BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780206|ref|YP_003064619.1| phosphoribosylamine--glycine
ligase [Candidatus Liberibacter asiaticus str. psy62]
         (424 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780206|ref|YP_003064619.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039883|gb|ACT56679.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 424

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE
Sbjct: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY
Sbjct: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE
Sbjct: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV
Sbjct: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL
Sbjct: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT 360
           EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT
Sbjct: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT 360

Query: 361 AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKY 420
           AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKY
Sbjct: 361 AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKY 420

Query: 421 RNKS 424
           RNKS
Sbjct: 421 RNKS 424


>gi|315122631|ref|YP_004063120.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496033|gb|ADR52632.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 414

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/414 (78%), Positives = 377/414 (91%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSPLLSELWS  GNPGIAQHA+C+ +D+++H AII FCQ+
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPLLSELWSTSGNPGIAQHAKCIPLDVEDHLAIIQFCQK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLV++GPELPLVNGISDALN+AGFKVFGPS+RA++LESSK F KKFCTKY IPTA Y
Sbjct: 61  KKIDLVIIGPELPLVNGISDALNSAGFKVFGPSKRASQLESSKFFTKKFCTKYSIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           QHF+DP+ AK+YV+ + MPIV+KADG+ AGKGVVVA T+D A  AIDRCFQQINSTV+IE
Sbjct: 121 QHFADPIVAKKYVKTQKMPIVIKADGIFAGKGVVVATTLDAAIVAIDRCFQQINSTVVIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           EYLEGFEVSFFA+CDGK A+PFTTARDHKR+ DGDIGPNTGGMGACSPALG+S+ELYST+
Sbjct: 181 EYLEGFEVSFFAICDGKIAVPFTTARDHKRVGDGDIGPNTGGMGACSPALGLSKELYSTI 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           I+ II PT+EGM++E+ PFQGVLFAGLMIT+Q PYLIEYNVRFGDPECQAMMMRLESDIL
Sbjct: 241 IKTIIQPTVEGMKQEKIPFQGVLFAGLMITKQKPYLIEYNVRFGDPECQAMMMRLESDIL 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT 360
           EILNSC  GNLHNT I+WKAEYALTVVVAT GYPE YP GT+I KIP +T  T+LFHAGT
Sbjct: 301 EILNSCAQGNLHNTTIDWKAEYALTVVVATNGYPETYPKGTVIRKIPLDTDKTKLFHAGT 360

Query: 361 AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +I++ +L ANGGRVL+ATALGKTI+ESRE AY+MVE+IDW+HG+WR+DIGLQKK
Sbjct: 361 SIIDGSLVANGGRVLNATALGKTISESRERAYNMVEDIDWEHGFWRKDIGLQKK 414


>gi|222147723|ref|YP_002548680.1| phosphoribosylamine--glycine ligase [Agrobacterium vitis S4]
 gi|221734711|gb|ACM35674.1| phosphoribosylamine--glycine ligase [Agrobacterium vitis S4]
          Length = 426

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 301/420 (71%), Gaps = 4/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWK+AQSPL+   ++ PGNPGIA+HA+ V ++I +HSA+I FC++
Sbjct: 1   MNILLIGSGGREHALAWKLAQSPLIGAFYAAPGNPGIAEHAELVNVNIDDHSAVIAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K +D VVVGPE PLV G++DAL AAG  VFGPS  AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KAVDFVVVGPEAPLVAGLADALRAAGLTVFGPSAAAAQLEGSKGFTKDVCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK YV+ +  PIV+KADGL AGKGV VA T+DEA SAID CF+       + 
Sbjct: 121 QRFNNAPKAKAYVRQQGAPIVIKADGLAAGKGVTVAMTLDEALSAIDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +L+G E SFF LCDGKT +P  TA+DHKR+ DGD GPNTGGMGA SPA  M+ ++
Sbjct: 181 VVVEAFLDGEEASFFCLCDGKTLLPLATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTSDM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTLREIIEPTMRGMAELGMPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L++C  G L      W  + ALTVV+A+KGYP  +   T I+ IP  +   ++F
Sbjct: 301 SDLLPLLHACASGTLDQVSAEWHDDPALTVVLASKGYPGSFTKNTPIAAIPAASDEAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ +  L A GGRVL+ATA GKT+ E++  AY +   ++W +G+ R DIG Q   R
Sbjct: 361 HAGTALKDGQLIATGGRVLNATARGKTVAEAQAKAYALARQVEWDNGFSRSDIGWQAIAR 420


>gi|13476192|ref|NP_107762.1| phosphoribosylamine--glycine ligase [Mesorhizobium loti MAFF303099]
 gi|20139625|sp|Q986A5|PUR2_RHILO RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|14026952|dbj|BAB53548.1| phosphoribosylamine-glycine ligase [Mesorhizobium loti MAFF303099]
          Length = 425

 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 238/421 (56%), Positives = 298/421 (70%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWKIA SPLL++L++ PGNPGI   A+ V +DI +H+A+  FCQE
Sbjct: 1   MNVLLLGSGGREHALAWKIAASPLLTKLYAAPGNPGIGAEAELVKLDITDHAAVTAFCQE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV GI+D L A   +VFGPS+ AA+LE SK F K  C +Y IPTA Y
Sbjct: 61  KKIDLVVVGPEGPLVAGIADDLRAENIRVFGPSKAAARLEGSKGFTKDLCARYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F+D   AK YV     PIV+KADGL AGKGV VA T DEA +A+D CF+       + 
Sbjct: 121 GRFNDLASAKAYVDQTGAPIVIKADGLAAGKGVTVAMTSDEARAALDACFEGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFF LCDG TA+PF TA+DHKR+ DGD+GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFMTGEEASFFCLCDGTTALPFGTAQDHKRVGDGDVGPNTGGMGAYSPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF G+LFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 IERTMREIIEPTMRGMAELGAPFAGILFAGLMITDKGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQL 355
            D+L +LN+ V G L +T I W+ E ALTVV+A +GYP     G++I  + Q  G   Q+
Sbjct: 301 DDLLVLLNAAVDGQLAHTSIRWRDEAALTVVMAARGYPGTPEKGSVIRGVEQAAGEGVQI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTAI    L ANGGRVL+ TA G T+ E+++ AY  ++ IDW  G+ R DIG Q   
Sbjct: 361 FHAGTAINGGALVANGGRVLNVTASGATVGEAQKRAYAALDRIDWPDGFCRRDIGWQAVA 420

Query: 416 R 416
           R
Sbjct: 421 R 421


>gi|222085071|ref|YP_002543601.1| phosphoribosylamine-glycine ligase protein [Agrobacterium
           radiobacter K84]
 gi|221722519|gb|ACM25675.1| phosphoribosylamine-glycine ligase protein [Agrobacterium
           radiobacter K84]
          Length = 423

 Score =  497 bits (1280), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 305/420 (72%), Gaps = 4/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL++E ++ PGNPGIA++A   A+DI++H A++ FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEYATLAALDIEDHGAVVAFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV GI+DAL AAG  VFGPS  AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGIADALRAAGIAVFGPSTAAAQLEGSKGFTKDICARYNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA TVDEA +A+D CF+    +  + 
Sbjct: 121 QRFNNAPKAKVYIREQGAPIVVKADGLAAGKGVTVAMTVDEALAAVDDCFEGAFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE YL+G E SFF L DGK A+   TA+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVIEAYLDGEEASFFCLSDGKHALALATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGYPFSGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +C +G L      W  + AL+VV+A+KGYP  Y   T I+ +P ++   ++F
Sbjct: 301 SDLLPLLLACANGTLDQVDAEWSDDVALSVVMASKGYPGSYAKNTPIAALPADSEGAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ ++ L A GGRVL+ TA G+T++E+++ AY +   ++W++G+ R DIG Q   R
Sbjct: 361 HAGTALKDDALVATGGRVLNVTATGRTVSEAQKRAYALASKVEWENGFNRSDIGWQAIAR 420


>gi|227821053|ref|YP_002825023.1| phosphoribosylamine--glycine ligase [Sinorhizobium fredii NGR234]
 gi|227340052|gb|ACP24270.1| phosphoribosylamine--glycine ligase [Sinorhizobium fredii NGR234]
          Length = 423

 Score =  494 bits (1272), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/421 (53%), Positives = 297/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L+ L++ PGNPGIA+ A  VA+DI +H+A++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPQLTALYAAPGNPGIAEEATIVALDIDDHAAVVDFCRR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID VVVGPE PLV G++DAL AAG   FGPS  AA+LE SK F K  C KY IPT  Y
Sbjct: 61  ESIDFVVVGPEAPLVAGLADALRAAGIATFGPSAAAAQLEGSKGFTKDLCAKYAIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI----NST 176
           + F++   AK Y++ +  PIV+KADGL AGKGV VA T+DEA +A+D CF  +     + 
Sbjct: 121 KRFTEAEPAKAYIREQGAPIVIKADGLAAGKGVTVAMTLDEALAAVDECFSGVFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF L DGK  +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEAYLDGEEASFFCLSDGKAVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAGM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +Q+II PT+ GM +   PF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMR++
Sbjct: 241 VERTMQEIIEPTVRGMAESGYPFTGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRMK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L    I W  + ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLYAAATGTLDGKEIEWHDDAALTVVMASRGYPGSYEKNTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTAI +  L A GGRVL+ TA+G T++++++ AY  V  + W++G++R DIG +   R
Sbjct: 361 HAGTAIKDGRLVATGGRVLNVTAMGSTVSDAKDAAYAGVNGVSWENGFYRRDIGWRAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|319784734|ref|YP_004144210.1| phosphoribosylamine/glycine ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170622|gb|ADV14160.1| phosphoribosylamine/glycine ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 425

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/421 (56%), Positives = 296/421 (70%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWKIA SPLL++L++ PGNPGI   A+ V +DI +H+A+  FC+E
Sbjct: 1   MNVLLLGSGGREHALAWKIAASPLLTKLYAAPGNPGIGGEAELVKLDIADHAAVTAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV GI+D L A   +VFGPS+ AA+LE SK F K  C +Y IPTATY
Sbjct: 61  KKIDLVVVGPEGPLVAGIADDLRAENIRVFGPSKAAARLEGSKGFTKDLCARYNIPTATY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             FSD   AK YV+    PIV+KADGL AGKGV VA T+ EA +A+D CF        + 
Sbjct: 121 GRFSDLASAKAYVEKTGAPIVIKADGLAAGKGVTVAMTLSEAQAALDACFDGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFF LCDG TA+PF TA+DHKR+ DGD GPNTGGMGA SPA  M+ EL
Sbjct: 181 VVVEEFMTGEEASFFCLCDGTTALPFGTAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GVLFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VERTMREIIEPTMRGMAELGAPFSGVLFAGLMITDKGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQL 355
            D+L +LN+   G L +T + W+ E ALTVV+A +GYP     G++I  +    G   Q+
Sbjct: 301 DDLLVLLNAATDGQLAHTSVRWRDEAALTVVMAARGYPGTPEKGSVIRGVEDVAGDGVQI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTAI    L ANGGRVL+ TA G T+ E+++ AY  ++ IDW  G+ R DIG Q   
Sbjct: 361 FHAGTAINGGALVANGGRVLNVTASGATVGEAQKRAYAALDRIDWPDGFCRRDIGWQAVA 420

Query: 416 R 416
           R
Sbjct: 421 R 421


>gi|159184405|ref|NP_353670.2| phosphoribosylamine--glycine ligase [Agrobacterium tumefaciens str.
           C58]
 gi|25091083|sp|Q8UHN3|PUR2_AGRT5 RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|159139718|gb|AAK86455.2| phosphoribosylamine--glycine ligase [Agrobacterium tumefaciens str.
           C58]
          Length = 423

