HHHHHHHH--HHHCCCCCCCCC
Q ss_conf             74899898605--880670106---------66555201023----57888765--310111122344
Q gi|254780206|r   75 VNGISDALNAA--GFKVFGPSQ---------RAAKLESSKSF----AKKFCTKY--GIPTATYQHFSD  125 (424)
Q Consensus        75 ~~gi~d~l~~~--gi~v~Gp~~---------~aa~le~sK~~----~K~~l~~~--gIPt~~~~~~~~  125 (424)
                      -.|+.|+|.+.  +.+.+-+..         ...+++|-=.|    +..|++.|  -|||+.+-+..+
T Consensus       225 ~~GL~DYL~~~v~~~~~~~~~~F~G~~~~tvd~~~~~WAl~W~~~~~~~~~~SY~N~iPT~QGGTH~~  292 (647)
T TIGR01055       225 EDGLKDYLSEAVNGLNTLPKKPFVGNFEGTVDDEAVEWALLWLPEGGELLMESYVNLIPTIQGGTHVN  292 (647)
T ss_pred             CCCHHHHHHHHHCCCCCCCCCCEECCCCCCHHHHHCCEEEEECCCCCHHHHHCCCCCCCCCCCCCHHH
T ss_conf             03313688876312322345530023211011110024466327884003204110157898871045


No 414
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center
Probab=47.37  E-value=20  Score=15.86  Aligned_cols=97  Identities=20%  Similarity=0.083  Sum_probs=40.0

Q ss_pred             HHHHHHCCCCEEEEE-E-CCCCCCCCCCCH--HHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCC
Q ss_conf             111210124202563-0-465343000232--356778887887514453177788775205752344215776310352
Q gi|254780206|r  129 AKQYVQNKSMPIVVK-A-DGLCAGKGVVVA--ATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTT  204 (424)
Q Consensus       129 a~~~~~~~g~PvVVK-p-~~~agGkGV~i~--~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~  204 (424)
                      ...+++.++...+|= . |..++-.|+.-.  ..+.++.+..+-.|.  .++-|.|.+-.-. -.+..+-+|-.+-.+..
T Consensus       113 ~~~~~~~l~~~~vVYdcvDd~~~~~~~~~~~~~~e~~l~~~ad~v~~--ts~~L~~~~~~~~-~~~~~i~nGvD~~~F~~  189 (373)
T cd04950         113 TLPVAALLQASLVVYDCVDDLSAFPGGPPELLEAERRLLKRADLVFT--TSPSLYEAKRRLN-PNVVLVPNGVDYEHFAA  189 (373)
T ss_pred             HHHHHHHCCCCCEEEEEECCHHHCCCCCHHHHHHHHHHHHHCCEEEE--CCHHHHHHHHHCC-CCEEEECCEECHHHHHH
T ss_conf             68898753788389995061221379868999999999997799998--5999999887469-99899888217888410


Q ss_pred             CCCCCC---CCCCCCCCCCCCCCEEEC
Q ss_conf             000111---356654444434430000
Q gi|254780206|r  205 ARDHKR---IHDGDIGPNTGGMGACSP  228 (424)
Q Consensus       205 ~~dyKr---~~~~d~GpnTGGMGa~~p  228 (424)
                      +++-..   ......+|.-|=+|++++
T Consensus       190 ~~~~~~~~~~~~~~~~p~igy~G~i~~  216 (373)
T cd04950         190 ARDPPPPPADLAALPRPVIGYYGAIAE  216 (373)
T ss_pred             HCCCCCCCHHHCCCCCCEEEEEECCCC
T ss_conf             015768804550479988999925752


No 415
>PRK10637 cysG siroheme synthase; Provisional
Probab=47.04  E-value=20  Score=15.82  Aligned_cols=23  Identities=17%  Similarity=0.270  Sum_probs=15.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             58998865889999999985899
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPL   24 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~   24 (424)
                      +|||+|+|.-...=+..|.+...
T Consensus        14 ~vLVVGGG~vA~rK~~~Ll~agA   36 (457)
T PRK10637         14 DCLIVGGGDVAERKARLLLDAGA   36 (457)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCC
T ss_conf             69998998999999999987898


No 416
>cd00279 YlxR Ylxr homologs; group of conserved hypothetical bacterial proteins of unknown function; structure revealed putative RNA binding cleft; proteins are encoded by an operon that includes other proteins involved in transcription and/or translation
Probab=47.04  E-value=20  Score=15.82  Aligned_cols=49  Identities=20%  Similarity=0.301  Sum_probs=31.4

Q ss_pred             CCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHH-----HHHHCC
Q ss_conf             4401111121012420256304653430002323567788878-----875144
Q gi|254780206|r  124 SDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQ  172 (424)
Q Consensus       124 ~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~-----~~~~~~  172 (424)
                      .+.+++..++..-.--+++-+.+-..|+|.+++.+.+-+..++     .++|..
T Consensus        12 ~~k~~LiR~V~~~dg~v~~D~~~k~~GRGAyv~~~~~c~~~A~~k~~l~ra~k~   65 (79)
T cd00279          12 KPKKELIRFVAGPEGEVVPDPTGKLPGRGAYVCADRECIEKAKKKKLFNRAFKA   65 (79)
T ss_pred             CCHHHHHEEEECCCCEEEECCCCCCCCCEEEECCCHHHHHHHHHHCHHHHHHCC
T ss_conf             696774155877998099898888787878987999999999982956798789


No 417
>PRK03317 histidinol-phosphate aminotransferase; Provisional
Probab=47.01  E-value=20  Score=15.82  Aligned_cols=19  Identities=21%  Similarity=0.295  Sum_probs=10.4

Q ss_pred             CHHHHHHHHHHHCCCEEEE
Q ss_conf             9899999998718979999
Q gi|254780206|r   50 NHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus        50 d~~~i~~~a~~~~iDlviv   68 (424)
                      |.+++++.+.+++++++++
T Consensus       148 d~d~l~~ai~~~~~klv~l  166 (369)
T PRK03317        148 DVDAAVAAIREHRPDVVFL  166 (369)
T ss_pred             CHHHHHHHHHCCCCCEEEE
T ss_conf             9999999863269858997


No 418
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]
Probab=46.94  E-value=20  Score=15.81  Aligned_cols=23  Identities=26%  Similarity=0.576  Sum_probs=19.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC
Q ss_conf             95899886588999999998589
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSP   23 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~   23 (424)
                      |||+|+|.|+----++..|.+.+
T Consensus         1 mkI~IlGaGAvG~l~g~~L~~~g   23 (307)
T COG1893           1 MKILILGAGAIGSLLGARLAKAG   23 (307)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCC
T ss_conf             95999878789999999998589


No 419
>PRK06179 short chain dehydrogenase; Provisional
Probab=46.77  E-value=20  Score=15.79  Aligned_cols=63  Identities=24%  Similarity=0.395  Sum_probs=38.6

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHH---CCEEEECCCCCHHHHHHHHHHH-----CCCEEE
Q ss_conf             8998865-889999999985899678999549835751---1705512878989999999871-----897999
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQ---HAQCVAIDIQNHSAIIHFCQEK-----HIDLVV   67 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~---~~~~~~i~~~d~~~i~~~a~~~-----~iDlvi   67 (424)
                      +||-|.+ |--.|+|..|.+...  +|+..--|.....   ..+.+..|.+|.+++.+++++.     ++|..|
T Consensus         7 alITGassGIG~a~A~~la~~G~--~V~~~~r~~~~~~~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~g~iDiLV   78 (270)
T PRK06179          7 ALVTGASSGIGRATAEALARAGY--RVFGTSRNPARATPIPGVELLELDVTDDASVQAAVQEVIARAGRIDVLV   78 (270)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99907246999999999998799--9999968977730548978999107999999999999999839988899


No 420
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional
Probab=46.72  E-value=20  Score=15.79  Aligned_cols=170  Identities=23%  Similarity=0.331  Sum_probs=78.0

Q ss_pred             EEEEECCCHHH----HHHHHHHHHCCCCCEEEEECCC-------HHHH-HC-CEEEECCCCCHH-----HHHHHHHHHCC
Q ss_conf             58998865889----9999999858996789995498-------3575-11-705512878989-----99999987189
Q gi|254780206|r    2 RVLLIGSGGRE----HALAWKIAQSPLLSELWSIPGN-------PGIA-QH-AQCVAIDIQNHS-----AIIHFCQEKHI   63 (424)
Q Consensus         2 kILviGsGgrE----hAl~~~l~~s~~~~~v~~~pgN-------~g~~-~~-~~~~~i~~~d~~-----~i~~~a~~~~i   63 (424)
                      |||+.=+||-.    --|+..|.+...  +|.|+.-.       |-+. .+ ...+..|..+.+     .-+++++.  .
T Consensus        73 kIlLgVtGsIAAYKa~~LvR~L~k~Ga--~V~vvmT~~A~~FVtplt~~~ls~~~V~tdl~~~~~~~~~~HI~La~~--A  148 (476)
T PRK13982         73 RITLIIGGGIAAYKALDLIRRLKERGA--EVRCVLTKAAQQFVTPLTASALSGQRVYTDLFDPESEFDAGHIRLARD--C  148 (476)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHHCCC--EEEEEECHHHHHHCCHHHHHHHHCCCEECCCCCCCCCCCCCHHHHHHH--C
T ss_conf             799996748999999999999997899--899997877863418999999839977702678765677765144144--4


Q ss_pred             CEEEECCCHH-----HHHHHHHHHH-----HCCCCEE-ECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHH
Q ss_conf             7999979557-----8748998986-----0588067-010666555201023578887653101111223440111112
Q gi|254780206|r   64 DLVVVGPELP-----LVNGISDALN-----AAGFKVF-GPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQY  132 (424)
Q Consensus        64 DlvivgpE~p-----L~~gi~d~l~-----~~gi~v~-Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~  132 (424)
                      |+++|.|-..     ++.|++|-|-     ...-|++ .|....            -|.++         -. ..+-.+.
T Consensus       149 DlilVAPATAN~IaK~A~GiADdllst~~LA~~~pvliaPAMN~------------~Mw~n---------pa-tq~Ni~~  206 (476)
T PRK13982        149 DLIVVAPATADLMAKMANGLADDLASAILLAANRPILLAPAMNP------------LMWNN---------PA-TRRNVAQ  206 (476)
T ss_pred             CEEEECCCCHHHHHHHHCCCCCHHHHHHHHHCCCCEEEEECCCH------------HHHHC---------HH-HHHHHHH
T ss_conf             99998238999999997566556999999865997799958299------------98869---------99-9999999


Q ss_pred             HHCCCCEEEEEEC-C-CC-CC-CCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCC
Q ss_conf             1012420256304-6-53-43-00023235677888788751445317778877520575234421577631035200
Q gi|254780206|r  133 VQNKSMPIVVKAD-G-LC-AG-KGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTAR  206 (424)
Q Consensus       133 ~~~~g~PvVVKp~-~-~a-gG-kGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~~~~~l~~~~  206 (424)
                      +.+.|+ .+|-|. | ++ .| .|.-...+.++...+++..+....     ++.+.|..+   .++-|-+.-++-++|
T Consensus       207 L~~~G~-~ii~P~~G~lA~cge~G~GRl~ep~~Iv~~i~~~l~~~~-----~~~L~GkkV---LITAGpT~E~IDPVR  275 (476)
T PRK13982        207 LKRDGV-HMIGPNAGEMAERGEAGVGRMAEPLEIAAAAEALLRPPQ-----PKPLAGRRV---LITAGPTHEPIDPVR  275 (476)
T ss_pred             HHCCCC-EECCCCCCCHHCCCCCCCCCCCCHHHHHHHHHHHHHCCC-----CCCCCCCEE---EEECCCCCEEECCCC
T ss_conf             861498-845886660120466577889999999999999872145-----555679889---996688712226745


No 421
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
Probab=46.66  E-value=20  Score=15.78  Aligned_cols=26  Identities=23%  Similarity=0.341  Sum_probs=13.5

Q ss_pred             CCHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             89899999998718979999795578
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      .+.+++++.+.+.++|++++|--.|.
T Consensus        86 ~~~~~i~~~I~~~~~div~vglG~Pk  111 (171)
T cd06533          86 EEEEEIIERINASGADILFVGLGAPK  111 (171)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCH
T ss_conf             66899999998649999999679828


