BLAST/PSIBLAST alignment of GI: 254780206 and GI: 190890598 at iteration 1
>gi|190890598|ref|YP_001977140.1| phosphoribosylamine-glycine ligase [Rhizobium etli CIAT 652] Length = 423
>gi|218517166|ref|ZP_03514006.1| phosphoribosylamine--glycine ligase [Rhizobium etli 8C-3] Length = 423
>gi|190695877|gb|ACE89962.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli CIAT 652] Length = 423
 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/421 (55%), Positives = 299/421 (71%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLLSE ++ PGNPGIA+HA  V I+I +H A+  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLSEFYAAPGNPGIAEHAVLVPINIDDHEAVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF+       + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDG+ A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGRHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM +  +PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTIRGMAESGHPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L     +W  + ALTVV+A+KGYP  Y   T I  +PQ     ++F
Sbjct: 301 SDLLPLLLAAANGTLDQVSADWSDDPALTVVMASKGYPGAYEKNTPILSLPQAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+R+ AY +++ + W +G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTATGGTVAEARDRAYALLDKVRWDNGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421