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/421 (54%), Positives = 295/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSPL+  L++ PGNPGIA HA  V++D+++H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPLIDALYAAPGNPGIADHATLVSLDVEDHAAVIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VV+GPE PLV G++D L AAG   FGPS+ AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVIGPEAPLVAGLADDLRAAGIATFGPSKAAAQLEGSKGFTKDLCARYDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F     AK YV+ +  PIV+KADGL AGKGV VA T  EA +AID CF     T    
Sbjct: 121 ERFKAAEPAKDYVRAQGAPIVIKADGLAAGKGVTVAMTEAEALAAIDDCFDGAFGTAGTE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +L+G E SFF L DGKTA+   TA+DHKR+ DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEAFLDGEEASFFCLSDGKTALALATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPAM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM K+ NPF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTISGMAKDGNPFSGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L IL +   G L      W+ + ALTVV+A+KGYP  Y   T I+ IP+ +   ++F
Sbjct: 301 SDLLPILYATATGTLDKVQAEWRDDAALTVVLASKGYPGAYDKNTPIAHIPEASEEAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ +  L A GGRVL+ TA G+ +TE++  AY + + ++W++G+ R DIG Q   R
Sbjct: 361 HAGTALKDGKLVATGGRVLNVTAFGRNVTEAQARAYALADKVEWENGFCRRDIGWQAIAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|163761031|ref|ZP_02168109.1| phosphoribosylamine--glycine ligase [Hoeflea phototrophica DFL-43]
 gi|162281812|gb|EDQ32105.1| phosphoribosylamine--glycine ligase [Hoeflea phototrophica DFL-43]
          Length = 426

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 233/421 (55%), Positives = 299/421 (71%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIAQSPLL   ++ PGNPGIA HA+   +D+ +H A+I FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAQSPLLGTFFAAPGNPGIADHAELTGLDVSDHQAVIAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID+VVVGPE PLV G++DALN AG KVFGPS  AA+LE SK F K  C + GIPTA Y
Sbjct: 61  KAIDMVVVGPEAPLVAGLADALNDAGIKVFGPSAAAAQLEGSKGFTKDLCARQGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK YV+ + +PIV+KADGL AGKGV VA T+++A  AI+ CF+    +  + 
Sbjct: 121 QCFNNAPKAKAYVRTQGVPIVIKADGLAAGKGVTVAMTLEDAFDAIEDCFEGAYGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFF LCDG+TA+PF TA+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFMTGEEASFFCLCDGQTALPFGTAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++II PT+ GM +   PF GVL+AGLMI E GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 IAQTMEQIIDPTMRGMAEMGAPFTGVLYAGLMIDETGPKLIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTGTTQL 355
            DIL +L++   G L +    W  + ALTVV+A +GYP     G+ I+ + Q      ++
Sbjct: 301 DDILVLLSAAADGGLRHVSARWSDQAALTVVMAAEGYPGTPKKGSAIAGLKQAEANGAKV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTA  +  L ANGGRVL+ TA G  +  ++ L Y  VE IDW  G++R DIG +  E
Sbjct: 361 FHAGTAQKDGQLIANGGRVLNVTAQGADVKAAQSLVYQAVEAIDWPGGFYRRDIGWRAVE 420

Query: 416 R 416
           R
Sbjct: 421 R 421


>gi|150395696|ref|YP_001326163.1| phosphoribosylamine--glycine ligase [Sinorhizobium medicae WSM419]
 gi|150027211|gb|ABR59328.1| phosphoribosylamine--glycine ligase [Sinorhizobium medicae WSM419]
          Length = 423

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 229/420 (54%), Positives = 294/420 (70%), Gaps = 4/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L+ L++ PGNPGIA+ A  VA+D+ NH A++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTTLYAAPGNPGIAEEAAIVALDVGNHVAVVDFCRS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV G++D L  AG  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDLVVVGPEAPLVAGLADVLIGAGIPVFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + FSD   A+ YV+ +  PIV+KADGL AGKGV VA  ++EA +A+D CF          
Sbjct: 121 KRFSDAESARAYVREQGAPIVIKADGLAAGKGVTVAMNLEEALAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK  +P  +A+DHKR+ DGD GPNTGGMGA SPA  MS E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKNVLPLGSAQDHKRVGDGDTGPNTGGMGAYSPAPVMSPEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMREIIQPTVRGMSENGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L      W+ + ALTVV+A +GYP  Y   T I  +P+ + TT++F
Sbjct: 301 SDLLPLLYAAATGTLEGMKAEWRDDVALTVVMAARGYPGSYEKDTPIDALPEASATTKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA GK+++ +++ AY  V N+ W++G+ R DIG +   R
Sbjct: 361 HAGTTMKDGRLVATGGRVLNVTATGKSVSVAKDAAYAAVRNVTWENGFHRNDIGWRAVAR 420


>gi|190890598|ref|YP_001977140.1| phosphoribosylamine-glycine ligase [Rhizobium etli CIAT 652]
 gi|218517166|ref|ZP_03514006.1| phosphoribosylamine--glycine ligase [Rhizobium etli 8C-3]
 gi|190695877|gb|ACE89962.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli CIAT
           652]
          Length = 423

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/421 (55%), Positives = 299/421 (71%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLLSE ++ PGNPGIA+HA  V I+I +H A+  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLSEFYAAPGNPGIAEHAVLVPINIDDHEAVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF+       + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDG+ A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGRHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM +  +PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTIRGMAESGHPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L     +W  + ALTVV+A+KGYP  Y   T I  +PQ     ++F
Sbjct: 301 SDLLPLLLAAANGTLDQVSADWSDDPALTVVMASKGYPGAYEKNTPILSLPQAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+R+ AY +++ + W +G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTATGGTVAEARDRAYALLDKVRWDNGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|260460337|ref|ZP_05808589.1| phosphoribosylamine/glycine ligase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033982|gb|EEW35241.1| phosphoribosylamine/glycine ligase [Mesorhizobium opportunistum
           WSM2075]
          Length = 425

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/421 (55%), Positives = 291/421 (69%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWKIA SPLL++L++ PGNPGI   A+   +DI +H+AI  FC+E
Sbjct: 1   MNVLLLGSGGREHALAWKIAASPLLTKLYAAPGNPGIGSEAELAKLDITDHAAIAVFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV GI+D L A   +VFGPS+ AA+LE SK F K  C +Y IPTA Y
Sbjct: 61  KKIDLVVVGPEGPLVAGIADDLRAENIRVFGPSKAAARLEGSKGFTKDLCARYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F D   AK YV+    PIV+KADGL AGKGV VA T+DEA +A+D CF        + 
Sbjct: 121 GRFGDLASAKAYVEKTGAPIVIKADGLAAGKGVTVAMTLDEARAALDSCFDGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF LCDG TA+PF TA+DHKR+ DGD+GPNTGGMGA SPA  M+ E 
Sbjct: 181 VVIEEFMTGEEASFFCLCDGTTALPFGTAQDHKRVGDGDVGPNTGGMGAYSPAPVMTPET 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM     PF G+LFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VERTMREIIQPTMRGMANLGAPFAGILFAGLMITDKGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQL 355
            D+L +LN+   G L +T + W+ + ALTVV+A +GYP     G++I  +        Q+
Sbjct: 301 DDLLVLLNAATDGQLAHTSVRWRDQAALTVVMAARGYPGTPEKGSVIRGVEDAAADGVQI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTAI    L ANGGRVL+ TA G T+ E++  AY  ++ IDW  G+ R DIG Q   
Sbjct: 361 FHAGTAINGGALVANGGRVLNVTATGATVGEAQARAYAALDRIDWPDGFCRRDIGWQAVA 420

Query: 416 R 416
           R
Sbjct: 421 R 421


>gi|307320093|ref|ZP_07599514.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti AK83]
 gi|306894308|gb|EFN25073.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti AK83]
          Length = 423

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 227/421 (53%), Positives = 292/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L++L++ PGNPGIA+ A  V +  +NH  ++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VVVGPE PLV G+ D L AA    FGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDFVVVGPEAPLVAGLGDVLRAADIPTFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   AK Y++ +  PIV+KADGL AGKGV VA ++DEA +A+D CF          
Sbjct: 121 RRFTDAEPAKAYIREEGAPIVIKADGLAAGKGVTVAMSLDEAFAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK+ +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKSVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 VERTMKEIIEPTVRGMAESGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L      W+ E ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLYAAATGTLEGMKAEWRDEAALTVVMASRGYPGAYEKDTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+    L A GGRVL+ TA GKT+ E+++ AY  V ++ W++G++R DIG Q   R
Sbjct: 361 HAGTAMKGGGLVAAGGRVLNVTATGKTVGEAKDAAYAAVRDVSWENGFYRNDIGWQAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|307309357|ref|ZP_07589020.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti BL225C]
 gi|306900226|gb|EFN30844.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti BL225C]
          Length = 423

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 226/421 (53%), Positives = 293/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L++L++ PGNPGIA+ A  V +  +NH  ++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VVVGPE PLV G+ D L AA    FGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDFVVVGPEAPLVAGLGDVLRAADIPTFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   AK Y++ +  PIV+KADGL AGKGV VA ++DEA +A+D CF          
Sbjct: 121 RRFTDAEPAKAYIREEGAPIVIKADGLAAGKGVTVAMSLDEAFAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK+ +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKSVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 VERTMKEIIEPTVRGMAESGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L++   G L      W+ E ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLHAAATGTLEGMKAEWRDEAALTVVMASRGYPGAYEKDTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+    L A GGRVL+ TA GKT+ E+++ AY  V ++ W++G++R DIG +   R
Sbjct: 361 HAGTAMKGGGLVAAGGRVLNVTATGKTVCEAKDAAYAAVRDVSWENGFYRNDIGWRAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|241203325|ref|YP_002974421.1| phosphoribosylamine--glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857215|gb|ACS54882.1| phosphoribosylamine/glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 425

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/422 (54%), Positives = 301/422 (71%), Gaps = 4/422 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL+SE ++ PGNPGIA+HA  V +DI++H A++ FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMSEFYAAPGNPGIAEHAVLVPVDIEDHEAVVAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ + +PIVVKADGL AGKGV VA T+DEA +A+D CF+       + 
Sbjct: 121 QRFNNGPKAKAYIRAEGVPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +  +PF GV FAGLMIT++GP LIEYNVRFGDPECQ MMMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITKKGPELIEYNVRFGDPECQVMMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L      W  + ALTVV+A+KGYP  Y   T I  +P      ++F
Sbjct: 301 SDLLPLLLATANGTLDQVKAEWNEDPALTVVMASKGYPGAYDKNTPILSLPDAGKGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E++  AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTASGGTVAEAKSRAYALLDRVRWENGFCRRDIGWRAIER 420

Query: 417 NV 418
            +
Sbjct: 421 EM 422


>gi|325292029|ref|YP_004277893.1| phosphoribosylamine-glycine ligase [Agrobacterium sp. H13-3]
 gi|325059882|gb|ADY63573.1| phosphoribosylamine-glycine ligase [Agrobacterium sp. H13-3]
          Length = 423

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/421 (55%), Positives = 294/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSPLL EL++ PGNPGIA HA  V++D+++H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPLLDELYAAPGNPGIADHATVVSLDVEDHAAVIAFARE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L AA    FGPS+ AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADDLRAADIATFGPSKAAAQLEGSKGFTKDLCARYDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F     AKQYV+ +  PIV+KADGL AGKGV VA +  EA +AID CF        + 
Sbjct: 121 QRFKTAEPAKQYVREQGAPIVIKADGLAAGKGVTVAMSEAEALAAIDDCFDGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +L+G E SFF L DGKTA+   TA+DHKR+ DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEAFLDGEEASFFCLSDGKTALALATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPAM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM K+ NPF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTISGMAKDGNPFSGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L IL +   G L      W+ + ALTVV+A+KGYP  Y   T I+ IP  +   ++F
Sbjct: 301 SDLLPILYATATGTLDKVKAEWRDDAALTVVLASKGYPGAYDKNTPIAHIPDASEEAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ +  L A GGRVL+ TA GK +TE++  AY +   ++W++G+ R DIG Q   R
Sbjct: 361 HAGTALKDGRLVATGGRVLNVTAFGKNVTEAQARAYALAAKVEWENGFCRRDIGWQAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|209548141|ref|YP_002280058.1| phosphoribosylamine--glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533897|gb|ACI53832.1| phosphoribosylamine/glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 427

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/420 (54%), Positives = 300/420 (71%), Gaps = 4/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL++E ++ PGNPGIA+HA  V ++I++H A+  FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEHAMLVPVNIEDHEAVAAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLVVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++++ +PIVVKADGL AGKGV VA T+DEA +A+D CF+       + 
Sbjct: 121 QRFNNAPKAKAYIRDQGVPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKNALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +  +PF GV FAGLMIT +GP LIEYNVRFGDPECQ MMMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITSRGPELIEYNVRFGDPECQVMMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L      W  + ALTVV+A+KGYP  Y   T I  +P+     ++F
Sbjct: 301 SDLLPLLLATANGTLDQMSAEWSDDPALTVVMASKGYPAAYEKNTPILSLPEAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+++ AY +++ + W +G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTASGGTVAEAKDRAYALLDRVKWDNGFSRRDIGWRAIER 420