No 422
>PRK10538 3-hydroxy acid dehydrogenase; Provisional
Probab=46.60  E-value=20  Score=15.78  Aligned_cols=65  Identities=20%  Similarity=0.289  Sum_probs=42.0

Q ss_pred             CEEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH-----HHCC---EEEECCCCCHHHHHHHHHHH-----CCCEE
Q ss_conf             958998865-8899999999858996789995498357-----5117---05512878989999999871-----89799
Q gi|254780206|r    1 MRVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI-----AQHA---QCVAIDIQNHSAIIHFCQEK-----HIDLV   66 (424)
Q Consensus         1 MkILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~-----~~~~---~~~~i~~~d~~~i~~~a~~~-----~iDlv   66 (424)
                      |-|||-|++ |--.|+|.+|.+...  +|++.--|..-     .++.   ..+..|..|.+++.+++.+.     .+|..
T Consensus         1 mVvlVTGassGIG~a~A~~la~~Ga--~Vv~~~r~~~~l~~l~~~lg~~~~~~~~Dvsd~~~v~~~~~~~~~~~g~iDiL   78 (248)
T PRK10538          1 MIVLVTGATAGFGECITRRFIQNGH--KVIATGRRQERLQELKDELGDNLYIAQLDVRNRAAIEEMLASLPAEWRNIDIL   78 (248)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             9999988866999999999998799--99999899999999999848867999973488899999999999970997599


Q ss_pred             E
Q ss_conf             9
Q gi|254780206|r   67 V   67 (424)
Q Consensus        67 i   67 (424)
                      |
T Consensus        79 V   79 (248)
T PRK10538         79 V   79 (248)
T ss_pred             E
T ss_conf             9


No 423
>PRK07454 short chain dehydrogenase; Provisional
Probab=46.42  E-value=20  Score=15.76  Aligned_cols=65  Identities=22%  Similarity=0.225  Sum_probs=38.5

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEEEECCCHHH-H----H------CCEEEECCCCCHHHHHHHHHHH-----C
Q ss_conf             958998865--8899999999858996789995498357-5----1------1705512878989999999871-----8
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELWSIPGNPGI-A----Q------HAQCVAIDIQNHSAIIHFCQEK-----H   62 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~~~pgN~g~-~----~------~~~~~~i~~~d~~~i~~~a~~~-----~   62 (424)
                      ||+-||-++  |--.|+|.+|.+...  +|++.--|..- .    +      ....+..|..|.+++.+++++.     .
T Consensus         6 mKvalITGas~GIG~a~A~~la~~G~--~V~l~~R~~~~l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~   83 (241)
T PRK07454          6 MPTALITGASRGIGKATALAFAKAGW--DLALVARSQDALEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLEQFGC   83 (241)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHCCC
T ss_conf             98899917587899999999998799--8999989999999999999965992899995189999999999999997599


Q ss_pred             CCEEE
Q ss_conf             97999
Q gi|254780206|r   63 IDLVV   67 (424)
Q Consensus        63 iDlvi   67 (424)
                      ||..|
T Consensus        84 iDiLV   88 (241)
T PRK07454         84 PSVLI   88 (241)
T ss_pred             CCEEE
T ss_conf             88999


No 424
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms]
Probab=46.35  E-value=20  Score=15.82  Aligned_cols=31  Identities=19%  Similarity=0.347  Sum_probs=23.1

Q ss_pred             CEEEEECCCHHHH-----HHHHHHHHCCCCCEEEEEC
Q ss_conf             9589988658899-----9999998589967899954
Q gi|254780206|r    1 MRVLLIGSGGREH-----ALAWKIAQSPLLSELWSIP   32 (424)
Q Consensus         1 MkILviGsGgrEh-----Al~~~l~~s~~~~~v~~~p   32 (424)
                      ||||+++.|.+-|     ||+++|++....- +|.+.
T Consensus         2 mkil~~~~~~~Ghv~p~~aL~~eL~~~gheV-~~~~~   37 (406)
T COG1819           2 MKILFVVCGAYGHVNPCLALGKELRRRGHEV-VFAST   37 (406)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHCCCEE-EEEEC
T ss_conf             5799981776432266699999999769749-99737


No 425
>TIGR01069 mutS2 MutS2 family protein; InterPro: IPR005747   Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication . MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base . MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch . MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level . Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.    MutS is a modular protein with a complex structure , and is composed of:    N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.    Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions . Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts .    This entry represents a family of MutS proteins.; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0045005 maintenance of fidelity during DNA-dependent DNA replication.
Probab=46.32  E-value=6.5  Score=19.36  Aligned_cols=21  Identities=10%  Similarity=0.153  Sum_probs=9.1

Q ss_pred             EEECCCHHHHHHHHHHHHHCC
Q ss_conf             996289899999999998525
Q gi|254780206|r  378 TALGKTITESRELAYHMVENI  398 (424)
Q Consensus       378 v~~g~~l~eA~~~ay~~i~~I  398 (424)
                      -..|+..++|.+...+.++.+
T Consensus       760 DlRG~R~E~Al~~LeK~l~~A  780 (834)
T TIGR01069       760 DLRGERSEEALDRLEKFLDDA  780 (834)
T ss_pred             CCCCCHHHHHHHHHHHHHHHH
T ss_conf             345302799999999999999


No 426
>PRK13139 consensus
Probab=46.29  E-value=21  Score=15.74  Aligned_cols=17  Identities=18%  Similarity=0.253  Sum_probs=7.0

Q ss_pred             HHHHHHHHHCCCEEEEC
Q ss_conf             99999987189799997
Q gi|254780206|r   53 AIIHFCQEKHIDLVVVG   69 (424)
Q Consensus        53 ~i~~~a~~~~iDlvivg   69 (424)
                      .++....+..+|++=+|
T Consensus        34 ~~~~~l~~~GaDiiElG   50 (254)
T PRK13139         34 EVIRAMVAGGVDLMELQ   50 (254)
T ss_pred             HHHHHHHHCCCCEEEEC
T ss_conf             99999996699999978


No 427
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=46.21  E-value=21  Score=15.74  Aligned_cols=11  Identities=27%  Similarity=0.374  Sum_probs=5.4

Q ss_pred             CCCCCCCCHHH
Q ss_conf             34300023235
Q gi|254780206|r  148 CAGKGVVVAAT  158 (424)
Q Consensus       148 agGkGV~i~~~  158 (424)
                      +||-|+.-...
T Consensus        95 aGG~GiaPl~~  105 (233)
T cd06220          95 GGGIGIAPLAP  105 (233)
T ss_pred             ECCEEHHHHHH
T ss_conf             17464677799


No 428
>pfam00390 malic Malic enzyme, N-terminal domain.
Probab=46.19  E-value=18  Score=16.13  Aligned_cols=26  Identities=31%  Similarity=0.638  Sum_probs=15.6

Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             575234421577631035200011135665444443443
Q gi|254780206|r  186 FEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMG  224 (424)
Q Consensus       186 ~E~Sv~~i~dG~~~~~l~~~~dyKr~~~~d~GpnTGGMG  224 (424)
                      .++.+.+++||+.++-|           ||.|  ++|||
T Consensus        65 ~~v~~iVVTDGerILGL-----------GDlG--~~Gm~   90 (182)
T pfam00390        65 EDVRVIVVTDGERILGL-----------GDLG--VAGMP   90 (182)
T ss_pred             CCCEEEEEECCCCCCCC-----------CCCC--CCCCC
T ss_conf             67359998567301466-----------7656--57650


No 429
>PRK13124 consensus
Probab=46.16  E-value=21  Score=15.73  Aligned_cols=99  Identities=18%  Similarity=0.238  Sum_probs=46.8

Q ss_pred             CCCHHHHHHHHHHH----CCCEEEECCCHHH-HHHH---HHHHHHCCCC-EEECCHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             78989999999871----8979999795578-7489---9898605880-670106665552010235788876531011
Q gi|254780206|r   48 IQNHSAIIHFCQEK----HIDLVVVGPELPL-VNGI---SDALNAAGFK-VFGPSQRAAKLESSKSFAKKFCTKYGIPTA  118 (424)
Q Consensus        48 ~~d~~~i~~~a~~~----~iDlvivgpE~pL-~~gi---~d~l~~~gi~-v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~  118 (424)
                      -.+.+.+.+++++.    ++-+++-+=-.|+ .-|+   +..+.+.|+. ++-|.--   +|-+..+ ++.++++|+...
T Consensus        67 G~~~~~~~~~~~~~r~~~~~pivlM~Y~N~i~~~G~e~F~~~~~~~Gv~GvIipDLP---~eE~~~~-~~~~~~~gl~~I  142 (257)
T PRK13124         67 GMNIVKAMELVGKMRKKVTIPIVYFTYYNPVLQYGLEKFFALARENGIDGLLIPDLP---LEESGEL-QEICDKYGIYLI  142 (257)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCEEEEEHHHHHHHHHHHHHHHHHHHCCCCEEECCCCC---HHHHHHH-HHHHHHCCCCEE
T ss_conf             996899999999852447888899750078987579999999997599847778999---7999999-999986687357


Q ss_pred             CCCCCCCCHHHHHHHHC-CCCEEEEEECCCCCC
Q ss_conf             11223440111112101-242025630465343
Q gi|254780206|r  119 TYQHFSDPMKAKQYVQN-KSMPIVVKADGLCAG  150 (424)
Q Consensus       119 ~~~~~~~~~ea~~~~~~-~g~PvVVKp~~~agG  150 (424)
                      .+..-++.+.+...++. -||=+.|=-.|..|.
T Consensus       143 ~lvaPTs~~Ri~~i~~~s~gFiY~vs~~GvTG~  175 (257)
T PRK13124        143 PLVAPTSKERIKKIAEQAEGFVYCVSSLGVTGV  175 (257)
T ss_pred             EEECCCCHHHHHHHHHCCCCCEEEEECCCCCCC
T ss_conf             884799679999998548983899624666787


No 430
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional
Probab=45.93  E-value=21  Score=15.71  Aligned_cols=21  Identities=24%  Similarity=0.390  Sum_probs=14.2

Q ss_pred             CHHHHHHHHCCCCEEEEEECC
Q ss_conf             011111210124202563046
Q gi|254780206|r  126 PMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus       126 ~~ea~~~~~~~g~PvVVKp~~  146 (424)
                      .+...+..+..+.|++||-.|
T Consensus       175 l~~I~~i~~~~~vPVIvKeVG  195 (351)
T PRK05437        175 LDRIAEIVSALPVPVIVKEVG  195 (351)
T ss_pred             HHHHHHHHHHCCCCEEEEECC
T ss_conf             999999998679988985215


No 431
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]
Probab=45.89  E-value=21  Score=15.70  Aligned_cols=77  Identities=16%  Similarity=0.280  Sum_probs=47.2

Q ss_pred             CEEEEECCCHHH-HHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHHHHHHH
Q ss_conf             958998865889-9999999858996789995498357511705512878989999999871897999979557874899
Q gi|254780206|r    1 MRVLLIGSGGRE-HALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPLVNGIS   79 (424)
Q Consensus         1 MkILviGsGgrE-hAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~gi~   79 (424)
                      |+||||..-+-- +.|...|..++.++-|..+                 .|-...++.+++.++|.+...-|-|-.+|+-
T Consensus         2 irVlvVddsal~R~~i~~~l~~~~~i~vv~~a-----------------~ng~~a~~~~~~~~PDVi~ld~emp~mdgl~   64 (350)
T COG2201           2 IRVLVVDDSALMRKVISDILNSDPDIEVVGTA-----------------RNGREAIDKVKKLKPDVITLDVEMPVMDGLE   64 (350)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEEC-----------------CCHHHHHHHHHHCCCCEEEEECCCCCCCHHH
T ss_conf             47999858199999999998308973799733-----------------7879999999722997899725664454799


Q ss_pred             ---HHHHHCCCCEEECCH
Q ss_conf             ---898605880670106
Q gi|254780206|r   80 ---DALNAAGFKVFGPSQ   94 (424)
Q Consensus        80 ---d~l~~~gi~v~Gp~~   94 (424)
                         ..++....||+--+.
T Consensus        65 ~l~~im~~~p~pVimvss   82 (350)
T COG2201          65 ALRKIMRLRPLPVIMVSS   82 (350)
T ss_pred             HHHHHHCCCCCCEEEEEC
T ss_conf             999984479986899951


