HHsearch alignment for GI: 254780206 and conserved domain: pfam01408

>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
Probab=96.95  E-value=0.0056  Score=41.52  Aligned_cols=111  Identities=23%  Similarity=0.286  Sum_probs=63.1

Q ss_pred             CEEEEECCC--HHHHHHHHHHHHC-CCCCEEEEECCCHHHHH-CCEEEECC-CCCHHHHHHHHHHHCCCEEEECCCHHHH
Q ss_conf             958998865--8899999999858-99678999549835751-17055128-7898999999987189799997955787
Q gi|254780206|r    1 MRVLLIGSG--GREHALAWKIAQS-PLLSELWSIPGNPGIAQ-HAQCVAID-IQNHSAIIHFCQEKHIDLVVVGPELPLV   75 (424)
Q Consensus         1 MkILviGsG--grEhAl~~~l~~s-~~~~~v~~~pgN~g~~~-~~~~~~i~-~~d~~~i~~~a~~~~iDlvivgpE~pL~   75 (424)
T Consensus         1 iki~iiG~G~~g~~~~~~--~~~~~~~~~i~ai~d~~~~~~~~~~~~~~~~~~~~~~---~~l~~~~iD~v~I~tp~~~H   75 (120)
T pfam01408         1 LRVGIVGAGKIGRRHLRA--LNESQDGAELVGVLDPDPARAEAVAESFGVPAYSDLE---ELLADPDVDAVSVATPPGLH   75 (120)
T ss_pred             CEEEEEECHHHHHHHHHH--HHHCCCCCEEEEEECCCHHHHHHHHHHHCCCEECCHH---HHHHCCCCCEEEECCCHHHH
T ss_conf             989999077999999999--9855999789999829999999999983996788699---99737788989990874618


Q ss_pred             HHHHHHHHHCCCCEEECCHHHHHHHHCCHHHHHHHHHHHHHC
Q ss_conf             489989860588067010666555201023578887653101
Q gi|254780206|r   76 NGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT  117 (424)
Q Consensus        76 ~gi~d~l~~~gi~v~Gp~~~aa~le~sK~~~K~~l~~~gIPt  117 (424)
T Consensus        76 ~~~~~~~l~~g~~v~~EKP~~~~~~e~~~l-~~~a~~~~~~~  116 (120)
T pfam01408        76 FELALAALEAGKHVLVEKPLATTVEEAKEL-VELAEKKGVRL  116 (120)
T ss_pred             HHHHHHHHHHCCEEEEECCCCCCHHHHHHH-HHHHHHCCCEE
T ss_conf             999999998199899968981999999999-99999829969