>gi|15964611|ref|NP_384964.1| phosphoribosylamine--glycine ligase [Sinorhizobium meliloti 1021]
 gi|20139566|sp|Q92RL0|PUR2_RHIME RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|15073789|emb|CAC45430.1| Probable phosphoribosylamine--glycine ligase [Sinorhizobium
           meliloti 1021]
          Length = 423

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 226/421 (53%), Positives = 292/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L++L++ PGNPGIA+ A  V +  +NH  ++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VVVGPE PLV G+ D L AA    FGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDFVVVGPEAPLVAGLGDVLRAADIPTFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   AK Y++ +  PIV+KADGL AGKGV VA ++DEA +A+D CF          
Sbjct: 121 RRFTDAEPAKAYIREEGAPIVIKADGLAAGKGVTVAMSLDEAFAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK+ +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKSVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 VERTMKEIIEPTVRGMAESGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L      W+ E ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLYAAATGTLEGMKAEWRDEAALTVVMASRGYPGAYEKDTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+    L A GGRVL+ TA GKT+ E+++ AY  V ++ W++G++R DIG +   R
Sbjct: 361 HAGTAMKGGGLVAAGGRVLNVTATGKTVGEAKDAAYAAVRDVSWENGFYRNDIGWRAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|86356532|ref|YP_468424.1| phosphoribosylamine--glycine ligase [Rhizobium etli CFN 42]
 gi|86280634|gb|ABC89697.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli CFN 42]
          Length = 427

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 233/421 (55%), Positives = 296/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLLSE ++ PGNPGIA+HA    ++I +H  +  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLSEFYAAPGNPGIAEHAVLAPLNIDDHETVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDLVVVGPEAPLVAGLADRLRADGLAVFGPSAGAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF+       + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAYGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YLEG E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLEGEEASFFCLCDGKHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTIRGMAESGYPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  HG L      W  + ALTVV+A+KGYP  Y   T I  +P+     ++F
Sbjct: 301 SDLLPLLLATAHGTLDQVSAEWSDDPALTVVMASKGYPGAYEKNTPIEFLPEAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E++  AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGMKDGVLVATGGRVLNVTASGGTVAEAKGRAYALLDRVRWENGFCRRDIGWRATER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|327192807|gb|EGE59734.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli
           CNPAF512]
          Length = 423

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 297/420 (70%), Gaps = 4/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLL+E ++ PGNPGIA+HA  V I+I +H A+  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLTEFYAAPGNPGIAEHAVLVPINIDDHEAVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF+       + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKNALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM    +PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTIRGMAASGHPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L      W  + ALTVV+A+KGYP  Y   T I  +PQ     ++F
Sbjct: 301 SDLLPLLLAAANGMLDQVGAEWSDDPALTVVMASKGYPGAYEKNTPILSLPQAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+ + AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTATGGTVAEASDRAYALLDKVRWENGFCRRDIGWRAIER 420


>gi|218671709|ref|ZP_03521378.1| phosphoribosylamine--glycine ligase [Rhizobium etli GR56]
          Length = 423

 Score =  481 bits (1239), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/421 (54%), Positives = 298/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLLSE ++ PGNPGIA+HA  + ++I +H A+  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLSEFYAAPGNPGIAEHAILIPVNIDDHEAVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF+       + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDG+ A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGRHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM +  +PF GV FAGLMITE+GP LIEYNVRFGDPECQ ++MRL+
Sbjct: 241 VERTMKEIIEPTIRGMAESGHPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLLMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L     +W  + ALTVV+A+KGYP  Y   T I  +P+     ++F
Sbjct: 301 SDLLPLLLATANGTLDQVSADWSDDPALTVVMASKGYPGAYEKNTPILSLPEVGDGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+ + AY +++ + W +G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTATGGTVAEASDRAYALLDKVRWDNGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|121602480|ref|YP_988711.1| phosphoribosylamine--glycine ligase [Bartonella bacilliformis
           KC583]
 gi|120614657|gb|ABM45258.1| phosphoribosylamine--glycine ligase [Bartonella bacilliformis
           KC583]
          Length = 424

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 303/422 (71%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +  + + +DI +H  +I FC+ 
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCAPGNPATIEFGENIVLDIDDHLLVIDFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV++GPE PL++GI+DALNAA   VFGP+Q+AA+LE SKSF K  C +  IPT+ Y
Sbjct: 61  HSIDLVIIGPEAPLISGITDALNAADIYVFGPNQKAAQLEGSKSFTKDLCQRNNIPTSIY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F D  KAK Y++ + +PIV+K DGL AGKGVV+A T++EA +A+D CF+         
Sbjct: 121 QCFDDASKAKSYIRQQGVPIVIKVDGLAAGKGVVIATTIEEAFNAVDSCFEGAFGDAGKK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IE +LEG E SFF LCDGKTAIPF +A+DHKR+ DGDIG NTGGMGA SPA  M++E+
Sbjct: 181 IVIEAFLEGEEASFFCLCDGKTAIPFGSAQDHKRVGDGDIGENTGGMGAYSPAPVMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++II P + GM + +  F+G+LFAGLMIT +GP LIE+NVRFGDPECQ +MMRLE
Sbjct: 241 VNRTLKEIIEPALRGMAEMEALFKGILFAGLMITSEGPKLIEFNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NT-GTTQ 354
            DIL +L +   GNL N  I W  + ALTVV+A  GYP     G++I  + + NT    Q
Sbjct: 301 EDILPLLLAAAQGNLENRPILWSEKTALTVVMAANGYPNAPQKGSVIRNVDKVNTLSDVQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FH+GTA+ N  L ANGGRVL+ TA+GKT++++++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFHSGTALHNGELIANGGRVLNITAVGKTVSKAQKRAYEAVDCIDWPQGFVRRDIGWRAI 420

Query: 415 ER 416
            R
Sbjct: 421 AR 422


>gi|239831286|ref|ZP_04679615.1| phosphoribosylamine--glycine ligase [Ochrobactrum intermedium LMG
           3301]
 gi|239823553|gb|EEQ95121.1| phosphoribosylamine--glycine ligase [Ochrobactrum intermedium LMG
           3301]
          Length = 438

 Score =  478 bits (1231), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 225/422 (53%), Positives = 296/422 (70%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+ V I   +H A+I F ++
Sbjct: 12  MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIATVAELVDISADDHKALIAFAKD 71

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV G+SD +   G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 72  KKIDLVVVGPEAPLVAGLSDEMRTEGIRVFGPSKAAAQLEGSKGFTKDLCARFDIPTGAY 131

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+DEA  A+D CF+       + 
Sbjct: 132 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLDEALDAVDACFEGAFGSAGAE 191

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+QE+
Sbjct: 192 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTQEI 251

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               ++++I PT+ GM +   PF G+LF GLMI + GP LIEYN RFGDPECQ +MMRL 
Sbjct: 252 VERTMRELIEPTMRGMAEIGAPFSGILFLGLMIGKDGPKLIEYNTRFGDPECQVLMMRLN 311

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SD+L ++N+ V G L    + WK + ALTVV+A +GYP     G++I  + +  G    +
Sbjct: 312 SDLLALINAAVDGKLDEVSLGWKDQPALTVVMAAEGYPSNVKKGSVIRGLDKLEGIDGVK 371

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  + N+ ANGGRVL+ TA+  T+ E++  AY  V+ IDW  G++R DIG +  
Sbjct: 372 VFHAGTAQKDGNIIANGGRVLNVTAIAGTVAEAQARAYEAVKRIDWPEGFYRSDIGWRAV 431

Query: 415 ER 416
           ER
Sbjct: 432 ER 433


>gi|254718594|ref|ZP_05180405.1| phosphoribosylamine--glycine ligase [Brucella sp. 83/13]
 gi|265983570|ref|ZP_06096305.1| phosphoribosylamine-glycine ligase [Brucella sp. 83/13]
 gi|306839888|ref|ZP_07472686.1| phosphoribosylamine--glycine ligase [Brucella sp. NF 2653]
 gi|264662162|gb|EEZ32423.1| phosphoribosylamine-glycine ligase [Brucella sp. 83/13]
 gi|306405074|gb|EFM61355.1| phosphoribosylamine--glycine ligase [Brucella sp. NF 2653]
          Length = 427

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 299/427 (70%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A++ F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALMAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   +     +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLERIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA+  T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITAMAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKADR 427


>gi|306845024|ref|ZP_07477605.1| phosphoribosylamine--glycine ligase [Brucella sp. BO1]
 gi|306274656|gb|EFM56445.1| phosphoribosylamine--glycine ligase [Brucella sp. BO1]
          Length = 427

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 299/427 (70%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMLAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++ + V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALITAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA+  T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITAMAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKADR 427


>gi|116250721|ref|YP_766559.1| phosphoribosylamine--glycine ligase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255369|emb|CAK06444.1| putative phosphoribosylamine--glycine ligase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 425

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/421 (53%), Positives = 297/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL++E ++ PGNPGIA+HA  VA++I++H A+  FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEHAVLVALNIEDHEAVAAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G+ D L A G  VFGPS  AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLVDRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+D+A +A+D CF+       + 
Sbjct: 121 QRFNNGPKAKSYIRAQGAPIVVKADGLAAGKGVTVAMTLDDALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK  +P  TA+DHKR+ +GDIG NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKHVLPLATAQDHKRVGEGDIGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +  +PF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITRKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L     +W  + ALTVV+A+KGYP  Y   T I  +P      ++F
Sbjct: 301 SDLLPLLLATANGTLDQVSADWSDDPALTVVMASKGYPGAYEKNTPILSLPDAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E++  AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTASGGTVAEAKSRAYALLDRVRWENGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|115526601|ref|YP_783512.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisA53]
 gi|115520548|gb|ABJ08532.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisA53]
          Length = 427

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 295/423 (69%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLL+GSGGREHALAWKIA SPL+ +LW  PGN GIA+ A+C+A+D  +H A+I F ++
Sbjct: 1   MKVLLLGSGGREHALAWKIAASPLVDKLWCAPGNAGIAREAECIALDAADHDAVIAFSRQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G+ DAL  AG K FGPSQ AA+LE SKSF K+ CT+ GIPTA Y
Sbjct: 61  NAVDLVVVGPEAPLVAGLVDALTKAGIKTFGPSQGAAQLEGSKSFTKEICTEAGIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF D   AK Y+Q +  PIV+KADGL AGKGVVVA T+ EA +A+D  F        + 
Sbjct: 121 GHFRDLAAAKAYLQTQGAPIVIKADGLAAGKGVVVAMTMAEADAALDMMFDGGFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF LCDG  A+P  TA+DHKR+ DGD+GPNTGGMGA SPA  M++ +
Sbjct: 181 VVIEEFMQGEEASFFVLCDGDHALPLATAQDHKRVFDGDLGPNTGGMGAYSPAPVMTEAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V+ +II PT+  M     P++GVLFAGLMIT +GP LIEYNVRFGDPECQ +M+RL+
Sbjct: 241 CAQVMDRIINPTLRAMAARGTPYKGVLFAGLMITAEGPKLIEYNVRFGDPECQVLMLRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SD++  L +   G LH+  + W    ALTVV+A KGYP +Y  G++I  + +       +
Sbjct: 301 SDLVPALLAACDGELHHIDLRWSDAPALTVVMAAKGYPGDYAKGSLIEGLDEAAAIEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA G ++ +++  AY  V+ + W  G+ R DIG Q  
Sbjct: 361 IFHAGTKADGDRILANGGRVLNVTATGASVADAQRRAYQAVDRLRWPDGFCRRDIGWQAI 420

Query: 415 ERN 417
           +R 
Sbjct: 421 KRE 423


>gi|75676736|ref|YP_319157.1| phosphoribosylamine--glycine ligase [Nitrobacter winogradskyi
           Nb-255]
 gi|74421606|gb|ABA05805.1| phosphoribosylamine--glycine ligase [Nitrobacter winogradskyi
           Nb-255]
          Length = 426