No 432
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent.
Probab=45.89  E-value=21  Score=15.70  Aligned_cols=62  Identities=21%  Similarity=0.279  Sum_probs=36.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHH-HHCCEEEE--CCCCCHHHHHHHHHHHCCCEEEEC
Q ss_conf             589988658899999999858996789995498357-51170551--287898999999987189799997
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI-AQHAQCVA--IDIQNHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~-~~~~~~~~--i~~~d~~~i~~~a~~~~iDlvivg   69 (424)
                      ||.+||.|---+||+..|.++.. +.+++..-|+.. ..+.+...  +...|.+++++     +-|++|.+
T Consensus         1 KIg~IG~G~mg~ai~~~l~~~g~-~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~DvIila   65 (93)
T pfam03807         1 KIGIIGAGNMGEALARGLAAAGH-EVIIANSRNPEKAAALAEELGVGATAVSNEEAAE-----EADVVILA   65 (93)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCC-CCEEEECCCHHHHHHHHHHHCCCCCCCCHHHHHH-----CCCEEEEE
T ss_conf             98999700999999999997799-6127864878999999998199764589999974-----49989999


No 433
>pfam03808 Glyco_tran_WecB Glycosyl transferase WecB/TagA/CpsF family.
Probab=45.86  E-value=21  Score=15.70  Aligned_cols=18  Identities=39%  Similarity=0.464  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHCCCEEEEC
Q ss_conf             999999987189799997
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivg   69 (424)
                      +++++.+.+.++|++++|
T Consensus        91 ~~i~~~I~~~~~div~vg  108 (172)
T pfam03808        91 EAIIEAINASGPDLLFVG  108 (172)
T ss_pred             HHHHHHHHHCCCCEEEEE
T ss_conf             999999984599999995


No 434
>PRK13129 consensus
Probab=45.57  E-value=21  Score=15.67  Aligned_cols=19  Identities=11%  Similarity=0.053  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHCCCCCCCCC
Q ss_conf             7888765310111122344
Q gi|254780206|r  107 KKFCTKYGIPTATYQHFSD  125 (424)
Q Consensus       107 K~~l~~~gIPt~~~~~~~~  125 (424)
                      ++.++++|+.......-++
T Consensus       141 ~~~~~~~gl~~I~lvaPtt  159 (267)
T PRK13129        141 SPIAAERGIDLILLVAPTT  159 (267)
T ss_pred             HHHHHHCCCEEEEEECCCC
T ss_conf             9999853981689948999


No 435
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only]
Probab=45.52  E-value=21  Score=15.66  Aligned_cols=86  Identities=23%  Similarity=0.278  Sum_probs=43.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECC-CHHHHH-CCEEEEC-CCCCHHHHHHHHHHHCCCEEEE--CCCHHHH
Q ss_conf             958998865889999999985899678999549-835751-1705512-8789899999998718979999--7955787
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPG-NPGIAQ-HAQCVAI-DIQNHSAIIHFCQEKHIDLVVV--GPELPLV   75 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pg-N~g~~~-~~~~~~i-~~~d~~~i~~~a~~~~iDlviv--gpE~pL~   75 (424)
                      |||.+||.|+--..++..+...+..-+.+.+++ +..-.. +...+.. ..++.++.+     ..+|+++=  ++++ .-
T Consensus         1 l~vgiVGcGaIG~~l~e~v~~~~~~~e~v~v~D~~~ek~~~~~~~~~~~~~s~ide~~-----~~~DlvVEaAS~~A-v~   74 (255)
T COG1712           1 LKVGIVGCGAIGKFLLELVRDGRVDFELVAVYDRDEEKAKELEASVGRRCVSDIDELI-----AEVDLVVEAASPEA-VR   74 (255)
T ss_pred             CEEEEEECCHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHCCCCCCCCHHHHH-----HCCCEEEEECCHHH-HH
T ss_conf             9578982337889999998668864369999448878888888603887635677773-----02442543078899-99


Q ss_pred             HHHHHHHHHCCCCEEECC
Q ss_conf             489989860588067010
Q gi|254780206|r   76 NGISDALNAAGFKVFGPS   93 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~   93 (424)
                      .-+.+.| ++|+.|+=-|
T Consensus        75 e~~~~~L-~~g~d~iV~S   91 (255)
T COG1712          75 EYVPKIL-KAGIDVIVMS   91 (255)
T ss_pred             HHHHHHH-HCCCCEEEEE
T ss_conf             9869999-6599889995


No 436
>PRK13114 consensus
Probab=45.52  E-value=21  Score=15.66  Aligned_cols=98  Identities=14%  Similarity=0.197  Sum_probs=43.5

Q ss_pred             CHHHHHHHHHH---H--CCCEEEECCCHHH-HHH---HHHHHHHCCCCE-EECCHHHHHHHHCCHHHHHHHHHHHHHCCC
Q ss_conf             98999999987---1--8979999795578-748---998986058806-701066655520102357888765310111
Q gi|254780206|r   50 NHSAIIHFCQE---K--HIDLVVVGPELPL-VNG---ISDALNAAGFKV-FGPSQRAAKLESSKSFAKKFCTKYGIPTAT  119 (424)
Q Consensus        50 d~~~i~~~a~~---~--~iDlvivgpE~pL-~~g---i~d~l~~~gi~v-~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~  119 (424)
                      ..+.+.+++++   .  ++-+++-+=-.|+ .-|   ++..+.+.|+.= +-|.--   .|-+..| ++.++++||....
T Consensus        73 ~l~~~f~~v~~~r~~~~~~PivlM~Y~N~i~~~G~~~F~~~~~~aGvdG~IipDLP---~eE~~~~-~~~~~~~gi~~I~  148 (266)
T PRK13114         73 TTADIFRIAAEFRQRHPEVPLVLMGYANPMVRRGPDWFAAECKKAGVDGVICVDIP---PEEDAEL-GPALRAAGIDPIR  148 (266)
T ss_pred             CHHHHHHHHHHHHHCCCCCCEEEEEEHHHHHHHHHHHHHHHHHHCCCCEEEECCCC---HHHHHHH-HHHHHHCCCCEEE
T ss_conf             79999999999874189988799863019998649999999997499779845899---7888999-9999974997267


Q ss_pred             CCCCCCCH-HHHHHHH-CCCCEEEEEECCCCCCC
Q ss_conf             12234401-1111210-12420256304653430
Q gi|254780206|r  120 YQHFSDPM-KAKQYVQ-NKSMPIVVKADGLCAGK  151 (424)
Q Consensus       120 ~~~~~~~~-ea~~~~~-~~g~PvVVKp~~~agGk  151 (424)
                      ...-++.+ -+.+.++ .-||=+.|=-.|..|.+
T Consensus       149 liaPtt~~~Ri~~i~~~a~gFiY~vs~~GvTG~~  182 (266)
T PRK13114        149 LATPTTDAARLPAVLEGASGFLYYVSVAGITGMQ  182 (266)
T ss_pred             EECCCCCHHHHHHHHHHCCCCEEEEECCCCCCCC
T ss_conf             7569997999999997389958998445566776


No 437
>PRK07024 short chain dehydrogenase; Provisional
Probab=45.47  E-value=21  Score=15.66  Aligned_cols=64  Identities=20%  Similarity=0.303  Sum_probs=39.9

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCH-HHHH----C----CEEEECCCCCHHHHHHHHHH-----HCCCEE
Q ss_conf             58998865-88999999998589967899954983-5751----1----70551287898999999987-----189799
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNP-GIAQ----H----AQCVAIDIQNHSAIIHFCQE-----KHIDLV   66 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~-g~~~----~----~~~~~i~~~d~~~i~~~a~~-----~~iDlv   66 (424)
                      ||||.|.. |--.|+|..|.+...  +|+++--|. ....    +    ...+..|..|.+++.+++++     ..||.+
T Consensus         4 ~VlITGassGIG~a~A~~la~~G~--~v~l~~R~~~~L~~~~~~~~~~~~~~~~~Dv~d~~~~~~~~~~~~~~~g~iDil   81 (256)
T PRK07024          4 KVFITGASSGIGQALAREYARQGA--TLGLVARRTDALQAFAARLPKARVSVYAADVRDADALAAAAADFIAAHGCPDVV   81 (256)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCEE
T ss_conf             899984602999999999998899--899998988999999997679976999811799999999999999983998799


Q ss_pred             E
Q ss_conf             9
Q gi|254780206|r   67 V   67 (424)
Q Consensus        67 i   67 (424)
                      |
T Consensus        82 i   82 (256)
T PRK07024         82 I   82 (256)
T ss_pred             E
T ss_conf             9


No 438
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I; InterPro: IPR011775    This entry represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll . This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria. It is also found in certain archaea not known to make chlorins.; GO: 0005524 ATP binding, 0016851 magnesium chelatase activity, 0006779 porphyrin biosynthetic process.
Probab=45.42  E-value=9.8  Score=18.08  Aligned_cols=50  Identities=24%  Similarity=0.468  Sum_probs=34.0

Q ss_pred             EEEEEEEEEEECCEEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEE----EEEECCCCCCC
Q ss_conf             66445448985570489998865147751044332654411566654201333321234444206----75422544668
Q gi|254780206|r  260 QGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYAL----TVVVATKGYPE  335 (424)
Q Consensus       260 ~G~l~~~~m~t~~gp~viE~N~R~GDPE~q~ilp~L~~dl~~il~~~~~g~L~~~~~~~~~~~~v----~Vvlas~GYP~  335 (424)
                      ||+||+|           |+|             +|+..|+|+|++++.+-.|-++   +++-|+    =-||+--|=|+
T Consensus       135 RG~LYiD-----------EVN-------------LLeDHlVDvLLDvAasG~NvVE---REG~SiRHPARFVLVGSGNPE  187 (340)
T TIGR02030       135 RGYLYID-----------EVN-------------LLEDHLVDVLLDVAASGVNVVE---REGVSIRHPARFVLVGSGNPE  187 (340)
T ss_pred             CCCEEEE-----------EEH-------------HHHHHHHHHHHHHCCCCCEEEE---ECCEEEECCCCEEEECCCCCC
T ss_conf             7842552-----------100-------------0124566566522047830586---356023037635871578887


Q ss_pred             C
Q ss_conf             7
Q gi|254780206|r  336 E  336 (424)
Q Consensus       336 ~  336 (424)
                      .
T Consensus       188 E  188 (340)
T TIGR02030       188 E  188 (340)
T ss_pred             C
T ss_conf             6


No 439
>PRK06500 short chain dehydrogenase; Provisional
Probab=45.33  E-value=21  Score=15.64  Aligned_cols=64  Identities=19%  Similarity=0.145  Sum_probs=37.4

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH-----HHC---CEEEECCCCCHHHHHHHHHHH-----CCCEEE
Q ss_conf             58998865-8899999999858996789995498357-----511---705512878989999999871-----897999
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI-----AQH---AQCVAIDIQNHSAIIHFCQEK-----HIDLVV   67 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~-----~~~---~~~~~i~~~d~~~i~~~a~~~-----~iDlvi   67 (424)
                      .+||-|++ |--.|+|+.|.+...  +|++..-|+..     ..+   ...+..|..|.+.+.+++++.     +||..|
T Consensus         8 ~~lITGas~GIG~aiA~~la~~Ga--~V~i~~r~~~~l~~~~~~l~~~~~~~~~Dv~~~~~~~~~~~~~~~~~g~iDiLv   85 (249)
T PRK06500          8 TALITGGTSGIGLETARQFAAEGA--RVAITGRDAATLEAARAELGEDALVIRNDAGSVAAQRALAQALAEAGGRLDAVF   85 (249)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             899937687899999999998799--999996998999999998589759999517999999999999999769998999


No 440
>PRK00439 leuD 3-isopropylmalate dehydratase small subunit; Reviewed
Probab=45.30  E-value=21  Score=15.64  Aligned_cols=32  Identities=6%  Similarity=0.141  Sum_probs=11.4

