BLAST/PSIBLAST alignment of GI: 254780206 and GI: 222085071 at iteration 1
>gi|222085071|ref|YP_002543601.1| phosphoribosylamine-glycine ligase protein [Agrobacterium radiobacter K84] Length = 423
>gi|221722519|gb|ACM25675.1| phosphoribosylamine-glycine ligase protein [Agrobacterium radiobacter K84] Length = 423
 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 305/420 (72%), Gaps = 4/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL++E ++ PGNPGIA++A   A+DI++H A++ FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEYATLAALDIEDHGAVVAFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV GI+DAL AAG  VFGPS  AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGIADALRAAGIAVFGPSTAAAQLEGSKGFTKDICARYNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA TVDEA +A+D CF+    +  + 
Sbjct: 121 QRFNNAPKAKVYIREQGAPIVVKADGLAAGKGVTVAMTVDEALAAVDDCFEGAFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE YL+G E SFF L DGK A+   TA+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVIEAYLDGEEASFFCLSDGKHALALATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGYPFSGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +C +G L      W  + AL+VV+A+KGYP  Y   T I+ +P ++   ++F
Sbjct: 301 SDLLPLLLACANGTLDQVDAEWSDDVALSVVMASKGYPGSYAKNTPIAALPADSEGAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ ++ L A GGRVL+ TA G+T++E+++ AY +   ++W++G+ R DIG Q   R
Sbjct: 361 HAGTALKDDALVATGGRVLNVTATGRTVSEAQKRAYALASKVEWENGFNRSDIGWQAIAR 420