 Score =  475 bits (1222), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 292/423 (69%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A+CVA+DI +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAGSPLVTKLWCAPGNAGIAREAECVALDIADHAAVIGFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGP + AA+LESSK F K  C   G+PTA Y
Sbjct: 61  SKVDLVVVGPEAPLAAGIVDDLAAAGIKAFGPGKAAAQLESSKGFTKDLCRDNGVPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           + F D   AK Y+     PIV+KADGL AGKGVVVA T+DEA +A+D  F+       + 
Sbjct: 121 ERFRDAGAAKDYIHAHGAPIVIKADGLAAGKGVVVAMTLDEALAAVDMMFEGGFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L G E SFFALCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFLRGEEASFFALCDGEHAMPLATAQDHKRAFDGDEGPNTGGMGAYSPAPVMTDEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II+PT+  M+++  PF+GVLFAGLMITEQGP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CRRTMDEIIVPTLRAMREKGAPFKGVLFAGLMITEQGPKLIEYNVRFGDPECQVLMLRMR 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
            DI+  L +   G L++  + W  + ALTVV+A KGYP  Y  GT I  I +    G  +
Sbjct: 301 GDIVPALFAACDGQLNHFSMRWFPDPALTVVMAAKGYPGSYAKGTRIDGIDEAAKAGGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + A+GGRVL+  ALG T+ E++  AY  V+ I W  G+ R DIGL+  
Sbjct: 361 IFHAGTKEEDGRILASGGRVLNVCALGNTVAEAQARAYEAVDRITWPEGFCRRDIGLRAV 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|153007874|ref|YP_001369089.1| phosphoribosylamine--glycine ligase [Ochrobactrum anthropi ATCC
           49188]
 gi|151559762|gb|ABS13260.1| phosphoribosylamine--glycine ligase [Ochrobactrum anthropi ATCC
           49188]
          Length = 429

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/429 (51%), Positives = 300/429 (69%), Gaps = 6/429 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVLLIGSGGREHALAWK++ SP L++L+  PGNPGIA  A+ V I + +H A+I F ++
Sbjct: 1   MRVLLIGSGGREHALAWKLSASPSLTKLYCAPGNPGIATIAELVDIGVDDHQALIAFAKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV G+SD + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KKIDLVVVGPEAPLVAGLSDEMRAEGIRVFGPSKAAAQLEGSKGFTKDLCARFDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGV+VA T+DEA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVIVAMTLDEALDAVDACFEGAFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               ++++I PT+ GM +   PF G+LF GLMI + GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VERTMRELIEPTMRGMAEIGAPFSGILFLGLMIGKDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SD+L ++N+ V G L    ++WK + ALTVV+A +GYP     G++I  + +  G    +
Sbjct: 301 SDLLALINAAVDGKLDEVSLDWKNQPALTVVMAAEGYPSNVKKGSVIRDLDKLEGIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA  + ++ A+GGRVL+ TA+  T+ E++  AY  V+ IDW  G++R DIG +  
Sbjct: 361 LFHAGTAEKDGSIVASGGRVLNITAIADTVAEAQARAYEAVKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYRNK 423
           ER  +   K
Sbjct: 421 ERETQADKK 429


>gi|39934237|ref|NP_946513.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           CGA009]
 gi|192289763|ref|YP_001990368.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           TIE-1]
 gi|39648085|emb|CAE26605.1| Phosphoribosylglycinamide synthetase (GARS) [Rhodopseudomonas
           palustris CGA009]
 gi|192283512|gb|ACE99892.1| phosphoribosylamine/glycine ligase [Rhodopseudomonas palustris
           TIE-1]
          Length = 427

 Score =  473 bits (1218), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/425 (53%), Positives = 292/425 (68%), Gaps = 6/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A CVA+DI NH A++ FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAASPLVTKLWCAPGNAGIAREATCVALDIGNHQAVVEFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGPS++A++LESSK F K  C  + IPTA Y
Sbjct: 61  NAVDLVVVGPEAPLAAGIVDDLAAAGIKAFGPSRKASQLESSKGFTKDLCKAHDIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + F DP +AK Y++ +  PIV+KADGL AGKGVVVA TV EA +A+D  F          
Sbjct: 121 ERFGDPNQAKTYIRAQGAPIVIKADGLAAGKGVVVAMTVAEAEAAVDMMFGGGLGSAGVE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E++L G E SFF LCDG+ A+P  TA+DHKR +DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEDFLVGEEASFFVLCDGEHALPLATAQDHKRAYDGDKGPNTGGMGAYSPAPVMTDAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +Q+II PT++ M+    PF+GVLFAGLMIT++GP LIEYNVRFGDPECQ +MMR+ 
Sbjct: 241 CQQAMQRIIYPTLKAMKAMGAPFKGVLFAGLMITDEGPQLIEYNVRFGDPECQVLMMRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SDI+  L +C  G L +  + W  E ALTVV+A KGYP  Y  GT I+ + +       Q
Sbjct: 301 SDIVPALLACADGQLDHFSLRWHDEPALTVVMAAKGYPGTYEKGTRIAGLERADAIAGVQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA  KT+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTIASGDWILANGGRVLAVTASAKTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 420

Query: 415 ERNVK 419
            R  +
Sbjct: 421 ARERR 425


>gi|27382609|ref|NP_774138.1| phosphoribosylamine--glycine ligase [Bradyrhizobium japonicum USDA
           110]
 gi|27355781|dbj|BAC52763.1| phosphoribosylamine--glycine ligase [Bradyrhizobium japonicum USDA
           110]
          Length = 427

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 223/421 (52%), Positives = 296/421 (70%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++ W  PGN GIA+ A+CVA+D+ +H+A+I FC+ 
Sbjct: 1   MHILLLGSGGREHALAWKIAASPLVTKFWCAPGNAGIAREAECVALDVADHAAVIAFCKR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ++LVVVGPE PL  GI D L AAG K FGPS  AA+LESSK F K  CT++GIPT  Y
Sbjct: 61  NAVELVVVGPETPLAAGIVDDLTAAGIKAFGPSGAAAQLESSKGFTKALCTEFGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           + F++   A+ YV ++  PIVVKADGL AGKGVVVA TV EA  AI   F+    +  + 
Sbjct: 121 KRFTNAKDARDYVISQGAPIVVKADGLAAGKGVVVAKTVREAEDAIAMMFEGAFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+L G E+SFFALCDG+TAIP  +A+DHKR+ D D+GPNTGGMGA SP   ++  +
Sbjct: 181 VVIEEFLPGREISFFALCDGETAIPLASAQDHKRVFDHDVGPNTGGMGAYSPTPLVTPAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
           +  ++ +IILPT+ GM++   PF+G+L+AG+M+T QGP L E+NVRFGDPECQ +M+R+ 
Sbjct: 241 HDAIMARIILPTVAGMKQRGTPFRGILYAGIMLTTQGPKLFEFNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
           SDI+    +   G L +  + W  E ALTVV+A KGYP +Y  GT I  + +     T +
Sbjct: 301 SDIVPAFIAACDGELKHFDLRWYPESALTVVMAAKGYPGDYQKGTRIQGLEEAAKVDTVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + ANGGRVL+  ALG T+TE++  AY  V+ I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTVAKDGAILANGGRVLNVCALGATVTEAQGRAYQAVDRINWPEGFCRRDIGWQAV 420

Query: 415 E 415
           E
Sbjct: 421 E 421


>gi|110633076|ref|YP_673284.1| phosphoribosylamine--glycine ligase [Mesorhizobium sp. BNC1]
 gi|110284060|gb|ABG62119.1| phosphoribosylamine--glycine ligase [Chelativorans sp. BNC1]
          Length = 426

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/424 (54%), Positives = 305/424 (71%), Gaps = 5/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L++ PGNPGIA+HA+CV++DI++H A+I FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLFAAPGNPGIAEHAECVSLDIRDHEAVIGFCRD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I  VVVGPE PLV G++D L AAG  VFGP+  AA+LE SK F K  C +Y IPTA Y
Sbjct: 61  HGIGFVVVGPEAPLVAGLADDLIAAGIPVFGPTASAARLEGSKGFTKDLCARYDIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI----NST 176
             F D   AK Y++   +PIV+KADGL AGKGV +A T +EA +A+D CF  +     + 
Sbjct: 121 ARFQDAAHAKDYIRKVGVPIVIKADGLAAGKGVTIAVTEEEAFAAVDDCFSGVFGDSGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE L G E SFF LCDGKTA+PF TA+DHKR+ +GD GPNTGGMGA SPA  M+ ++
Sbjct: 181 VVVEELLVGEEASFFCLCDGKTALPFGTAQDHKRVGEGDTGPNTGGMGAYSPAPVMTSDM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            S V+++II PT++GM++  +PF GVL+AGLMIT++GP LIEYNVRFGDPECQ +M+ L+
Sbjct: 241 VSQVMREIIEPTLKGMEEMGSPFVGVLYAGLMITKEGPKLIEYNVRFGDPECQVLMLLLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQL 355
            D+L ++   V G L +  + W+ + ALTVV+A  GYP     G+II  +        ++
Sbjct: 301 DDLLALMKGAVDGQLAHMSVRWRDDAALTVVMAANGYPGTPEKGSIIGGLNAAAAEGAEI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTA+ +  L ANGGRVL+ TALG+T+TE+ + AY  V+ IDW  G+ R DIG +  E
Sbjct: 361 FHAGTALKDGALVANGGRVLNVTALGRTVTEAGDKAYRAVDRIDWPEGFCRRDIGWRAIE 420

Query: 416 RNVK 419
           R  +
Sbjct: 421 RESR 424


>gi|319408208|emb|CBI81861.1| Phosphoribosylamine-glycine ligase [Bartonella schoenbuchensis R1]
          Length = 424

 Score =  471 bits (1213), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/416 (54%), Positives = 299/416 (71%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA+SPLL++L+  PGNP   +  + + ++I +HS +I+FC+E
Sbjct: 1   MNVLLIGSGGREHALAWKIAESPLLTKLYCAPGNPATIELGENIDLNINDHSLVINFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LNAAG  VFGP+Q+AA+LE SKSF K  C +  IPT+ Y
Sbjct: 61  HSIDLVIVGPEGPLVEGITDSLNAAGICVFGPTQKAAQLEGSKSFTKDLCYRNNIPTSIY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F++  +AK Y++ + +PIV+KADGL AGKGVVVA T+ EA  A+D CF+         
Sbjct: 121 QCFNNASQAKSYIRQQGVPIVIKADGLAAGKGVVVAMTMQEAFDAVDACFEGTFNDAKKK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++E +LEG E SFF LCDG TAIPF +A+DHKR+ DGD G NTGGMGA SPA  M++E+
Sbjct: 181 IVVEAFLEGEEASFFCLCDGTTAIPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P +  M     PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALRDMSAMGAPFKGILFTGLMITQKGPELIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NT-GTTQ 354
            DIL +L +   GNL N HI W  + ALTVV+A KGYP     G+II  + + NT    +
Sbjct: 301 DDILSLLLAAAQGNLKNKHIQWSEKTALTVVMAAKGYPNAPQKGSIIRNVDKVNTLPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +F AGTA+ N  L ANGGRVL+ TA G+T+  +++ AY  V+ IDW  G+ R DIG
Sbjct: 361 VFQAGTALHNGELIANGGRVLNITATGETVAHAQQRAYEAVDCIDWPQGFVRRDIG 416


>gi|49473990|ref|YP_032032.1| phosphoribosylamine--glycine ligase [Bartonella quintana str.
           Toulouse]
 gi|49239493|emb|CAF25846.1| Phosphoribosylamine-glycine ligase [Bartonella quintana str.
           Toulouse]
          Length = 424