Q ss_pred             EEEECCCHHHHHCCEEEECCCCCHHHHHHHHH
Q ss_conf             99954983575117055128789899999998
Q gi|254780206|r   28 LWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQ   59 (424)
Q Consensus        28 v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~   59 (424)
                      +|+.-+|-.|..+..-......|.+++.+++-
T Consensus         4 v~~~GDnIdTD~I~P~~~l~~~~~~~l~~~~f   35 (163)
T PRK00439          4 VWKFGDNIDTDVIIPGRYLNTSDPDELAKHAM   35 (163)
T ss_pred             EEECCCCCCHHHCCCHHHHCCCCHHHHHHHCC
T ss_conf             68779998864375276656599778877413


No 441
>PRK06718 precorrin-2 dehydrogenase; Reviewed
Probab=45.30  E-value=21  Score=15.64  Aligned_cols=24  Identities=21%  Similarity=0.277  Sum_probs=14.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             958998865889999999985899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPL   24 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~   24 (424)
                      .+|||||+|.-...=+..|.+...
T Consensus        11 k~vLVVGGG~vA~rK~~~Ll~~gA   34 (202)
T PRK06718         11 KRVVIVGGGKVAGRRAITLLKYGA   34 (202)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC
T ss_conf             869998898999999999986899


No 442
>cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit. A group of proteins similar to the alpha subunit of the MoFe protein of the molybdenum (Mo-) nitrogenase. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen to ammonia. The Mo-nitrogenase is the most widespread and best characterized of these systems.  Mo-nitrogenase consists of the MoFe protein (component 1) and the Fe protein (component 2).  MoFe is an alpha2beta2 tetramer. Each alphabeta pair of MoFe contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha subunit. The Fe protein contains a single [4Fe-4S] cluster.  Electrons are transferred from the [4Fe-4S] cluster of the Fe protein to the P-cluster of the MoFe and in turn to FeMoCo, the site of substrate reduction.
Probab=45.16  E-value=21  Score=15.63  Aligned_cols=95  Identities=14%  Similarity=0.139  Sum_probs=50.3

Q ss_pred             HHHHHHHHHHCC-CEEEECCC---HHH---HHHHHHHHHH-CCCCEE---ECCHHH-HHHHHCCHHHHHHHHHH---H--
Q ss_conf             999999987189-79999795---578---7489989860-588067---010666-55520102357888765---3--
Q gi|254780206|r   52 SAIIHFCQEKHI-DLVVVGPE---LPL---VNGISDALNA-AGFKVF---GPSQRA-AKLESSKSFAKKFCTKY---G--  114 (424)
Q Consensus        52 ~~i~~~a~~~~i-DlvivgpE---~pL---~~gi~d~l~~-~gi~v~---Gp~~~a-a~le~sK~~~K~~l~~~---g--  114 (424)
                      +++.+..++.++ ..++|...   .-+   ..+++..+++ .|+||+   +|+-.. ++-.+.+.....+++..   .  
T Consensus        88 ~aI~ea~~~~~P~kaIfV~sTC~~glIGDDI~aV~~~~~~~~gipVIpv~~~GF~g~s~~~G~~~a~~al~~~vv~~~~~  167 (421)
T cd01976          88 KAIDEAYELFPLNKGISVQSECPVGLIGDDIEAVARKASKELGIPVVPVRCEGFRGVSQSLGHHIANDAIRDHILGKRNE  167 (421)
T ss_pred             HHHHHHHHHCCCCEEEEEEECCCHHHHCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999998579730899992373786556899999998775299889986898577523068899999999984166887


Q ss_pred             -HHCC-------CCCCCCCCHHHHHHHHCCCCEEEEEECC
Q ss_conf             -1011-------1122344011111210124202563046
Q gi|254780206|r  115 -IPTA-------TYQHFSDPMKAKQYVQNKSMPIVVKADG  146 (424)
Q Consensus       115 -IPt~-------~~~~~~~~~ea~~~~~~~g~PvVVKp~~  146 (424)
                       -|+|       .|....+..+....++++|.-++..-.|
T Consensus       168 ~~~~~~~iNiige~ni~gd~~~i~~lL~~mGi~V~~~~tg  207 (421)
T cd01976         168 FEPTPYDVNIIGDYNIGGDAWASRILLEEMGLRVVAQWSG  207 (421)
T ss_pred             CCCCCCCEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEEC
T ss_conf             7889841799755667632999999999839837999808


No 443
>KOG2157 consensus
Probab=45.14  E-value=13  Score=17.08  Aligned_cols=32  Identities=19%  Similarity=0.345  Sum_probs=26.4

Q ss_pred             CCCEEEEEECCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             24202563046534300023235677888788
Q gi|254780206|r  136 KSMPIVVKADGLCAGKGVVVAATVDEATSAID  167 (424)
Q Consensus       136 ~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~  167 (424)
                      -....++||.+.+-|+|+++..+.++....+.
T Consensus       198 ~~~~wIvKP~~~srg~GI~~~~~l~~l~~~~~  229 (497)
T KOG2157         198 ERSWWIVKPASKSRGRGIFLFNTLSDLQAIVD  229 (497)
T ss_pred             CCCEEEECCCCCCCCCEEEEECCHHHHHHHHH
T ss_conf             46668964432101652688623566565431


No 444
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional
Probab=44.99  E-value=19  Score=16.05  Aligned_cols=21  Identities=5%  Similarity=-0.133  Sum_probs=12.0

Q ss_pred             EEEECCCHHHHHHHHHHHHHC
Q ss_conf             999628989999999999852
Q gi|254780206|r  377 ATALGKTITESRELAYHMVEN  397 (424)
Q Consensus       377 vv~~g~~l~eA~~~ay~~i~~  397 (424)
                      ....-++|++|.++.-+-+..
T Consensus       494 yaps~e~L~EA~~RI~~FL~~  514 (518)
T PRK13355        494 YLPRLGMLEETMDELDDFFSY  514 (518)
T ss_pred             ECCCHHHHHHHHHHHHHHHHH
T ss_conf             279999999999999999998


No 445
>PRK08017 short chain dehydrogenase; Provisional
Probab=44.97  E-value=21  Score=15.61  Aligned_cols=56  Identities=20%  Similarity=0.232  Sum_probs=33.6

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH-HH----CCEEEECCCCCHHHHHHHHHH
Q ss_conf             8998865-8899999999858996789995498357-51----170551287898999999987
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI-AQ----HAQCVAIDIQNHSAIIHFCQE   60 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~-~~----~~~~~~i~~~d~~~i~~~a~~   60 (424)
                      |||.|+. |--.|+|..|.+...  .|+.+--++.- ..    ..+.+.+|..|.+.+.+.+.+
T Consensus         5 vlITGassGIG~a~A~~la~~G~--~V~~~~r~~~~l~~~~~~~~~~~~~D~~~~~~~~~~~~~   66 (256)
T PRK08017          5 VLITGCSSGIGLESALELKRQGF--RVLAGCRKPDDVARMNSMGFTGVLIDLDSPESVDRAADE   66 (256)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHCCCCEEEEECCCHHHHHHHHHH
T ss_conf             99965876899999999998799--999996998999999856994699835898999999999


No 446
>PRK05650 short chain dehydrogenase; Provisional
Probab=44.94  E-value=22  Score=15.60  Aligned_cols=64  Identities=23%  Similarity=0.293  Sum_probs=39.8

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHH----HH-----CCE--EEECCCCCHHHHHHHHHH-----HCCC
Q ss_conf             58998865-8899999999858996789995498357----51-----170--551287898999999987-----1897
Q gi|254780206|r    2 RVLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGI----AQ-----HAQ--CVAIDIQNHSAIIHFCQE-----KHID   64 (424)
Q Consensus         2 kILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~----~~-----~~~--~~~i~~~d~~~i~~~a~~-----~~iD   64 (424)
                      ||||-|.+ |--.|+|..|.+...  +|.++.-|...    ..     ..+  .+..|.+|.+++.+++.+     ..||
T Consensus         2 rVlITGassGIG~alA~~la~~G~--~V~l~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~~~~~~~~v~~~~g~iD   79 (270)
T PRK05650          2 RVMITGAASGLGRAIALRWAREGW--RLALADVNEEGGEETLKELREAGGDGFYQRCDVRDYSQLTALAQACEEKWGGID   79 (270)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             799988764999999999998899--899997988999999999984499289998458999999999999999839977


Q ss_pred             EEE
Q ss_conf             999
Q gi|254780206|r   65 LVV   67 (424)
Q Consensus        65 lvi   67 (424)
                      +.|
T Consensus        80 iLV   82 (270)
T PRK05650         80 VIV   82 (270)
T ss_pred             EEE
T ss_conf             896


No 447
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=44.91  E-value=22  Score=15.60  Aligned_cols=142  Identities=21%  Similarity=0.310  Sum_probs=72.9

Q ss_pred             CEEEEECCCHH-HHHHHHHHHHCCCCCEEEEECCCHHHH----HCCEEEECCCCCHHHHHHHHHHHCCCEEEE-CC----
Q ss_conf             95899886588-999999998589967899954983575----117055128789899999998718979999-79----
Q gi|254780206|r    1 MRVLLIGSGGR-EHALAWKIAQSPLLSELWSIPGNPGIA----QHAQCVAIDIQNHSAIIHFCQEKHIDLVVV-GP----   70 (424)
Q Consensus         1 MkILviGsGgr-EhAl~~~l~~s~~~~~v~~~pgN~g~~----~~~~~~~i~~~d~~~i~~~a~~~~iDlviv-gp----   70 (424)
                      |+|||.|.-|. -.++++.|.+...  .|..+--|+.-.    ...+...-|..+...+...+  ..+|.++. .+    
T Consensus         1 ~~ilV~GatG~~G~~~~~~L~~~~~--~v~~~~r~~~~~~~~~~~v~~~~~d~~~~~~l~~~~--~G~~~~~~i~~~~~~   76 (275)
T COG0702           1 MKILVTGATGFVGGAVVRELLARGH--EVRAAVRNPEAAAALAGGVEVVLGDLRDPKSLVAGA--KGVDGVLLISGLLDG   76 (275)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHCCC--EEEEECCCCHHHHHCCCCCEEECCCCCCCHHHHHHH--CCCEEEEEECCCCCC
T ss_conf             9389986777579999999997598--699973682211110378528845641607799984--894179995254556


Q ss_pred             C----HHHHHHHHHHHHHCC--C------CEEECCH-HHHHHHHCCHHHHHHHHHHHHHCCCCC---CCCCCHHH-HHHH
Q ss_conf             5----578748998986058--8------0670106-665552010235788876531011112---23440111-1121
Q gi|254780206|r   71 E----LPLVNGISDALNAAG--F------KVFGPSQ-RAAKLESSKSFAKKFCTKYGIPTATYQ---HFSDPMKA-KQYV  133 (424)
Q Consensus        71 E----~pL~~gi~d~l~~~g--i------~v~Gp~~-~aa~le~sK~~~K~~l~~~gIPt~~~~---~~~~~~ea-~~~~  133 (424)
                      +    ..-...+++..+..+  .      .++++.. ..+.+..+|..+...+...|+|..-..   .+.+.... ....
T Consensus        77 ~~~~~~~~~~~~~~~a~~a~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~e~~l~~sg~~~t~lr~~~~~~~~~~~~~~~~  156 (275)
T COG0702          77 SDAFRAVQVTAVVRAAEAAGAGVKHGVSLSVLGADAASPSALARAKAAVEAALRSSGIPYTTLRRAAFYLGAGAAFIEAA  156 (275)
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEECCCCHHHHHHH
T ss_conf             63012003678999998627442432687502356688067899999999999856986203556300115305679999


Q ss_pred             HCCCCEEEEEECC
Q ss_conf             0124202563046
Q gi|254780206|r  134 QNKSMPIVVKADG  146 (424)
Q Consensus       134 ~~~g~PvVVKp~~  146 (424)
                      ...+.|+...+.+
T Consensus       157 ~~~~~~~~~~~~~  169 (275)
T COG0702         157 EAAGLPVIPRGIG  169 (275)
T ss_pred             HHCCCCEEECCCC
T ss_conf             8458851412566


