HHsearch alignment for GI: 254780206 and conserved domain: pfam08886

>pfam08886 GshA Glutamate-cysteine ligase. This is a rare family of glutamate--cysteine ligases, demonstrated first in Thiobacillus ferrooxidans and present in a few other Proteobacteria. It is the first of two enzymes for glutathione biosynthesis. It is also called gamma-glutamylcysteine synthetase.
Probab=90.79  E-value=0.58  Score=26.96  Aligned_cols=101  Identities=24%  Similarity=0.332  Sum_probs=51.9

Q ss_pred             CCCEEEECCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHHHCCH--------HHHHHHHHHHHH----CCCCCCCCCCH-
Q ss_conf             8979999795578748998986058-806701066655520102--------357888765310----11112234401-
Q gi|254780206|r   62 HIDLVVVGPELPLVNGISDALNAAG-FKVFGPSQRAAKLESSKS--------FAKKFCTKYGIP----TATYQHFSDPM-  127 (424)
Q Consensus        62 ~iDlvivgpE~pL~~gi~d~l~~~g-i~v~Gp~~~aa~le~sK~--------~~K~~l~~~gIP----t~~~~~~~~~~-  127 (424)
T Consensus       152 ~Pc~ILLNND--LS~GiP~iL~~l~~Q~il-Ppl~~GW~~RrKS~HF~~Y~~v~~eF~~l~~IDpWli~p~f~~c~~idf  228 (404)
T pfam08886       152 DPCLILLNND--LSSGIPEILQGLHEQYLL-PPLHAGWANRRKSNHFSAYDEVAKEFAKLIGIDPWLINPLFSSCGGVDF  228 (404)
T ss_pred             CCCEEEECCC--CCCCCCHHHHCCCCCCCC-CCCCCCCCCEECCHHHHHHHHHHHHHHHHHCCCCHHCCCCCCCCCCCCC
T ss_conf             8757997475--443683566064655055-9845674410122678999999999999749991113535023076267


Q ss_pred             -----------HHHHHHHC-------CC---CE-EEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             -----------11112101-------24---20-25630465343000232356778887
Q gi|254780206|r  128 -----------KAKQYVQN-------KS---MP-IVVKADGLCAGKGVVVAATVDEATSA  165 (424)
Q Consensus       128 -----------ea~~~~~~-------~g---~P-vVVKp~~~agGkGV~i~~~~~e~~~~  165 (424)
T Consensus       229 ~~~~g~~~La~~Vd~lL~kI~~KY~eygI~ekPfV~VKad~GTYGMGIm~v~~~~ei~~L  288 (404)
T pfam08886       229 HDREGEECLAEKVDALLAKIREKYKEYGIKEKPFVFVKADAGTYGMGIMTVRSGDEVLAL  288 (404)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCEEEEECCHHHHHHH
T ss_conf             744369999999999999999999970999884599967899877337995599999886