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 226/422 (53%), Positives = 296/422 (70%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA+SPLL++L+  PGNP   +  + + ++I +H  +I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAKSPLLTKLYCAPGNPATIELGENIDLNIDDHLLVIDFCKM 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LN A   VFGP+Q+AA+LE SK+F K  C K  IPTATY
Sbjct: 61  HSIDLVIVGPEAPLVAGITDSLNNANICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTATY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F+D  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA SA+D CF+     +   
Sbjct: 121 QCFNDAAKAKAYIHQQGVPIVIKADGLAAGKGVVVAMTMEEAFSAVDACFKSTSNDVGEK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IE +LEG E SFF LCDGK A+PF +A+DHKR+ DGD G NTGGMGA SPA  M+QE+
Sbjct: 181 IVIESFLEGEEASFFCLCDGKIALPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTQEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P +  M +   PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALRSMDEMGAPFKGILFVGLMITQKGPELIEFNVRFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQ 354
            DIL IL     GNL N  + W  + ALTVV+A  GYP     GT+I  + +       +
Sbjct: 301 DDILPILLGAAQGNLENKPLQWSEKTALTVVMAANGYPNSPQKGTVIRNVDKVNALPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT + N  L ANGGRVLS TA G+TIT++++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTILCNGELIANGGRVLSITATGETITKAQKRAYEAVDYIDWPEGFVRHDIGWRAV 420

Query: 415 ER 416
            R
Sbjct: 421 VR 422


>gi|163867866|ref|YP_001609070.1| phosphoribosylamine--glycine ligase [Bartonella tribocorum CIP
           105476]
 gi|161017517|emb|CAK01075.1| Phosphoribosylamine-glycine ligase [Bartonella tribocorum CIP
           105476]
          Length = 424

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 226/422 (53%), Positives = 297/422 (70%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL +L+  PGNP   +  + + +DI +H  +I FC+E
Sbjct: 1   MNILLIGSGGREHALAWKIAASPLLKKLYCAPGNPATTEFGENINLDIDDHPLVIDFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV+GI+D+LN A   VFGP+Q+AA+LE SK+F K  C K  IPT +Y
Sbjct: 61  HSIDLVIVGPEAPLVSGITDSLNRAKICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTGSY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F+D  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA +A+D CF+       + 
Sbjct: 121 QCFNDAAKAKAYIHQRGVPIVIKADGLAAGKGVVVATTIEEAFNAVDACFKSAFGDAGNK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IE +LEG E SFF LCDGK A+PF +A+DHKR+ DGD G NTGGMGA SPA  M++E+
Sbjct: 181 IVIESFLEGEEASFFCLCDGKIALPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P ++ M +   PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALKSMHEIGAPFKGILFVGLMITQKGPELIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NT-GTTQ 354
            DIL I  +   G L N  + W  E ALTVV+A  GYP     GT+I  + + NT    +
Sbjct: 301 DDILPIFLAAAQGKLENKPLQWSDETALTVVMAAHGYPSSPQKGTVIRNVDKVNTLPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L ANGGRVL+ TA GKTIT +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALRNGELIANGGRVLNITATGKTITNAQKRAYEAVDCIDWPEGFVRRDIGWRAI 420

Query: 415 ER 416
            R
Sbjct: 421 AR 422


>gi|240850074|ref|YP_002971467.1| phosphoribosylamine-glycine ligase PurD [Bartonella grahamii
           as4aup]
 gi|240267197|gb|ACS50785.1| phosphoribosylamine-glycine ligase PurD [Bartonella grahamii
           as4aup]
          Length = 424

 Score =  468 bits (1204), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 299/422 (70%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL++L+  PGNP   +  + + ++I +H  +I FC++
Sbjct: 1   MNILLIGSGGREHALAWKIAASPLLTKLYCAPGNPATTEFGENINLNIDDHHLVIDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LN+A   VFGP+Q+AA+LE SK+F K  C K  IPT +Y
Sbjct: 61  HSIDLVIVGPEAPLVAGITDSLNSANICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTGSY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F+D  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA +A+D CF+       + 
Sbjct: 121 QCFNDASKAKAYIHQQGVPIVIKADGLAAGKGVVVATTMEEAFNAVDACFKSAFGDAGNK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++E +LEG E SFF LCDGK A+PF +A+DHKR+ DGDIG NTGGMGA SPA  M+QE+
Sbjct: 181 IVVESFLEGEEASFFCLCDGKVALPFGSAQDHKRVGDGDIGANTGGMGAYSPAPIMTQEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P ++ M++   PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALKSMKEMGAPFKGILFVGLMITQKGPELIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
            DIL I  +   G L N  + W  + ALTVV+A  GYP+    GT+I  + +  N    +
Sbjct: 301 DDILPIFLAAAQGKLENKPLRWSEKTALTVVMAANGYPDSPQKGTVIRNVDKVNNLPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT + +  L ANGGRVL+ TA GKTIT +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTVLRDGELIANGGRVLNITATGKTITHAQKRAYEAVDCIDWPEGFVRRDIGWRAI 420

Query: 415 ER 416
            R
Sbjct: 421 AR 422


>gi|319403920|emb|CBI77508.1| Phosphoribosylamine-glycine ligase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 424

 Score =  468 bits (1203), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 293/422 (69%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +    + +DI +H +II+FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCTPGNPATMEFGTNINLDINDHCSIINFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV GI+DALNAA   VFGP+Q+AA+LE SK F K  C K  IPTA Y
Sbjct: 61  NTIDLVVVGPEAPLVGGITDALNAAHICVFGPNQKAAQLEGSKGFTKDLCYKNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F + +KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID CF+         
Sbjct: 121 QRFDNALKAKSYIHQQGIPIVIKADGLAAGKGVVVAMTMEEAFDAIDSCFEGTFGDAGKE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +LEG E SFF LCDGK AIPF +A+DHKRI DGD G NTGGMGA SPA  M++E+
Sbjct: 181 VVVEAFLEGEETSFFCLCDGKIAIPFGSAQDHKRIGDGDTGVNTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +Q+I+ P + G+ +    F+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLQEIVTPALRGLAEMDISFKGILFVGLMITQKGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
            DIL +  +   GNL   ++ W  E ALTVV+A  GYP     G++I  I +  +    +
Sbjct: 301 DDILPLFLAAAQGNLEKKNLQWSEETALTVVMAANGYPVSPQKGSVIRNIDKVNSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA GKTI  +++ AY  VE IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALCNGELIANSGRVLNITATGKTIKIAQKRAYEAVECIDWPEGFVRRDIGWRAI 420

Query: 415 ER 416
            R
Sbjct: 421 MR 422


>gi|49475224|ref|YP_033265.1| phosphoribosylamine--glycine ligase [Bartonella henselae str.
           Houston-1]
 gi|49238029|emb|CAF27236.1| Phosphoribosylamine-glycine ligase [Bartonella henselae str.
           Houston-1]
          Length = 427

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/422 (52%), Positives = 298/422 (70%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SP+L++L+  PGNP   +  + + +DI +H  +I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAASPMLTKLYCAPGNPATIELGENIDLDINDHHLVIDFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LN A   VFGP+Q+AA+LE SK+F K  C K  IPT TY
Sbjct: 61  HSIDLVIVGPEAPLVAGITDSLNNANICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTGTY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F+D  KAK Y++ + +PIV+KADGL AGKGVVVA T++EA +A+D CF+       + 
Sbjct: 121 QCFNDAEKAKAYIRQQGVPIVIKADGLAAGKGVVVAMTMEEAFNAVDACFKSAFGDAGNK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++E +LEG E SFF LCDGK AIPF +A+DHKR+ DGD G NTGGMGA SPA  M+QE+
Sbjct: 181 IVVESFLEGEEASFFCLCDGKIAIPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTQEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +I+ P +  + +  +PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLNEIVEPVLHSLNQMGSPFKGILFVGLMITKKGPELIEFNVRFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQ 354
           +DIL IL +   GNL NT + W  + ALTVV+A KGYP+    GT+I  + +       +
Sbjct: 301 NDILPILLAAARGNLENTSLQWSKKTALTVVMAAKGYPDSPQKGTVIRNVDKVNALPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F A T + N  L ANGGRVL+ TA G+TI ++++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAATVLHNGELIANGGRVLNITATGETILQAQKRAYEAVDFIDWPEGFVRRDIGWRAV 420

Query: 415 ER 416
            R
Sbjct: 421 AR 422


>gi|146342907|ref|YP_001207955.1| phosphoribosylamine--glycine ligase [Bradyrhizobium sp. ORS278]
 gi|146195713|emb|CAL79740.1| Phosphoribosylamine--glycine ligase (GARS) (Glycinamide
           ribonucleotide synthetase) (Phosphoribosylglycinamide
           synthetase) [Bradyrhizobium sp. ORS278]
          Length = 427

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/418 (53%), Positives = 291/418 (69%), Gaps = 6/418 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL++LW  PGN GIA+ A+CVA+D  NH+ +I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAGSPLLTKLWCAPGNAGIAKEAECVALDTTNHADVIAFCRA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D ++ AG K+FGP + AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  NKVDLVVVGPETPLAAGIVDDVSGAGIKIFGPRKLAAQLEGSKGFTKDLCAEYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI----DRCFQQINST 176
             F +  +A  YV+    PIVVKADGL AGKGVVVA T+ EA  A+    D  F    + 
Sbjct: 121 SRFDNAPEALAYVREHGAPIVVKADGLAAGKGVVVARTLVEAEEAVRMMFDGGFGVAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG EVSFFALCDG+TAIP  +A+DHKR+ D D GPNTGGMGA SP   ++QE+
Sbjct: 181 VVIEEFLEGREVSFFALCDGETAIPLASAQDHKRVFDHDQGPNTGGMGAYSPTPFVTQEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
           +  ++++IILPTI+GM     PF+G+L+AGLM+T +GP L EYNVRFGDPECQ +M+R+ 
Sbjct: 241 HDQIMKRIILPTIDGMNARGTPFKGILYAGLMLTAEGPKLFEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
           SD++  + +   G L N  + W  + A+TVV+A +GYP +Y  G++I  +         +
Sbjct: 301 SDLVPAMLAACDGQLKNFDLRWFPDAAVTVVMAAEGYPGDYAKGSVIEGLDDAAKVDGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           +FHAGT + + ++ ANGGRVL+  A GKTITE++  AY  V+ I W  G+ R DI  Q
Sbjct: 361 IFHAGTVVKDGSIIANGGRVLNVCATGKTITEAQARAYEAVDRIRWTDGFCRRDIAWQ 418


>gi|254713019|ref|ZP_05174830.1| phosphoribosylamine--glycine ligase [Brucella ceti M644/93/1]
 gi|254716626|ref|ZP_05178437.1| phosphoribosylamine--glycine ligase [Brucella ceti M13/05/1]
 gi|261218427|ref|ZP_05932708.1| phosphoribosylamine-glycine ligase [Brucella ceti M13/05/1]
 gi|261320724|ref|ZP_05959921.1| phosphoribosylamine-glycine ligase [Brucella ceti M644/93/1]
 gi|260923516|gb|EEX90084.1| phosphoribosylamine-glycine ligase [Brucella ceti M13/05/1]
 gi|261293414|gb|EEX96910.1| phosphoribosylamine-glycine ligase [Brucella ceti M644/93/1]
          Length = 427