No 448
>PRK07538 hypothetical protein; Provisional
Probab=44.84  E-value=22  Score=15.59  Aligned_cols=29  Identities=31%  Similarity=0.450  Sum_probs=19.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEE
Q ss_conf             95899886588999999998589967899
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELW   29 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~   29 (424)
                      |||+|+|.|=---++|..|.+...-..||
T Consensus         1 m~V~IvGaG~aGL~lA~~L~~~Gi~v~V~   29 (413)
T PRK07538          1 MKVLIAGGGIGGLTLALTLHQRGIEVEVF   29 (413)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             98999990589999999999789998999


No 449
>PRK11559 garR tartronate semialdehyde reductase; Provisional
Probab=44.82  E-value=22  Score=15.59  Aligned_cols=34  Identities=24%  Similarity=0.292  Sum_probs=25.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHH
Q ss_conf             958998865889999999985899678999549835
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG   36 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g   36 (424)
                      |||-+||=|-=-.+++..|.+...  +|++.+-++.
T Consensus         2 MkIgfIGlG~MG~~ma~~L~~~G~--~v~v~dr~~~   35 (295)
T PRK11559          2 MKVGFIGLGIMGKPMSKNLLKAGY--SLVVYDRNPE   35 (295)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCC--EEEEEECCHH
T ss_conf             789998405769999999997899--5899929999


No 450
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism]
Probab=44.75  E-value=22  Score=15.58  Aligned_cols=101  Identities=17%  Similarity=0.231  Sum_probs=52.8

Q ss_pred             CCCCHHHHHHHHHHHCCCEEEEC-CCHHH-HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             87898999999987189799997-95578-74899898605880670106665552010235788876531011112234
Q gi|254780206|r   47 DIQNHSAIIHFCQEKHIDLVVVG-PELPL-VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFS  124 (424)
Q Consensus        47 ~~~d~~~i~~~a~~~~iDlvivg-pE~pL-~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~  124 (424)
                      ++..-....+|-++++|++.++- -+.|+ .+-+.+.++..|..+     +.  |-..+.   ..+++.|   -.....+
T Consensus        10 ~C~t~rka~~~L~~~gi~~~~~~~~~~~~s~~eL~~~l~~~g~~~-----~~--li~t~~---~~~r~L~---~~~~~~~   76 (117)
T COG1393          10 NCSTCRKALAWLEEHGIEYTFIDYLKTPPSREELKKILSKLGDGV-----EE--LINTRG---TTYRELN---LDKEDLS   76 (117)
T ss_pred             CCHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHCCCCH-----HH--HHHHCC---CHHHHCC---CCCCCCC
T ss_conf             875899999999986999679882069999999999999848469-----99--987145---0587758---7532358


Q ss_pred             CCHHHHHHHHC---CCCEEEEEECCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             40111112101---2420256304653430002323567788878
Q gi|254780206|r  125 DPMKAKQYVQN---KSMPIVVKADGLCAGKGVVVAATVDEATSAI  166 (424)
Q Consensus       125 ~~~ea~~~~~~---~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~  166 (424)
                      +.+.+...+++   +..|+||.+      +++.+..+.++..+.+
T Consensus        77 ~~~~~~~i~~~~~LikRPivv~~------~~~~iG~~~e~~~~~l  115 (117)
T COG1393          77 DEELIEALLENPSLIKRPIVVDN------KKLRVGFNEEEIRAFL  115 (117)
T ss_pred             HHHHHHHHHHCHHHHCCCEEEEC------CCEEECCCHHHHHHHH
T ss_conf             69999999858344048769859------9468548999999884


No 451
>PRK13302 putative L-aspartate dehydrogenase; Provisional
Probab=44.66  E-value=22  Score=15.57  Aligned_cols=83  Identities=22%  Similarity=0.262  Sum_probs=40.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHC-CCCCEEEEECCCHHHH-HCCEEE--ECCCCCHHHHHHHHHHHCCCEEEE--CCCHHH
Q ss_conf             9589988658899999999858-9967899954983575-117055--128789899999998718979999--795578
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQS-PLLSELWSIPGNPGIA-QHAQCV--AIDIQNHSAIIHFCQEKHIDLVVV--GPELPL   74 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s-~~~~~v~~~pgN~g~~-~~~~~~--~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL   74 (424)
                      |||.+||-|.--..++.+|.+. +.+.-+++...+|+-. ...+..  .....+.+.   ++  ..+|+|+=  ++++  
T Consensus         7 mrVgliG~GaIG~~va~~l~~g~~~~~l~~V~~r~~~~~~~~~~~~~~~~~~~~~~~---l~--~~~DlVVE~A~~~a--   79 (271)
T PRK13302          7 LRVAIAGLGAIGKAIAQALDRGLPGLTLSAVAVRDPQRHADFIWGLRRPPPVVPLDQ---LA--THADIVVEAAPASV--   79 (271)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHHHHHHCCCCCCCCCHHH---HH--HCCCEEEECCCHHH--
T ss_conf             779998867899999999975899818999992887888999873589874078899---60--18999998989899--


Q ss_pred             HHHHHHHHHHCCCCEE
Q ss_conf             7489989860588067
Q gi|254780206|r   75 VNGISDALNAAGFKVF   90 (424)
Q Consensus        75 ~~gi~d~l~~~gi~v~   90 (424)
                      +...+...-+.|..++
T Consensus        80 v~~~~~~~L~~G~dlv   95 (271)
T PRK13302         80 LRAIVEPVLAAGKKAI   95 (271)
T ss_pred             HHHHHHHHHHCCCCEE
T ss_conf             9999999997599789


No 452
>PRK13113 consensus
Probab=44.33  E-value=22  Score=15.54  Aligned_cols=99  Identities=11%  Similarity=0.115  Sum_probs=41.7

Q ss_pred             CCHHHHHHHHHHHC-----CCEEEECCCHHH-HHHH---HHHHHHCCCCE-EECCHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             89899999998718-----979999795578-7489---98986058806-70106665552010235788876531011
Q gi|254780206|r   49 QNHSAIIHFCQEKH-----IDLVVVGPELPL-VNGI---SDALNAAGFKV-FGPSQRAAKLESSKSFAKKFCTKYGIPTA  118 (424)
Q Consensus        49 ~d~~~i~~~a~~~~-----iDlvivgpE~pL-~~gi---~d~l~~~gi~v-~Gp~~~aa~le~sK~~~K~~l~~~gIPt~  118 (424)
                      .+.+.+.+++++.+     +-+++-+=-.|+ .-|+   +..+.+.|+.= +=|.--   .|-++.+ ++.++++||...
T Consensus        76 ~~~~~~~~~v~~~r~~~~~~PivlM~Y~N~i~~~G~e~F~~~~~~~GvdGvIipDLP---~eE~~~~-~~~~~~~~l~~I  151 (263)
T PRK13113         76 MTLDRTLDMVRAFRKEDDTTPIVMMGYYNPIYSRGVDRFLAEAKEAGIDGLIVVDLP---PEEDSEL-CLPAQAAGLNFI  151 (263)
T ss_pred             CCHHHHHHHHHHHHCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEECCCC---HHHHHHH-HHHHHHCCCCEE
T ss_conf             838899999997512389988899831368988569999999877794369717999---7888999-999997798679


Q ss_pred             CCCCCCCCHH-HHHHHH-CCCCEEEEEECCCCCCC
Q ss_conf             1122344011-111210-12420256304653430
Q gi|254780206|r  119 TYQHFSDPMK-AKQYVQ-NKSMPIVVKADGLCAGK  151 (424)
Q Consensus       119 ~~~~~~~~~e-a~~~~~-~~g~PvVVKp~~~agGk  151 (424)
                      ....-++.++ +.+.++ .-||=++|=-.|..|.+
T Consensus       152 ~lvaPtt~~~Ri~~i~~~a~gFiY~Vs~~GvTG~~  186 (263)
T PRK13113        152 RLATPTTDDRRLPKVLQNTSGFVYYVSITGITGAA  186 (263)
T ss_pred             EEECCCCCHHHHHHHHHCCCCCEEEEECCCCCCCC
T ss_conf             99479999999999983389848998345566877


No 453
>PRK08007 para-aminobenzoate synthase component II; Provisional
Probab=44.08  E-value=22  Score=15.51  Aligned_cols=72  Identities=21%  Similarity=0.217  Sum_probs=40.9

Q ss_pred             EEEECCC-HHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE--CCCHHHHHHHH
Q ss_conf             8998865-88999999998589967899954983575117055128789899999998718979999--79557874899
Q gi|254780206|r    3 VLLIGSG-GREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV--GPELPLVNGIS   79 (424)
Q Consensus         3 ILviGsG-grEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv--gpE~pL~~gi~   79 (424)
                      ||+|-++ ...|-|+..|++...  ++.+.|             .|..+.+.+    .+.++|.+|.  ||-.|..+|..
T Consensus         2 ILiIDn~DsFT~ni~~~l~~~g~--~v~V~~-------------~d~~~~~~i----~~~~p~~IvlSpGPg~P~~~~~~   62 (187)
T PRK08007          2 ILLIDNYDSFTWNLYQYFCELGA--DVLVKR-------------NDALTLADI----DALKPQKIVISPGPCTPDEAGIS   62 (187)
T ss_pred             EEEEECCCCHHHHHHHHHHHCCC--EEEEEE-------------CCCCCHHHH----HHCCCCEEEECCCCCCHHHCCCC
T ss_conf             99996898189999999987799--799993-------------898999999----84298979999999995890840


Q ss_pred             HHH-H--HCCCCEEECC
Q ss_conf             898-6--0588067010
Q gi|254780206|r   80 DAL-N--AAGFKVFGPS   93 (424)
Q Consensus        80 d~l-~--~~gi~v~Gp~   93 (424)
                      -.+ +  +..+|++|=.
T Consensus        63 ~~~i~~~~~~iPiLGIC   79 (187)
T PRK08007         63 LDVIRHYAGRLPILGVC   79 (187)
T ss_pred             HHHHHHHCCCCCEEEEC
T ss_conf             46899753899889987


No 454
>PRK13187 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase; Reviewed
Probab=43.96  E-value=22  Score=15.50  Aligned_cols=42  Identities=24%  Similarity=0.405  Sum_probs=32.4

Q ss_pred             CCCHHHHHHHHHHHCCCEEEE---CCCHHHHHH----HHHHHHHCCCCE
Q ss_conf             789899999998718979999---795578748----998986058806
Q gi|254780206|r   48 IQNHSAIIHFCQEKHIDLVVV---GPELPLVNG----ISDALNAAGFKV   89 (424)
Q Consensus        48 ~~d~~~i~~~a~~~~iDlviv---gpE~pL~~g----i~d~l~~~gi~v   89 (424)
                      +.-+|.++....-..||=++|   |||.|+.+|    +++.++++|+.-
T Consensus        85 V~TVEHLmAAL~glgIDN~~Ieidg~EvPIlDGSa~~fv~~i~~aGi~~  133 (305)
T PRK13187         85 VRTVEHLLASLLACEIDHAIVELDAEEVPILDGSATPWVDAIRACGRVA  133 (305)
T ss_pred             EEEHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEE
T ss_conf             9619999999997598459999589978713686299999987448564


No 455
>TIGR00619 sbcd nuclease SbcCD, D subunit; InterPro: IPR004593 All proteins in this family for which functions are known are double-stranded DNA exonuclease (as part of a complex with SbcC homologs). This complex functions in the initiation of recombination and recombinational repair and is particularly important in regulating the stability of DNA sections that can form secondary structures. This family is likely to be homologous to the MRE11 family.; GO: 0004527 exonuclease activity, 0006259 DNA metabolic process.
Probab=43.92  E-value=22  Score=15.50  Aligned_cols=66  Identities=21%  Similarity=0.331  Sum_probs=34.7

Q ss_pred             HHHHHHHHHHHCCCEEEEC--------CCH---HHHHHHHHHHHHCC--CCEE---ECCHHHHHHHHCCHHHHHHHHHHH
Q ss_conf             8999999987189799997--------955---78748998986058--8067---010666555201023578887653
Q gi|254780206|r   51 HSAIIHFCQEKHIDLVVVG--------PEL---PLVNGISDALNAAG--FKVF---GPSQRAAKLESSKSFAKKFCTKYG  114 (424)
Q Consensus        51 ~~~i~~~a~~~~iDlvivg--------pE~---pL~~gi~d~l~~~g--i~v~---Gp~~~aa~le~sK~~~K~~l~~~g  114 (424)
                      ...++++++++++|+++++        |..   -|.....-.|...+  +|++   |-=-...+|    ...+++|...|
T Consensus        37 L~~l~~~~~~e~~Da~lvAGDvFD~~~P~~ea~~L~~~~l~~L~~~~~R~p~Vvi~GNHD~~~~L----s~~~~Ll~~~~  112 (275)
T TIGR00619        37 LDDLLEILKAEQVDALLVAGDVFDTANPPAEAQELFYAFLLNLSDANPRLPIVVISGNHDSADRL----SAAKKLLKELG  112 (275)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH----CHHHHHHHHCC
T ss_conf             99999999738998899700007889887999999999999998538961278704788877861----11677897709


Q ss_pred             HHCCCC
Q ss_conf             101111
Q gi|254780206|r  115 IPTATY  120 (424)
Q Consensus       115 IPt~~~  120 (424)
                      +-.+.+
T Consensus       113 ~~v~~~  118 (275)
T TIGR00619       113 VFVVGK  118 (275)
T ss_pred             CEEEEC
T ss_conf             544202


No 456
>PRK01581 speE spermidine synthase; Validated
Probab=43.71  E-value=22  Score=15.47  Aligned_cols=22  Identities=18%  Similarity=0.395  Sum_probs=8.7

Q ss_pred             ECCCCCEEEEECCCCCCHHHHH
Q ss_conf             1477510443326544115666
Q gi|254780206|r  283 FGDPECQAMMMRLESDILEILN  304 (424)
Q Consensus       283 ~GDPE~q~ilp~L~~dl~~il~  304 (424)
                      |-||-...+=-+-...|+.++.
T Consensus       223 lPDP~n~~L~KLYS~eFY~Ll~  244 (363)
T PRK01581        223 FPDPATELLSTLYTSELFARIA  244 (363)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHH
T ss_conf             8999862466673599999999


No 457
>cd01144 BtuF Cobalamin binding protein BtuF.  These proteins have been shown to function as initial receptors in ABC transport of vitamin B12 (cobalamin) in eubacterial and some archaeal species.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=43.68  E-value=22  Score=15.47  Aligned_cols=81  Identities=21%  Similarity=0.267  Sum_probs=42.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEE---CCCHHHHHCCEEE-ECCCCCHHHHHHHHHHHCCCEEEECCCHHHHH
Q ss_conf             9589988658899999999858996789995---4983575117055-12878989999999871897999979557874
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSELWSI---PGNPGIAQHAQCV-AIDIQNHSAIIHFCQEKHIDLVVVGPELPLVN   76 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v~~~---pgN~g~~~~~~~~-~i~~~d~~~i~~~a~~~~iDlvivgpE~pL~~   76 (424)
                      |||..++.+.-|-  ..+|--.   +++.-.   ...|........+ ....-|.|.|+.    .+||+|+..... -..
T Consensus         1 ~RIVsl~~~~te~--l~aLG~~---d~iVGv~~~~~~p~~~~~~p~vG~~~~p~~E~I~~----L~PDLVi~~~~~-~~~   70 (245)
T cd01144           1 MRIVSLAPSATEL--LYALGLG---DQLVGVTDYCDYPPEAKKLPRVGGFYQLDLERVLA----LKPDLVIAWDDC-NVC   70 (245)
T ss_pred             CEEEECCCHHHHH--HHHCCCC---CCEEEEECCCCCHHHHHCCCCCCCCCCCCHHHHHC----CCCCEEEEECCC-CHH
T ss_conf             9799968269999--9985999---80799857889948871488337888999999952----599647742687-768


Q ss_pred             HHHHHHHHCCCCEEE
Q ss_conf             899898605880670
Q gi|254780206|r   77 GISDALNAAGFKVFG   91 (424)
Q Consensus        77 gi~d~l~~~gi~v~G   91 (424)
                      ...+.|++.|++++-
T Consensus        71 ~~~~~l~~~gi~v~~   85 (245)
T cd01144          71 AVVDQLRAAGIPVLV   85 (245)
T ss_pred             HHHHHHHCCCCEEEE
T ss_conf             899987604976998


No 458
>TIGR03190 benz_CoA_bzdN benzoyl-CoA reductase, bzd-type, N subunit. Members of this family are the N subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene.
Probab=43.54  E-value=23  Score=15.46  Aligned_cols=20  Identities=15%  Similarity=0.215  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHCCCCCEEEE
Q ss_conf             89999999985899678999
Q gi|254780206|r   11 REHALAWKIAQSPLLSELWS   30 (424)
Q Consensus        11 rEhAl~~~l~~s~~~~~v~~   30 (424)
                      |+.+.-||-++...+--.||
T Consensus        15 ~~~~~~~k~~~GkkVVG~~C   34 (377)
T TIGR03190        15 HDYARDWKARTGGQVVATMC   34 (377)
T ss_pred             HHHHHHHHHHCCCEEEEEEC
T ss_conf             99999999856986999808


No 459
>PRK06249 2-dehydropantoate 2-reductase; Provisional
Probab=43.25  E-value=23  Score=15.42  Aligned_cols=32  Identities=16%  Similarity=0.350  Sum_probs=23.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEE-EEECCC
Q ss_conf             9589988658899999999858996789-995498
Q gi|254780206|r    1 MRVLLIGSGGREHALAWKIAQSPLLSEL-WSIPGN   34 (424)
Q Consensus         1 MkILviGsGgrEhAl~~~l~~s~~~~~v-~~~pgN   34 (424)
                      |||+|||.|+----+++.|+++..  +| +++.++
T Consensus         6 ~kI~IiGaGAiG~~~a~~L~~aG~--~V~li~r~~   38 (313)
T PRK06249          6 PRIAIIGTGAIGGFYGAMLARAGF--DVHFLLRSD   38 (313)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--CEEEEECCH
T ss_conf             889999914999999999996699--569996755


No 460
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=43.24  E-value=23  Score=15.42  Aligned_cols=65  Identities=22%  Similarity=0.246  Sum_probs=34.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE-CCCH
Q ss_conf             5899886588999999998589967899954983575117055128789899999998718979999-7955
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV-GPEL   72 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv-gpE~   72 (424)
                      ||.|||.|..-||=+.-|+.|.....+=+-+|-.. ...++.-.+...++++.++.     -|+|++ -|+.
T Consensus        20 ~iaIIGYGsQG~ahalNlRDSGlnViiGlr~g~~s-~~kA~~dGf~V~~v~ea~k~-----ADvim~L~PDe   85 (338)
T COG0059          20 KVAIIGYGSQGHAQALNLRDSGLNVIIGLRKGSSS-WKKAKEDGFKVYTVEEAAKR-----ADVVMILLPDE   85 (338)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHH-HHHHHHCCCEEECHHHHHHC-----CCEEEEECCHH
T ss_conf             69999027087888742242487479985688724-89999669775139998522-----79999818654


No 461
>COG2145 ThiM Hydroxyethylthiazole kinase, sugar kinase family [Coenzyme metabolism]
Probab=43.16  E-value=22  Score=15.57  Aligned_cols=135  Identities=17%  Similarity=0.208  Sum_probs=63.3

Q ss_pred             EECCCCCHHHHHHHHHHHCCCEEE-ECC---CH-HHHHHHHHHHHHCCCCEEE-CCHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             512878989999999871897999-979---55-7874899898605880670-10666555201023578887653101
Q gi|254780206|r   44 VAIDIQNHSAIIHFCQEKHIDLVV-VGP---EL-PLVNGISDALNAAGFKVFG-PSQRAAKLESSKSFAKKFCTKYGIPT  117 (424)
Q Consensus        44 ~~i~~~d~~~i~~~a~~~~iDlvi-vgp---E~-pL~~gi~d~l~~~gi~v~G-p~~~aa~le~sK~~~K~~l~~~gIPt  117 (424)
                      .|+=..+.+++.+|++--+- |+| +|.   |. ....--+..-++.|.|++= |..-. -.+-++.++++++++..+-.
T Consensus        39 SP~Ma~~~eE~~e~~kia~A-L~INIGTL~~~~~~~m~~A~~~An~~~~PvvLDPVgvg-At~~R~~~~~~LL~~~~~~~  116 (265)
T COG2145          39 SPVMADAPEEVEEFAKIADA-LLINIGTLSAERIQAMRAAIKAANESGKPVVLDPVGVG-ATKFRTKFALELLAEVKPAA  116 (265)
T ss_pred             CCHHCCCHHHHHHHHHHCCC-EEEEECCCCHHHHHHHHHHHHHHHHCCCCEEECCCCCC-CHHHHHHHHHHHHHHCCCCE
T ss_conf             82001487899999975070-38960469867899999999998752998786574578-66889999999997068747


Q ss_pred             CCCCCCCCCHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf             11122344011111210124202563046534300023235677888788751445317778877520575234421577
Q gi|254780206|r  118 ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGK  197 (424)
Q Consensus       118 ~~~~~~~~~~ea~~~~~~~g~PvVVKp~~~agGkGV~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G~E~Sv~~i~dG~  197 (424)
                      -+.    |..|....+.   -        ...+|||--....+++.+..+..-...+ .|++   +.|+   +++++||.
T Consensus       117 IrG----N~sEI~~Lag---~--------~~~~kGVDa~~~~~~~~~~a~~~A~~~~-~vvv---vTG~---vD~Isdg~  174 (265)
T COG2145         117 IRG----NASEIAALAG---E--------AGGGKGVDAGDGAADAIEAAKKAAQKYG-TVVV---VTGE---VDYISDGT  174 (265)
T ss_pred             EEC----CHHHHHHHHC---C--------CCCCCCCCCCCCHHHHHHHHHHHHHHHC-CEEE---EECC---EEEEEECC
T ss_conf             825----6999999733---0--------2667454666431469999999988759-1899---9778---24897087


Q ss_pred             CCCCC
Q ss_conf             63103
Q gi|254780206|r  198 TAIPF  202 (424)
Q Consensus       198 ~~~~l  202 (424)
                      +++.+
T Consensus       175 ~~~~i  179 (265)
T COG2145         175 RVVVI  179 (265)
T ss_pred             EEEEE
T ss_conf             69998


No 462
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional
Probab=42.91  E-value=23  Score=15.39  Aligned_cols=23  Identities=22%  Similarity=0.319  Sum_probs=20.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             58998865889999999985899
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPL   24 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~   24 (424)
                      ||.|||+|+---|||+-|.+...
T Consensus         8 KI~ViGaGawGTALA~~la~n~~   30 (340)
T PRK12439          8 KVVVLGGGSWGTTVASICARRGP   30 (340)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCC
T ss_conf             28998969999999999995899


No 463
>cd00363 PFK Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to PFK family that includes ATP- and pyrophosphate (PPi)- dependent phosphofructokinases. Some members evolved by gene duplication and thus have a large C-terminal/N-terminal extension comprising a second PFK domain. Generally, ATP-PFKs are allosteric homotetramers, and  PPi-PFKs are dimeric and nonallosteric except for plant PPi-PFKs which are allosteric heterotetramers.
Probab=42.86  E-value=23  Score=15.38  Aligned_cols=90  Identities=19%  Similarity=0.340  Sum_probs=41.7

Q ss_pred             EEEEECCCHHH---H----HHHHHHHHCCCCCEEEEEC-CCHHHHH---------------------CCEE-EE--CCCC
Q ss_conf             58998865889---9----9999998589967899954-9835751---------------------1705-51--2878
Q gi|254780206|r    2 RVLLIGSGGRE---H----ALAWKIAQSPLLSELWSIP-GNPGIAQ---------------------HAQC-VA--IDIQ   49 (424)
Q Consensus         2 kILviGsGgrE---h----Al~~~l~~s~~~~~v~~~p-gN~g~~~---------------------~~~~-~~--i~~~   49 (424)
                      ||.|+=|||--   +    +++..+.+..  .+||-+. |-.|...                     +..+ ..  -+..
T Consensus         2 rIaIltsGG~~pGmNa~ir~vv~~a~~~g--~~v~Gi~~G~~GL~~~~~~~L~~~~v~~i~~~GGt~LgssR~~~~~~~~   79 (338)
T cd00363           2 KIGVLTSGGDAPGMNAAIRGVVRSAIAEG--LEVYGIYEGYAGLVEGDIKELDWESVSDIINRGGTIIGSARCKEFRTEE   79 (338)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCC--CEEEEECCCHHHHCCCCEEECCHHHHHHHHHCCCEECCCCCCCCCCCHH
T ss_conf             59998688886688899999999999779--9999982577777079816299999987985698131676787667867