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 299/427 (70%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAMVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|62289401|ref|YP_221194.1| phosphoribosylamine--glycine ligase [Brucella abortus bv. 1 str.
           9-941]
 gi|82699328|ref|YP_413902.1| phosphoribosylamine--glycine ligase [Brucella melitensis biovar
           Abortus 2308]
 gi|189023652|ref|YP_001934420.1| phosphoribosylamine--glycine ligase [Brucella abortus S19]
 gi|225626921|ref|ZP_03784960.1| phosphoribosylamine--glycine ligase [Brucella ceti str. Cudo]
 gi|225851950|ref|YP_002732183.1| phosphoribosylamine--glycine ligase [Brucella melitensis ATCC
           23457]
 gi|237814887|ref|ZP_04593885.1| phosphoribosylamine--glycine ligase [Brucella abortus str. 2308 A]
 gi|254688714|ref|ZP_05151968.1| phosphoribosylamine--glycine ligase [Brucella abortus bv. 6 str.
           870]
 gi|254693197|ref|ZP_05155025.1| phosphoribosylamine--glycine ligase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696842|ref|ZP_05158670.1| phosphoribosylamine--glycine ligase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701221|ref|ZP_05163049.1| phosphoribosylamine--glycine ligase [Brucella suis bv. 5 str. 513]
 gi|254707854|ref|ZP_05169682.1| phosphoribosylamine--glycine ligase [Brucella pinnipedialis
           M163/99/10]
 gi|254709564|ref|ZP_05171375.1| phosphoribosylamine--glycine ligase [Brucella pinnipedialis B2/94]
 gi|254729747|ref|ZP_05188325.1| phosphoribosylamine--glycine ligase [Brucella abortus bv. 4 str.
           292]
 gi|256031056|ref|ZP_05444670.1| phosphoribosylamine--glycine ligase [Brucella pinnipedialis
           M292/94/1]
 gi|256112936|ref|ZP_05453844.1| phosphoribosylamine--glycine ligase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256159120|ref|ZP_05456941.1| phosphoribosylamine--glycine ligase [Brucella ceti M490/95/1]
 gi|256254459|ref|ZP_05459995.1| phosphoribosylamine--glycine ligase [Brucella ceti B1/94]
 gi|256256961|ref|ZP_05462497.1| phosphoribosylamine--glycine ligase [Brucella abortus bv. 9 str.
           C68]
 gi|256264540|ref|ZP_05467072.1| phosphoribosylglycinamide synthetase [Brucella melitensis bv. 2
           str. 63/9]
 gi|256368870|ref|YP_003106376.1| phosphoribosylamine--glycine ligase [Brucella microti CCM 4915]
 gi|260168187|ref|ZP_05754998.1| phosphoribosylamine--glycine ligase [Brucella sp. F5/99]
 gi|260545847|ref|ZP_05821588.1| phosphoribosylglycinamide synthetase [Brucella abortus NCTC 8038]
 gi|260754192|ref|ZP_05866540.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 6 str.
           870]
 gi|260757412|ref|ZP_05869760.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 4 str.
           292]
 gi|260761237|ref|ZP_05873580.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883217|ref|ZP_05894831.1| phosphoribosylamine-glycine ligase [Brucella abortus bv. 9 str.
           C68]
 gi|261213439|ref|ZP_05927720.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 3 str.
           Tulya]
 gi|261221631|ref|ZP_05935912.1| phosphoribosylamine-glycine ligase [Brucella ceti B1/94]
 gi|261315343|ref|ZP_05954540.1| phosphoribosylamine-glycine ligase [Brucella pinnipedialis
           M163/99/10]
 gi|261317092|ref|ZP_05956289.1| phosphoribosylamine-glycine ligase [Brucella pinnipedialis B2/94]
 gi|261751760|ref|ZP_05995469.1| phosphoribosylamine-glycine ligase [Brucella suis bv. 5 str. 513]
 gi|261757647|ref|ZP_06001356.1| phosphoribosylglycinamide synthetase [Brucella sp. F5/99]
 gi|265988128|ref|ZP_06100685.1| phosphoribosylamine-glycine ligase [Brucella pinnipedialis
           M292/94/1]
 gi|265994374|ref|ZP_06106931.1| phosphoribosylamine-glycine ligase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997593|ref|ZP_06110150.1| phosphoribosylamine-glycine ligase [Brucella ceti M490/95/1]
 gi|297247814|ref|ZP_06931532.1| phosphoribosylamine-glycine ligase [Brucella abortus bv. 5 str.
           B3196]
 gi|62195533|gb|AAX73833.1| PurD, phosphoribosylamine--glycine ligase [Brucella abortus bv. 1
           str. 9-941]
 gi|82615429|emb|CAJ10398.1| Phosphoribosylglycinamide synthetase [Brucella melitensis biovar
           Abortus 2308]
 gi|189019224|gb|ACD71946.1| Phosphoribosylglycinamide synthetase [Brucella abortus S19]
 gi|225618578|gb|EEH15621.1| phosphoribosylamine--glycine ligase [Brucella ceti str. Cudo]
 gi|225640315|gb|ACO00229.1| phosphoribosylamine--glycine ligase [Brucella melitensis ATCC
           23457]
 gi|237789724|gb|EEP63934.1| phosphoribosylamine--glycine ligase [Brucella abortus str. 2308 A]
 gi|255999028|gb|ACU47427.1| phosphoribosylamine--glycine ligase [Brucella microti CCM 4915]
 gi|260097254|gb|EEW81129.1| phosphoribosylglycinamide synthetase [Brucella abortus NCTC 8038]
 gi|260667730|gb|EEX54670.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 4 str.
           292]
 gi|260671669|gb|EEX58490.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674300|gb|EEX61121.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 6 str.
           870]
 gi|260872745|gb|EEX79814.1| phosphoribosylamine-glycine ligase [Brucella abortus bv. 9 str.
           C68]
 gi|260915046|gb|EEX81907.1| phosphoribosylglycinamide synthetase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260920215|gb|EEX86868.1| phosphoribosylamine-glycine ligase [Brucella ceti B1/94]
 gi|261296315|gb|EEX99811.1| phosphoribosylamine-glycine ligase [Brucella pinnipedialis B2/94]
 gi|261304369|gb|EEY07866.1| phosphoribosylamine-glycine ligase [Brucella pinnipedialis
           M163/99/10]
 gi|261737631|gb|EEY25627.1| phosphoribosylglycinamide synthetase [Brucella sp. F5/99]
 gi|261741513|gb|EEY29439.1| phosphoribosylamine-glycine ligase [Brucella suis bv. 5 str. 513]
 gi|262552061|gb|EEZ08051.1| phosphoribosylamine-glycine ligase [Brucella ceti M490/95/1]
 gi|262765487|gb|EEZ11276.1| phosphoribosylamine-glycine ligase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263094873|gb|EEZ18611.1| phosphoribosylglycinamide synthetase [Brucella melitensis bv. 2
           str. 63/9]
 gi|264660325|gb|EEZ30586.1| phosphoribosylamine-glycine ligase [Brucella pinnipedialis
           M292/94/1]
 gi|297174983|gb|EFH34330.1| phosphoribosylamine-glycine ligase [Brucella abortus bv. 5 str.
           B3196]
 gi|326408448|gb|ADZ65513.1| Phosphoribosylglycinamide synthetase [Brucella melitensis M28]
 gi|326538163|gb|ADZ86378.1| phosphoribosylamine--glycine ligase [Brucella melitensis M5-90]
          Length = 427

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 299/427 (70%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|85717178|ref|ZP_01048136.1| phosphoribosylamine--glycine ligase [Nitrobacter sp. Nb-311A]
 gi|85696011|gb|EAQ33911.1| phosphoribosylamine--glycine ligase [Nitrobacter sp. Nb-311A]
          Length = 426

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/423 (52%), Positives = 288/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPLL++LW  PGN GIA+ A+CVA+++ +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIADSPLLTKLWCAPGNAGIAREAECVALNVADHAAVIAFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGP + AA+LESSK F K  C   GIP A Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAAAGVKAFGPGKAAAQLESSKGFTKDLCRDNGIPAAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           + F D   AK Y+     PIV+KADGL AGKGVVVA T+DEA +A+D  F+       + 
Sbjct: 121 ERFKDAAAAKDYIHAHGAPIVIKADGLAAGKGVVVAMTLDEALAAVDMMFEGGFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++EE+L G E SFFALCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 IVVEEFLRGEEASFFALCDGEHAMPLATAQDHKRAFDGDEGPNTGGMGAYSPAPVMTDEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II+PT+  M+++   F+GVLFAGLMITEQGP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CRRTMDEIIVPTLRAMREKGASFKGVLFAGLMITEQGPKLIEYNVRFGDPECQVLMLRMR 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
            DI+  L +   G L++  + W  + ALTVV+A KGYP  Y  GT I  +         +
Sbjct: 301 GDIVPALFAACDGQLNHFSLRWFPDPALTVVMAAKGYPGSYTKGTRIDGLDDAAKVEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + A GGRVL+  ALGKT+ +++  AY  V+ I W  G+ R DIGL+  
Sbjct: 361 IFHAGTKDDDGRILAVGGRVLNVCALGKTVAKAQARAYEAVDRIRWPEGFCRRDIGLRAV 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|23501317|ref|NP_697444.1| phosphoribosylamine--glycine ligase [Brucella suis 1330]
 gi|161618389|ref|YP_001592276.1| phosphoribosylamine--glycine ligase [Brucella canis ATCC 23365]
 gi|163842696|ref|YP_001627100.1| phosphoribosylamine--glycine ligase [Brucella suis ATCC 23445]
 gi|260566979|ref|ZP_05837449.1| phosphoribosylamine-glycine ligase [Brucella suis bv. 4 str. 40]
 gi|38258167|sp|Q8G2B1|PUR2_BRUSU RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|23347207|gb|AAN29359.1| phosphoribosylamine--glycine ligase [Brucella suis 1330]
 gi|161335200|gb|ABX61505.1| phosphoribosylamine--glycine ligase [Brucella canis ATCC 23365]
 gi|163673419|gb|ABY37530.1| phosphoribosylamine--glycine ligase [Brucella suis ATCC 23445]
 gi|260156497|gb|EEW91577.1| phosphoribosylamine-glycine ligase [Brucella suis bv. 4 str. 40]
          Length = 427

 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 298/427 (69%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVTGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVAGGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|319406932|emb|CBI80569.1| Phosphoribosylamine-glycine ligase [Bartonella sp. 1-1C]
          Length = 424

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/422 (53%), Positives = 292/422 (69%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +    + +DI +H +I+ FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCTPGNPATMEFGTNIDLDINDHFSIVDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV GI+DALNAA   VFGP+Q+AA+LE SK F K  C K  IPTA Y
Sbjct: 61  NTIDLVVVGPEAPLVGGITDALNAAHICVFGPNQQAAQLEGSKGFTKDLCYKNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F + +KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID CF+         
Sbjct: 121 QRFDNALKAKSYIHQQGIPIVIKADGLAAGKGVVVAMTMEEAFDAIDSCFEGTFGDAGKE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +LEG E SFF LCDGK AIPF +A+DHKRI DGD G NTGGMGA SPA  M++E+
Sbjct: 181 VVVEAFLEGEETSFFCLCDGKIAIPFGSAQDHKRIGDGDTGVNTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +Q+I+ P + G+ +    F+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLQEIVTPALRGLAEMDISFKGILFVGLMITQKGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
            DIL +  +   GNL   ++ W  E ALTVV+A  GYP     G++I  I +  +    +
Sbjct: 301 DDILPLFLAAAQGNLEKKNLQWSEETALTVVMAANGYPVSPQKGSVIRNIDKVNSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA GKTI  +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALCNGELIANSGRVLNITATGKTIKIAQKRAYEAVDCIDWPEGFVRRDIGWRAI 420

Query: 415 ER 416
            R
Sbjct: 421 MR 422


>gi|91978565|ref|YP_571224.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisB5]
 gi|91685021|gb|ABE41323.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisB5]
          Length = 427

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/427 (53%), Positives = 293/427 (68%), Gaps = 8/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A CV +D+ +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAASPLVTKLWCAPGNAGIARAATCVPLDLADHAAVIDFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I+ VVVGPE PLV GI D L AAG K FGPS +AA+LE SK F K  C  +GIPTA Y
Sbjct: 61  NAIEFVVVGPEAPLVAGIVDDLTAAGIKAFGPSSKAAQLEGSKGFTKDLCKAHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + FSDP +AK Y++ +  PIVVKADGL AGKGVVVA T+ EA +A+D  F          
Sbjct: 121 ERFSDPDEAKAYIRVQGAPIVVKADGLAAGKGVVVAMTLAEAEAAVDMIFGGALGDAGVE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E++L G E SFF LCDG+ A+   TA+DHKR +DGD GPNTGGMGA SPA  M++ +
Sbjct: 181 VVVEDFLVGEEASFFVLCDGEHALALATAQDHKRAYDGDKGPNTGGMGAYSPAPVMTEAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT++GM+    PF+GVLFAGLMITE GP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CKQAMERIITPTLKGMKAMGMPFKGVLFAGLMITEDGPQLIEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTTQ 354
           SDI+  L +C  G L +  + W  E ALTVV+A KGYP  Y  GT I+ +   +     +
Sbjct: 301 SDIVPALLACADGQLAHFSLRWVDEPALTVVMAAKGYPGAYEKGTRIAGLERAEQIPGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ-- 412
           +FHAGT    + + ANGGRVL+ TA   T+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTMASGDWILANGGRVLAVTASANTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 420

Query: 413 KKERNVK 419
            +ER  K
Sbjct: 421 ARERGRK 427


>gi|90420139|ref|ZP_01228047.1| phosphoribosylamine--glycine ligase [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335473|gb|EAS49223.1| phosphoribosylamine--glycine ligase [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 424