Q ss_pred             CHHHHHHHHHHHCCC-EEEECCCHHH--HHHHHHHHHH--CCCCEEECC
Q ss_conf             989999999871897-9999795578--7489989860--588067010
Q gi|254780206|r   50 NHSAIIHFCQEKHID-LVVVGPELPL--VNGISDALNA--AGFKVFGPS   93 (424)
Q Consensus        50 d~~~i~~~a~~~~iD-lvivgpE~pL--~~gi~d~l~~--~gi~v~Gp~   93 (424)
                      +.+.+++..++++|| |+++|-+..+  +.-+++.+.+  .+++|+|-+
T Consensus        80 ~~~~~~~~l~~~~Id~Li~IGGdgS~~~a~~L~~~~~~~~~~i~vvgIP  128 (338)
T cd00363          80 GRAKAAENLKKHGIDALVVIGGDGSYTGADLLTEEWPSKYQGFNVIGLP  128 (338)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             7899999999829998999789269999999999888528995189841


No 464
>PRK13403 ketol-acid reductoisomerase; Provisional
Probab=42.72  E-value=23  Score=15.37  Aligned_cols=58  Identities=24%  Similarity=0.323  Sum_probs=31.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEE--CCCHHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEE
Q ss_conf             589988658899999999858996789995--4983575117055128789899999998718979999
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSI--PGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVV   68 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~--pgN~g~~~~~~~~~i~~~d~~~i~~~a~~~~iDlviv   68 (424)
                      +|-|||.|..-||=|.-|+.|..  +|.+.  +|.  ....++.--+...++++.+++     -|+|++
T Consensus        18 ~iaVIGYGsQG~AhAlNLrDSG~--~V~vglr~g~--s~~~A~~~Gf~v~~~~eA~~~-----aDvi~~   77 (335)
T PRK13403         18 TVAVIGYGSQGHAQAQNLRDSGV--EVVVGVRPGK--SFEVAKADGFEVMSVSEAVRT-----AQVVQM   77 (335)
T ss_pred             EEEEEEECCHHHHHHHHHHHCCC--CEEEEECCCC--CHHHHHHCCCEECCHHHHHHH-----CCEEEE
T ss_conf             79997567076898856476399--7799979985--699999879931679999985-----797875


No 465
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases. ETF transfers electrons to the main respiratory chain via ETF-ubiquinone oxidoreductase. ETF is an heterodimer that consists of an alpha and a beta subunit which binds one molecule of FAD per dimer . A similar system also exists in some bacteria.  The homologous pair of proteins (FixA/FixB) are essential for nitrogen fixation. The alpha subunit of ETF is structurally related to the bacterial nitrogen fixation protein fixB which could play a role in a redox process and feed electrons to ferredoxin. The beta subunit protein is distantly related to and forms a heterodimer with the alpha subunit.
Probab=42.61  E-value=23  Score=15.36  Aligned_cols=20  Identities=20%  Similarity=0.451  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHCCCEEEECCC
Q ss_conf             99999998718979999795
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPE   71 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE   71 (424)
                      ..|.++++++++|+|+.|.+
T Consensus        81 ~~la~~i~~~~~dlVl~g~~  100 (181)
T cd01985          81 KALAALIKKEKPDLILAGAT  100 (181)
T ss_pred             HHHHHHHHHCCCCEEEECCC
T ss_conf             99999998609989996041


No 466
>pfam01177 Asp_Glu_race Asp/Glu/Hydantoin racemase. This family contains aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase.
Probab=42.59  E-value=23  Score=15.36  Aligned_cols=80  Identities=14%  Similarity=0.157  Sum_probs=38.8

Q ss_pred             HHHHHHHHHHCCCEEEECCC-HHHHHHHHHHHH-HCCCCEEECCHHHHHHHHCCHHHHHH-HHHHHHHCCCCCCCCCCHH
Q ss_conf             99999998718979999795-578748998986-05880670106665552010235788-8765310111122344011
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPE-LPLVNGISDALN-AAGFKVFGPSQRAAKLESSKSFAKKF-CTKYGIPTATYQHFSDPMK  128 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE-~pL~~gi~d~l~-~~gi~v~Gp~~~aa~le~sK~~~K~~-l~~~gIPt~~~~~~~~~~e  128 (424)
                      ...+++..+.++|.++++.- .+.   +.+.++ ..++|++|+...+.+     .+ +.. .++-+|=++.....+  .-
T Consensus        54 ~~~~~~l~~~g~d~iviaCnt~~~---~~~~~~~~~~ipvi~~~~a~~~-----a~-~~~~~~ri~vl~t~~t~~~--~~  122 (212)
T pfam01177        54 LEAARRLAKAGADAIVIACNTAHA---LAGELREATDIPVIGIVEAALK-----AL-ALLGAKRVGVLATYGTIVS--GL  122 (212)
T ss_pred             HHHHHHHHHCCCCEEEEECCHHHH---HHHHHHHHCCCCEEEHHHHHHH-----HH-HHCCCCEEEEEECCHHHHH--HH
T ss_conf             999999986799999991765999---9999998729989854789999-----99-9718980899956424437--99


Q ss_pred             HHHHHHCCCCEEEE
Q ss_conf             11121012420256
Q gi|254780206|r  129 AKQYVQNKSMPIVV  142 (424)
Q Consensus       129 a~~~~~~~g~PvVV  142 (424)
                      ..+++++.|+.++.
T Consensus       123 ~~~~l~~~g~~~~~  136 (212)
T pfam01177       123 YQELLAEAGIEVVA  136 (212)
T ss_pred             HHHHHHHCCCCEEE
T ss_conf             99999975992785


No 467
>pfam04007 DUF354 Protein of unknown function (DUF354). Members of this family are around 350 amino acids in length. They are found in archaebacteria and have no known function.
Probab=42.50  E-value=23  Score=15.35  Aligned_cols=20  Identities=5%  Similarity=0.187  Sum_probs=8.1

Q ss_pred             CHHHHHHHHHHHCCCEEEEC
Q ss_conf             98999999987189799997
Q gi|254780206|r   50 NHSAIIHFCQEKHIDLVVVG   69 (424)
Q Consensus        50 d~~~i~~~a~~~~iDlvivg   69 (424)
                      |.+.+.++.+..++++.++|
T Consensus        36 ~~~~~~~LL~~y~i~~~~iG   55 (335)
T pfam04007        36 KFGELPELLRSLGFQVKSIG   55 (335)
T ss_pred             CCCHHHHHHHHCCCCEEEEC
T ss_conf             13519999997699769975


No 468
>COG1598 Predicted nuclease of the RNAse H fold, HicB family [General    function prediction only]
Probab=42.42  E-value=16  Score=16.55  Aligned_cols=21  Identities=24%  Similarity=0.335  Sum_probs=9.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHH
Q ss_conf             999962898999999999985
Q gi|254780206|r  376 SATALGKTITESRELAYHMVE  396 (424)
Q Consensus       376 ~vv~~g~~l~eA~~~ay~~i~  396 (424)
                      .|.++|+|+++|.+++..+++
T Consensus        25 gc~s~G~T~eea~~n~~eai~   45 (73)
T COG1598          25 GCHSQGETLEEALQNAKEAIE   45 (73)
T ss_pred             CHHHCCCCHHHHHHHHHHHHH
T ss_conf             733027889999999999999


No 469
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. This subgroup includes the type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids. Members of this subgroup are sequence-similar to members of the family of ABC-type hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine-binding protein (LIVBP); their ligand specificity has not been determined experimentally, however.
Probab=42.29  E-value=24  Score=15.32  Aligned_cols=45  Identities=18%  Similarity=0.328  Sum_probs=28.1

Q ss_pred             HHHHHHHHHHCCCEEEECCC-HHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             99999998718979999795-57874899898605880670106665
Q gi|254780206|r   52 SAIIHFCQEKHIDLVVVGPE-LPLVNGISDALNAAGFKVFGPSQRAA   97 (424)
Q Consensus        52 ~~i~~~a~~~~iDlvivgpE-~pL~~gi~d~l~~~gi~v~Gp~~~aa   97 (424)
                      ....+++.+.+++.++ ||- .+....+.+..++.++|++.|+....
T Consensus        56 ~~a~~li~~~~V~~iv-G~~~S~~~~a~~~~~~~~~vp~is~~~~~~  101 (312)
T cd06333          56 TNARKLIEEDKVDAII-GPSTTPATMAVAPVAEEAKTPMISLAPAAA  101 (312)
T ss_pred             HHHHHHHHHCCCEEEE-CCCCCHHHHHHHHHHHHCCCEEEECCCCCC
T ss_conf             9999986517933986-687737788889999974986997478761


No 470
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase. This family is a subset of the pfam03102 and is believed to include only authentic NeuB N-acetylneuraminate (sialic acid) synthase enzymes. The majority of the genes identified by this model are observed adjacent to both the NeuA and NeuC genes which together effect the biosynthesis of CMP-N-acetylneuraminate from UDP-N-acetylglucosamine.
Probab=42.17  E-value=24  Score=15.31  Aligned_cols=22  Identities=18%  Similarity=0.625  Sum_probs=12.5

Q ss_pred             CCCCCHHHHHHHHHHHCCCEEE
Q ss_conf             2878989999999871897999
Q gi|254780206|r   46 IDIQNHSAIIHFCQEKHIDLVV   67 (424)
Q Consensus        46 i~~~d~~~i~~~a~~~~iDlvi   67 (424)
                      ++..+...+.++|++.++++..
T Consensus        73 ls~~~~~~L~~~~~~~gi~~~~   94 (329)
T TIGR03569        73 LSEEDHRELKEYCESKGIEFLS   94 (329)
T ss_pred             CCHHHHHHHHHHHHHHCCEEEE
T ss_conf             8999999999999972992998


No 471
>pfam00465 Fe-ADH Iron-containing alcohol dehydrogenase.
Probab=42.08  E-value=24  Score=15.30  Aligned_cols=26  Identities=15%  Similarity=0.261  Sum_probs=17.7

Q ss_pred             CCHHHHHHHHHHHCCCEEE-ECCCHHH
Q ss_conf             8989999999871897999-9795578
Q gi|254780206|r   49 QNHSAIIHFCQEKHIDLVV-VGPELPL   74 (424)
Q Consensus        49 ~d~~~i~~~a~~~~iDlvi-vgpE~pL   74 (424)
                      .+.+..++.++++++|+|| +|--.++
T Consensus        66 ~~v~~~~~~~~~~~~D~IIaiGGGS~i   92 (312)
T pfam00465        66 EEVDEAAAAAREEGADVIIAVGGGSVI   92 (312)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCCC
T ss_conf             999999999996499899980897612


No 472
>PRK08219 short chain dehydrogenase; Provisional
Probab=41.99  E-value=24  Score=15.29  Aligned_cols=64  Identities=20%  Similarity=0.257  Sum_probs=37.7

Q ss_pred             CEEE-EECCC-HHHHHHHHHHHHCCCCCEEEEECCCH-HHHH-----CCEEEECCCCCHHHHHHHHHHH-CCCEEE
Q ss_conf             9589-98865-88999999998589967899954983-5751-----1705512878989999999871-897999
Q gi|254780206|r    1 MRVL-LIGSG-GREHALAWKIAQSPLLSELWSIPGNP-GIAQ-----HAQCVAIDIQNHSAIIHFCQEK-HIDLVV   67 (424)
Q Consensus         1 MkIL-viGsG-grEhAl~~~l~~s~~~~~v~~~pgN~-g~~~-----~~~~~~i~~~d~~~i~~~a~~~-~iDlvi   67 (424)
                      ||+- |.|++ |--.|+|..|.+..  ..+.+. .|. ....     -...+..|..|.+.+.++.++. ++|..|
T Consensus         3 mKvalITGas~GIG~aia~~la~~g--~vv~~~-r~~~~l~~l~~~~~~~~~~~Dlt~~~~i~~~~~~~~~iD~lV   75 (226)
T PRK08219          3 MPTALITGASRGIGAAIARALARTH--TLLLAG-RPSERLDAVAARLGATTWPADLTDPEAIAAAVEPLDRLDVLV   75 (226)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCC--CEEEEE-CCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHCCCCCEEE
T ss_conf             8999992846499999999999699--899998-988999999997099378605799999999999659988999