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 225/414 (54%), Positives = 290/414 (70%), Gaps = 4/414 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           + VLLIGSGGREHALAWKIAQSP L +L++ PGNPG+A+HA+ VA+D+ + +A+  FC++
Sbjct: 3   INVLLIGSGGREHALAWKIAQSPELGKLFAAPGNPGVAEHAEIVALDVADAAAVTGFCRD 62

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVVVGPE PLV+G++DAL+ AG KVFGPS+ AA+LE SK F K  CT + IPTA Y
Sbjct: 63  HAIGLVVVGPEQPLVDGLADALSEAGIKVFGPSKAAARLEGSKGFTKDLCTLHDIPTARY 122

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ----INST 176
           + FSD   A+ Y+    +PIVVKADGL AGKGV VA T +EA +A+D CF+       + 
Sbjct: 123 RRFSDAAAARDYINAGGVPIVVKADGLAAGKGVTVAETKEEAIAAVDACFEGDFGGPGAE 182

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+LEG E S F +CDG+ A+ F TA+DHKR  D D GPNTGGMGA SPAL M+  +
Sbjct: 183 VVVEEFLEGEEASLFCICDGERALFFGTAQDHKRAFDRDRGPNTGGMGAYSPALPMTDAV 242

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+++I+ PT+ GM     PF+GVL+ GLM+TE GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 243 TKRVMREIVEPTLAGMTAAGTPFRGVLYVGLMLTETGPKLIEYNVRFGDPECQVLMMRLE 302

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L IL +   G++      W    ALTVV+A  GYP  Y  GT I  +P    + ++F
Sbjct: 303 SDVLPILLAAAEGDVSGVRPEWSDARALTVVMAADGYPGTYAKGTAIRSLPAPDASMRVF 362

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            AGT++ +  L A GGRVL+ TA G T+ E+   AY  VE +DW  G+WR DIG
Sbjct: 363 QAGTSLADGGLVATGGRVLNVTATGATVKEAARRAYEGVEAVDWTEGFWRSDIG 416


>gi|319898594|ref|YP_004158687.1| phosphoribosylamine-glycine ligase [Bartonella clarridgeiae 73]
 gi|319402558|emb|CBI76103.1| Phosphoribosylamine-glycine ligase [Bartonella clarridgeiae 73]
          Length = 424

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/422 (53%), Positives = 293/422 (69%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +  + + +DI +H ++I+FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCTPGNPATMEFGENIDLDIDDHCSVINFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PLV GI+DALNAA   VFGP+Q+A +LE SK F K  C +  IPTA Y
Sbjct: 61  NAIDLAVVGPEAPLVAGITDALNAAHICVFGPNQKATQLEGSKGFTKDLCYRNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F +  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID CF+         
Sbjct: 121 QRFDNASKAKSYIHQQGIPIVIKADGLAAGKGVVVAMTIEEAFDAIDACFEGTFGDAGKE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +LEG E SFF LCDGK AIPF +A+DHKR+ DGD G NTGGMGA SPA  M++E+
Sbjct: 181 VVVEAFLEGEEASFFCLCDGKIAIPFGSAQDHKRVGDGDTGVNTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I++P + GM +    F+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVIPALRGMAEMDIYFKGILFVGLMITQKGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
            DIL +  S   GNL   ++ W  E ALTVV+A  GYP     G++I  I +  +    +
Sbjct: 301 DDILPLFLSAAQGNLQKKNLQWSEETALTVVMAANGYPVSPQKGSVIRNIDKVNSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA+GKTI  +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALRNGELIANSGRVLNITAIGKTIKLAQKRAYEAVDYIDWPQGFVRRDIGWRAI 420

Query: 415 ER 416
            R
Sbjct: 421 MR 422


>gi|256060550|ref|ZP_05450718.1| phosphoribosylamine--glycine ligase [Brucella neotomae 5K33]
 gi|261324545|ref|ZP_05963742.1| phosphoribosylamine-glycine ligase [Brucella neotomae 5K33]
 gi|261300525|gb|EEY04022.1| phosphoribosylamine-glycine ligase [Brucella neotomae 5K33]
          Length = 427

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 299/427 (70%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGL+IT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLIITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|319405359|emb|CBI78976.1| Phosphoribosylamine-glycine ligase [Bartonella sp. AR 15-3]
          Length = 424

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/422 (53%), Positives = 292/422 (69%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +    + +DI +H ++I FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCAPGNPATMEFGTNINLDIDDHYSVIDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PL+ GI+DALNAA   VFGP+Q+AA+LE SK F K  C +  IPTA Y
Sbjct: 61  NAIDLVVVGPEAPLIAGITDALNAAHICVFGPNQKAAQLEGSKGFTKDLCYRNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           Q F + +KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID CF+         
Sbjct: 121 QRFDNALKAKSYIHRQGIPIVIKADGLAAGKGVVVARTMEEAFDAIDACFEGTFGDAGKK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YLEG E SFF LCDGK AIPF +A+DHKR+ DGD G NTGGMGA SPA  M++++
Sbjct: 181 VVVEAYLEGEETSFFCLCDGKVAIPFGSAQDHKRVGDGDTGVNTGGMGAYSPAPIMTEKM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +Q+I+ P + G+ +    F+G+LF GLMIT+ GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLQEIVTPALRGLAEMDISFRGILFVGLMITQTGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
            DIL +  +   GNL   ++ W  E ALTVV+A  GYP     G++I  I +  +    +
Sbjct: 301 DDILPLFLTAAQGNLKKKNLRWSEETALTVVMAANGYPFSPQKGSVIRNIDKADSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA+GKTI  +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 IFQAGTALCNGELIANSGRVLNITAIGKTIKLAQKRAYEAVDYIDWPQGFVRRDIGWRAI 420

Query: 415 ER 416
            R
Sbjct: 421 MR 422


>gi|148253229|ref|YP_001237814.1| phosphoribosylamine--glycine ligase [Bradyrhizobium sp. BTAi1]
 gi|146405402|gb|ABQ33908.1| phosphoribosylamine--glycine ligase [Bradyrhizobium sp. BTAi1]
          Length = 427

 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/418 (53%), Positives = 287/418 (68%), Gaps = 6/418 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL+ LW  PGN GIA+ A+CVA+D+ +H+ +I FCQ 
Sbjct: 1   MNILLIGSGGREHALAWKIAGSPLLTTLWCAPGNAGIAKEAECVALDVTDHAGVIAFCQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D + AAG K+FGP + AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  NKVDLVVVGPETPLAAGIVDDVEAAGIKIFGPRKLAAQLEGSKGFTKDLCAEYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ----INST 176
             F +  +A  YV+    PIVVKADGL AGKGVVVA T+ EA  A+   F+       + 
Sbjct: 121 CRFDNAPEALAYVREHGAPIVVKADGLAAGKGVVVAKTLAEAEDAVRMMFEGGFGVAGTE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG EVSFFALCDG+TAIP  +A+DHKR+ D D GPNTGGMGA SP   ++ E+
Sbjct: 181 VVIEEFLEGREVSFFALCDGQTAIPLASAQDHKRVFDHDQGPNTGGMGAYSPTPFVTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
           +  ++ +IILPTI+GM     PF+G+L+AGLM+T QGP L EYNVRFGDPECQ +M+R+ 
Sbjct: 241 HDQIMSRIILPTIDGMNARGTPFKGILYAGLMLTAQGPKLFEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SD++  + +   G L N  + W  + A+TVV+A KGYP +Y  G++I  +         +
Sbjct: 301 SDLVPAMLAACDGQLKNFDLRWFPDAAVTVVIAAKGYPGDYAKGSVIEGLDAAAKVEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           +FHAGT   +  + ANGGRVL+  A GKT+TE++  AY  V+ I W  G+ R DI  Q
Sbjct: 361 IFHAGTVAKDGAILANGGRVLNICASGKTVTEAQARAYQAVDLIQWPDGFCRRDIAWQ 418


>gi|306842318|ref|ZP_07474978.1| phosphoribosylamine--glycine ligase [Brucella sp. BO2]
 gi|306287575|gb|EFM59031.1| phosphoribosylamine--glycine ligase [Brucella sp. BO2]
          Length = 427

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 298/427 (69%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++ + V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALITAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKADR 427


>gi|148560155|ref|YP_001258436.1| phosphoribosylamine--glycine ligase [Brucella ovis ATCC 25840]
 gi|148371412|gb|ABQ61391.1| phosphoribosylamine--glycine ligase [Brucella ovis ATCC 25840]
          Length = 427

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 297/427 (69%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRTAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAG A+ +    A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGMALKDGTFVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|294851794|ref|ZP_06792467.1| phosphoribosylamine-glycine ligase [Brucella sp. NVSL 07-0026]
 gi|294820383|gb|EFG37382.1| phosphoribosylamine-glycine ligase [Brucella sp. NVSL 07-0026]
          Length = 427

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 298/427 (69%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHA TA+ +  + A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHASTALKDGAIVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|254703767|ref|ZP_05165595.1| phosphoribosylamine--glycine ligase [Brucella suis bv. 3 str. 686]
 gi|261754414|ref|ZP_05998123.1| phosphoribosylamine-glycine ligase [Brucella suis bv. 3 str. 686]
 gi|261744167|gb|EEY32093.1| phosphoribosylamine-glycine ligase [Brucella suis bv. 3 str. 686]
          Length = 427

 Score =  463 bits (1191), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 297/427 (69%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVTGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V   L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDSRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVAGGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|86748986|ref|YP_485482.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           HaA2]
 gi|86572014|gb|ABD06571.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           HaA2]
          Length = 442

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 290/427 (67%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++L+  PGN GIA+ A CVA+D+ +H+A+I FC+ 
Sbjct: 16  MNILLLGSGGREHALAWKIAASPLVTKLFCAPGNAGIAREATCVALDVTDHAAVIDFCKA 75

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I+LVVVGPE PL  GI D L  AG K FGP+Q+AA+LE SK F K  C  + IPTA Y
Sbjct: 76  NAIELVVVGPEAPLAAGIVDDLAGAGIKAFGPTQKAAQLEGSKGFTKDLCKAHDIPTAAY 135

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + FSDP  AK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D  F          
Sbjct: 136 ERFSDPADAKAYIRVQGAPIVVKADGLAAGKGVVVAMTLAEAEDAVDMMFGGALGDAGIE 195

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E+++ G E SFF LCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+  +
Sbjct: 196 VVVEDFMIGEEASFFVLCDGEHALPLATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTDAI 255

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT++ M+    PF+GVLFAGLMITE GP LIEYNVRFGDPECQ +MMR+ 
Sbjct: 256 CKQAMERIIGPTLKAMKAMGAPFKGVLFAGLMITEDGPQLIEYNVRFGDPECQVLMMRMM 315

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTTQ 354
           SDI+  L +CV G L +  + W  E ALTVV+A KGYP  Y  GT I+ +   +     Q
Sbjct: 316 SDIVPALLACVDGQLAHLTLRWFDEPALTVVMAAKGYPGGYEKGTRIAGLDRAEQIPGVQ 375

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA  KT+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 376 IFHAGTVASGDWVLANGGRVLAVTASAKTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 435

Query: 415 ERNVKYR 421
            R  + +
Sbjct: 436 ARERRKK 442


>gi|304393466|ref|ZP_07375394.1| phosphoribosylamine--glycine ligase [Ahrensia sp. R2A130]
 gi|303294473|gb|EFL88845.1| phosphoribosylamine--glycine ligase [Ahrensia sp. R2A130]
          Length = 424