No 473
>PRK05086 malate dehydrogenase; Provisional
Probab=41.90  E-value=24  Score=15.28  Aligned_cols=32  Identities=41%  Similarity=0.487  Sum_probs=21.7

Q ss_pred             CEEEEECC-CHHHHHHHHHHH-HCCCCCEEEEEC
Q ss_conf             95899886-588999999998-589967899954
Q gi|254780206|r    1 MRVLLIGS-GGREHALAWKIA-QSPLLSELWSIP   32 (424)
Q Consensus         1 MkILviGs-GgrEhAl~~~l~-~s~~~~~v~~~p   32 (424)
                      |||-|||. |.--.++++.|. +.+..+++.+..
T Consensus         1 mKV~IiGA~G~VG~s~A~~l~~~~~~~~el~L~D   34 (312)
T PRK05086          1 MKVAVLGAAGGIGQALALLLKTQLPAGSELSLYD   34 (312)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             9899998998699999999982898777499975


No 474
>pfam07355 GRDB Glycine/sarcosine/betaine reductase selenoprotein B (GRDB). This family represents a conserved region approximately 350 residues long within the selenoprotein B component of the bacterial glycine, sarcosine and betaine reductase complexes.
Probab=41.87  E-value=24  Score=15.28  Aligned_cols=75  Identities=23%  Similarity=0.395  Sum_probs=42.2

Q ss_pred             CHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHH
Q ss_conf             98999999987189799997955787489989860588067010666555201023578887653101111223440111
Q gi|254780206|r   50 NHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKA  129 (424)
Q Consensus        50 d~~~i~~~a~~~~iDlvivgpE~pL~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea  129 (424)
                      -.+.+++++++.++|++|.||-  ..+|      ..|+.| |            ..+|..-++.|||+-..-...|.- +
T Consensus        68 a~~~il~mv~~~~pDlfiAGPA--FnAG------RYGvAC-G------------~i~kaV~e~l~IP~vTgMy~ENPG-v  125 (349)
T pfam07355        68 AVAEILEMLKEEKPDLFIAGPA--FNAG------RYGVAC-G------------TIAKAVKEELGIPAVTGMYVENPG-V  125 (349)
T ss_pred             HHHHHHHHHHHCCCCEEEECCC--CCCC------CHHHHH-H------------HHHHHHHHHHCCCEEEECCCCCCC-H
T ss_conf             9999999998429998987663--2564------258889-9------------999999998699638641566850-7


Q ss_pred             HHHHHCCCCEEEEEECCCCC
Q ss_conf             11210124202563046534
Q gi|254780206|r  130 KQYVQNKSMPIVVKADGLCA  149 (424)
Q Consensus       130 ~~~~~~~g~PvVVKp~~~ag  149 (424)
                      .-| +  ..-++++...+|+
T Consensus       126 dm~-k--k~~yIv~t~nsAa  142 (349)
T pfam07355       126 DMF-K--KDVYIISTGNSAA  142 (349)
T ss_pred             HHH-H--CCEEEEECCCHHH
T ss_conf             676-4--4428996584176


No 475
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism]
Probab=41.83  E-value=24  Score=15.28  Aligned_cols=174  Identities=21%  Similarity=0.248  Sum_probs=0.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHH-------CCEEEECCCCCHHHHHHHHHHHCCCEEEECCCHHH
Q ss_conf             58998865889999999985899678999549835751-------17055128789899999998718979999795578
Q gi|254780206|r    2 RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ-------HAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPL   74 (424)
Q Consensus         2 kILviGsGgrEhAl~~~l~~s~~~~~v~~~pgN~g~~~-------~~~~~~i~~~d~~~i~~~a~~~~iDlvivgpE~pL   74 (424)
                      ||.+||+|---.-++--+..-+...-+-++.-|...+.       ..+-..++..+........+.-++ .+-=.-+.-+
T Consensus        19 RVGlIGAG~mG~~ivtQi~~m~Gm~vvaisd~~~~~ak~A~~~ag~~~~~~~e~~~~s~~a~Ai~aGKi-~vT~D~~~i~   97 (438)
T COG4091          19 RVGLIGAGEMGTGIVTQIASMPGMEVVAISDRNLDAAKRAYDRAGGPKIEAVEADDASKMADAIEAGKI-AVTDDAELII   97 (438)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCE-EEECCHHHHH
T ss_conf             998754541106799987506883699984246427889998735872000011116678899862867-9826535432


Q ss_pred             HHHHHHHHHHC-CCCEEECCHHHHHHHHCCH--------------HHHHHHHHHHHH--CCCCCCCCCCHHHHHHHHCCC
Q ss_conf             74899898605-8806701066655520102--------------357888765310--111122344011111210124
Q gi|254780206|r   75 VNGISDALNAA-GFKVFGPSQRAAKLESSKS--------------FAKKFCTKYGIP--TATYQHFSDPMKAKQYVQNKS  137 (424)
Q Consensus        75 ~~gi~d~l~~~-gi~v~Gp~~~aa~le~sK~--------------~~K~~l~~~gIP--t~~~~~~~~~~ea~~~~~~~g  137 (424)
                      ..++.|..-.+ |+|-+|..-.-..|+..|.              +.|+...+.|+-  -.....=.+.-|+.+|++.+|
T Consensus        98 ~~~~IdvIIdATG~p~vGA~~~l~Ai~h~KHlVMmNVEaDvtIGp~Lk~~Ad~~GviyS~~~GDeP~~~mEL~efa~a~G  177 (438)
T COG4091          98 ANDLIDVIIDATGVPEVGAKIALEAILHGKHLVMMNVEADVTIGPILKQQADAAGVIYSGGAGDEPSSCMELYEFASALG  177 (438)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEEEEEEECEEECHHHHHHHHHCCEEEECCCCCCCHHHHHHHHHHHHCC
T ss_conf             38860499976788530147579998567728999754032534889987765475885467897177878999998649


Q ss_pred             CEEEEEECCCCCCCC----CCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHC
Q ss_conf             202563046534300----023235677888788751445317778877520
Q gi|254780206|r  138 MPIVVKADGLCAGKG----VVVAATVDEATSAIDRCFQQINSTVIIEEYLEG  185 (424)
Q Consensus       138 ~PvVVKp~~~agGkG----V~i~~~~~e~~~~~~~~~~~~~~~VliEefl~G  185 (424)
                      |++|.      +|||    -.+-.+.+...+..++   ..-..=.+-+|.+|
T Consensus       178 ~evv~------aGKGkNnpl~~~a~Pdt~~eeA~r---~~~n~~Ml~sF~DG  220 (438)
T COG4091         178 FEVVS------AGKGKNNPLNIDANPDTYEEEAKR---RNMNPRMLVSFQDG  220 (438)
T ss_pred             CEEEE------CCCCCCCCCCCCCCCCHHHHHHHH---CCCCHHHHHHHHCC
T ss_conf             75886------157768987667898147888760---48986786543143


No 476
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed
Probab=41.70  E-value=24  Score=15.26  Aligned_cols=29  Identities=28%  Similarity=0.396  Sum_probs=0.0

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHCCCCCEEE
Q ss_conf             958998865--88999999998589967899
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQSPLLSELW   29 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s~~~~~v~   29 (424)
                      |||.+||+|  |==.||..|++.-...-.||
T Consensus         1 MkI~~iGGGPaGLYfailmK~~~P~~eI~V~   31 (770)
T PRK08255          1 MRIVCIGGGPAGLYFGLLMKLRDPAHEVTVV   31 (770)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             9499977875899999999865899974798


No 477
>PRK13112 consensus
Probab=41.67  E-value=24  Score=15.26  Aligned_cols=91  Identities=16%  Similarity=0.237  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHCCCEEEECCCHHH--HHHHHHHHHHCC---CCEEECCHHHHHHHHCCHHHHHHH---HHHHHHCCCCCC
Q ss_conf             899999998718979999795578--748998986058---806701066655520102357888---765310111122
Q gi|254780206|r   51 HSAIIHFCQEKHIDLVVVGPELPL--VNGISDALNAAG---FKVFGPSQRAAKLESSKSFAKKFC---TKYGIPTATYQH  122 (424)
Q Consensus        51 ~~~i~~~a~~~~iDlvivgpE~pL--~~gi~d~l~~~g---i~v~Gp~~~aa~le~sK~~~K~~l---~~~gIPt~~~~~  122 (424)
                      .+.-++-|++..+|.+++ |+-|.  ...+...++++|   |+.+-|+....||..--..++.|.   ...|+--.+-..
T Consensus       112 ~e~F~~~~~~aGvdGvIi-pDLP~eE~~~~~~~~~~~~i~~I~lvaPtt~~eRi~~i~~~s~GFiY~Vs~~GvTG~~~~~  190 (279)
T PRK13112        112 VERFLTDAKAAGVDGLIV-VDLPPEMDAELCIPAMKAGINFIRLATPTTDDKRLPKVLANTSGFVYYVSMTGITGSALAD  190 (279)
T ss_pred             HHHHHHHHHHCCCCEEEE-CCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEECCCCCCCCCCC
T ss_conf             999999999739987984-6999788899999998578346998258998999999985278808998356666766456


Q ss_pred             CCCCHHHHHHHHCC-CCEEEE
Q ss_conf             34401111121012-420256
Q gi|254780206|r  123 FSDPMKAKQYVQNK-SMPIVV  142 (424)
Q Consensus       123 ~~~~~ea~~~~~~~-g~PvVV  142 (424)
                      .....+..+-+++. ..|++|
T Consensus       191 ~~~~~~~i~~ik~~t~~Pv~v  211 (279)
T PRK13112        191 TSAVGEAVARIKRHTDLPVCV  211 (279)
T ss_pred             HHHHHHHHHHHHHHCCCCCEE
T ss_conf             488999999999717898767


No 478
>pfam03681 UPF0150 Uncharacterized protein family (UPF0150). This family of small proteins are uncharacterized. In the DNA-binding protein (CopG family) from Caulobacter vibrioides this domain is found next to a DNA binding helix-turn-helix domain pfam01402, which suggests that this is some kind of ligand binding domain. The structure of this domain suggests that these domains oligomerize and due to structural similarities may bind to RNA.
Probab=41.65  E-value=15  Score=16.83  Aligned_cols=21  Identities=29%  Similarity=0.332  Sum_probs=0.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHH
Q ss_conf             999962898999999999985
Q gi|254780206|r  376 SATALGKTITESRELAYHMVE  396 (424)
Q Consensus       376 ~vv~~g~~l~eA~~~ay~~i~  396 (424)
                      .+.+.|+|+++|++++.++++
T Consensus        23 g~~t~G~t~eEa~~n~~eai~   43 (48)
T pfam03681        23 GCITQGETLEEALENAKEALE   43 (48)
T ss_pred             CHHHHCCCHHHHHHHHHHHHH
T ss_conf             636524999999999999999


No 479
>PRK10444 UMP phosphatase; Provisional
Probab=41.62  E-value=24  Score=15.25  Aligned_cols=72  Identities=8%  Similarity=0.168  Sum_probs=0.0

Q ss_pred             CCEEEECCCHHH--HHHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             979999795578--748998986058806701066655520102357888765310111122344011111210124
Q gi|254780206|r   63 IDLVVVGPELPL--VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKS  137 (424)
Q Consensus        63 iDlvivgpE~pL--~~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt~~~~~~~~~~ea~~~~~~~g  137 (424)
                      +|.|+---..++  +....+.|++.|++++=-|-.+++   +..-..+.|.+.|++.+...++++...+.+++++..
T Consensus         8 lDGvl~~g~~~ipga~e~l~~L~~~g~~~~fvTNnss~---s~~~~~~kL~~~Gl~v~~~~i~ts~~~~~~~L~~~~   81 (248)
T PRK10444          8 IDGVLMHDNVAVPGAAEFLHRILEKGLPLVLLTNYPSQ---TGQDLANRFATAGVDVPDSVFYTSAMATADFLRRQE   81 (248)
T ss_pred             CCCEEEECCEECCCHHHHHHHHHHCCCEEEEEECCC