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 287/422 (68%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKI  SPLL  L+  PGN G   + +   +D+ +H A++ FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIHHSPLLDRLFIAPGNGGTRPYGEHPDLDVADHGAVVEFCRA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVV+GPE PLV G++D L  AGF  FGPS  AA+LE SK F K  C +  IPTA  
Sbjct: 61  NEIGLVVIGPEAPLVAGLADDLREAGFATFGPSAAAAQLEGSKQFTKALCERKAIPTAAS 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D  KA++Y+     PIVVKADGL AGKGV VA TV+EA +A+D CF        + 
Sbjct: 121 GHFTDAAKAREYITMVGAPIVVKADGLAAGKGVTVAMTVEEAHAAVDDCFDGSFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE YLEG E S F LCDGK A+PF TA+DHKR +DGD GPNTGGMGA SPA  ++ EL
Sbjct: 181 VVIEAYLEGEEASAFFLCDGKNALPFGTAQDHKRAYDGDTGPNTGGMGAYSPAPVLTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V+Q+I+ PT++GM +   PF GVL+AGLM++  GP LIEYNVRFGDPECQ +M+RLE
Sbjct: 241 EAEVMQRIVQPTLDGMAEAGTPFSGVLYAGLMLSADGPQLIEYNVRFGDPECQVLMVRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTGTTQL 355
           SD++ +L SC +G+L      W  ++ALT+V+A KGYP  Y  GT I+ +        ++
Sbjct: 301 SDLVPLLLSCANGDLAGQSAEWSDDFALTIVMAAKGYPGAYEKGTRITALDALYDDQIEV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT   +  + A GGRVL+ T+   T TE+++LAY+ VE ++W  G+WR DIG +  E
Sbjct: 361 FHAGTEARDERIHAIGGRVLAVTSKAPTATEAQQLAYYAVEEVNWPEGFWRTDIGARAVE 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|316932706|ref|YP_004107688.1| phosphoribosylamine/glycine ligase [Rhodopseudomonas palustris
           DX-1]
 gi|315600420|gb|ADU42955.1| phosphoribosylamine/glycine ligase [Rhodopseudomonas palustris
           DX-1]
          Length = 427

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/427 (53%), Positives = 292/427 (68%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A CVA+DI +HSA+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAASPLVTKLWCAPGNAGIAREATCVALDIADHSAVIAFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  GI D L AAG K FGPS++A++LESSK F K  C  + IPTA Y
Sbjct: 61  NQVDFVVVGPEAPLAAGIVDDLAAAGIKTFGPSRKASQLESSKGFTKDLCKAHDIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + FSDP +AK Y++ +  PIVVKADGL AGKGVVVA T+ EA +AID  F          
Sbjct: 121 ERFSDPNEAKAYIRVQGAPIVVKADGLAAGKGVVVATTLAEAEAAIDMMFGGGLGDAGVE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E++L G E SFF LCDG  A+P  +A+DHKR +DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEDFLVGEEASFFVLCDGDHALPLASAQDHKRAYDGDKGPNTGGMGAYSPAPVMTDAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +Q+II PT++ M+    PF+GVLFAGLMITE GP LIEYNVRFGDPECQ +MMR+ 
Sbjct: 241 CQQTMQRIIYPTLKAMKAMGAPFKGVLFAGLMITEDGPQLIEYNVRFGDPECQVLMMRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SDI+  L +C  G L +  + W  + ALTVV+A KGYP  Y  GT I+ + +       Q
Sbjct: 301 SDIVPSLLACADGQLDHVSLRWHDDPALTVVMAAKGYPGHYEKGTRIAGLERADAIPGVQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA  KT+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTVASGDWVLANGGRVLAVTASAKTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 420

Query: 415 ERNVKYR 421
            R  + +
Sbjct: 421 ARERRRK 427


>gi|254471989|ref|ZP_05085390.1| phosphoribosylamine--glycine ligase [Pseudovibrio sp. JE062]
 gi|211959191|gb|EEA94390.1| phosphoribosylamine--glycine ligase [Pseudovibrio sp. JE062]
          Length = 426

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/422 (51%), Positives = 291/422 (68%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAW +A+SP+L+EL+  PGN GI Q A+C+A+D+ +H ++I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWSLAKSPVLNELFVAPGNAGIEQFAKCIALDLTDHRSVIEFCRL 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I+ VV+GPE PLV+G+SD+L  AG +VFGPS  AA+LE SK F K  C +  +PTA Y
Sbjct: 61  HDINFVVIGPEAPLVDGLSDSLTHAGLRVFGPSSAAAQLEGSKGFTKDMCARANVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F +   AK Y++ +  PIVVKADGL AGKGV++A    EA  A+D CF        + 
Sbjct: 121 GRFDNADAAKTYIREQGAPIVVKADGLAAGKGVIIAMNEQEALDAVDSCFDGAFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+LEG E SFF L DG  A+P  TA+DHKR  DGD GPNTGGMGA SPA  M++E+
Sbjct: 181 VVVEEFLEGEEASFFVLSDGVNALPLATAQDHKRAFDGDEGPNTGGMGAYSPAPVMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+++II PTI  M+ +  PF+GVL+AGLMIT+ GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 MDRVMKEIIHPTIADMKAQGCPFKGVLYAGLMITKDGPKLIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQ 354
           +D+L IL  C  G L      W ++ A+TVV+A+KGYP  Y   T I  + +       +
Sbjct: 301 TDLLPILLGCAEGTLDLVDAEWHSDPAVTVVMASKGYPGSYEKLTEIKGLVEAAADPDVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT + +  L +NGGRVL+ TA   T++++R  AY  +E IDW  G++R+DIG +  
Sbjct: 361 IFHAGTVVADEKLLSNGGRVLNITARAATVSQARAKAYAAIEKIDWPEGFYRKDIGWRAV 420

Query: 415 ER 416
           ER
Sbjct: 421 ER 422


>gi|256044133|ref|ZP_05447040.1| phosphoribosylamine--glycine ligase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265990544|ref|ZP_06103101.1| phosphoribosylamine-glycine ligase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263001328|gb|EEZ13903.1| phosphoribosylamine-glycine ligase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 427

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 298/427 (69%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+   GNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCALGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|254502378|ref|ZP_05114529.1| phosphoribosylamine--glycine ligase [Labrenzia alexandrii DFL-11]
 gi|222438449|gb|EEE45128.1| phosphoribosylamine--glycine ligase [Labrenzia alexandrii DFL-11]
          Length = 423

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/421 (52%), Positives = 291/421 (69%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREH+LAW +A+SP L++L++ PGN GIA HA+   +D+ +H+A+I FC++
Sbjct: 1   MKVLLIGSGGREHSLAWALAKSPKLTKLYAAPGNAGIAAHAELSDLDVSDHAAVITFCRD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I+ VVVGPE PLV G+ D L+AAG K FGPS+ AA+LE SK+F K  C +  IPTA Y
Sbjct: 61  KQIEFVVVGPEAPLVAGLVDDLDAAGIKAFGPSKAAAQLEGSKAFTKAVCDEANIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F +   A  YV+ K  PIV+KADGL AGKGVVVA T+ +A +A+  CF        S 
Sbjct: 121 GRFDNAADALNYVRTKGAPIVIKADGLAAGKGVVVAMTLADAEAAVTDCFDGTFGAAGSE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E SFF L DG  A+P  TA+DHKR +DGD GPNTGGMGA SPA  ++ +L
Sbjct: 181 VVIEEFLEGEEASFFVLSDGINALPLATAQDHKRAYDGDEGPNTGGMGAYSPAPVLTDDL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V++ I+ PTI  + K   PF+GVL+AGLMIT  GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VADVMRSIVEPTIATLSKRGTPFKGVLYAGLMITSDGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTGTTQL 355
           SD+LE++ +   G L  +H +W  + ALTVV+A KGYP  Y  GT I  +   ++   ++
Sbjct: 301 SDLLELMIASADGTLDQSHADWHDDVALTVVMAAKGYPGVYKKGTEIKGLNVISSDEAEV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT    + + ANGGRVL+ TALG ++ +++  AY  V  IDW  G+ R DIG +   
Sbjct: 361 FHAGTKSDGDKILANGGRVLNITALGTSVKDAQAAAYKAVSKIDWPEGFCRSDIGWRAVA 420

Query: 416 R 416
           R
Sbjct: 421 R 421


>gi|17987802|ref|NP_540436.1| phosphoribosylamine--glycine ligase [Brucella melitensis bv. 1 str.
           16M]
 gi|260563490|ref|ZP_05833976.1| phosphoribosylamine-glycine ligase [Brucella melitensis bv. 1 str.
           16M]
 gi|20139476|sp|Q8YFK1|PUR2_BRUME RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|17983528|gb|AAL52700.1| phosphoribosylamine-glycine ligase [Brucella melitensis bv. 1 str.
           16M]
 gi|260153506|gb|EEW88598.1| phosphoribosylamine-glycine ligase [Brucella melitensis bv. 1 str.
           16M]
          Length = 427

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/427 (52%), Positives = 298/427 (69%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+   GNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCALGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D CF+       + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  +   ++    +
Sbjct: 301 SDLLALVNAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA   T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITATAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYR 421
           ER    R
Sbjct: 421 EREKANR 427


>gi|92118639|ref|YP_578368.1| phosphoribosylamine--glycine ligase [Nitrobacter hamburgensis X14]
 gi|91801533|gb|ABE63908.1| phosphoribosylamine--glycine ligase [Nitrobacter hamburgensis X14]
          Length = 428

 Score =  458 bits (1178), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/427 (52%), Positives = 288/427 (67%), Gaps = 8/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA S LL++LW  PGN GIA+ A+CV++D+ +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIADSVLLTKLWCAPGNAGIAREAECVSLDVADHAAVIAFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L  AG K FGPS+ AA+LESSK F K+ C    IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAVAGIKAFGPSKAAAQLESSKGFTKELCRDNAIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   AK Y++ +  PIV+KADGL AGKGVVVA T+DEA +A+D  F          
Sbjct: 121 ERFNDAAAAKAYIRVQGAPIVIKADGLAAGKGVVVATTLDEALAAVDMMFDGGFGGAGAQ 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFFALCDG+ A+   TA+DHKR  DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFMRGEEASFFALCDGEDALALATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II+PT+  M+    PF+GVLFAGL+ITEQGP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CRRTMDEIIIPTLRAMRARGAPFKGVLFAGLIITEQGPKLIEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
            DI+  L +     L +  + W    ALTVV+A KGYP +Y  GT I  +         +
Sbjct: 301 GDIVPALFAVCDEQLKHFDLRWFPASALTVVMAAKGYPGDYARGTRIDGLDNAAKVEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ-- 412
           +FHAGT      + ANGGRVL+  A GKT+ E++  AY  V+ I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTKEEGGQILANGGRVLNVCASGKTVAEAQARAYEAVDRINWPDGFCRRDIGFQAV 420

Query: 413 KKERNVK 419
            +ER +K
Sbjct: 421 ARERELK 427


>gi|307941683|ref|ZP_07657038.1| phosphoribosylamine--glycine ligase [Roseibium sp. TrichSKD4]
 gi|307775291|gb|EFO34497.1| phosphoribosylamine--glycine ligase [Roseibium sp. TrichSKD4]
          Length = 422

 Score =  454 bits (1169), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 227/416 (54%), Positives = 285/416 (68%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAW ++ SPLL++L++ PGN GIA+ A+ +++D+ +H A+I FCQ 
Sbjct: 1   MNILLIGSGGREHALAWALSNSPLLTKLFAAPGNAGIAEIAELISVDVADHEAVISFCQT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PLV G+ D L AAG K FGPS+ AA+LE SKSF K  C    IPTA Y
Sbjct: 61  NAVDFVVVGPEAPLVAGLVDDLTAAGIKAFGPSKAAAQLEGSKSFTKAICDAANIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF     AK YV+    PIVVKADGL AGKGVVVA T +EA +A+D CF+       + 
Sbjct: 121 GHFKTADDAKAYVEAHGAPIVVKADGLAAGKGVVVAMTKEEALAAVDACFEGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+LEG E SFF L DG+  +P  TA+DHKR +DGD GPNTGGMGA SPA  M + +
Sbjct: 181 VVLEEFLEGEETSFFVLVDGENFLPLATAQDHKRAYDGDKGPNTGGMGAYSPAPVMDEAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            S  I +II PT++ M K   PF+GVLFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VSRTIDEIIKPTVDEMAKRGTPFKGVLFAGLMITDEGPNLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
            D+L +L +   G L      W  + A+TVV+A KGYP  Y +GT I  I +  +     
Sbjct: 301 DDLLTLLLASADGTLDKVDARWHDDVAMTVVLAAKGYPGSYENGTQIKGIEKAADGPDVA 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT  V+  L ANGGRVL+ TA G T+ E+R+ AY  VE IDW  G+ R DIG
Sbjct: 361 IFHAGTKQVDGQLLANGGRVLNVTAHGTTVQEARDKAYAAVEKIDWPEGFCRTDIG 416


>gi|87198198|ref|YP_495455.1| phosphoribosylamine--glycine ligase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87133879|gb|ABD24621.1| phosphoribosylamine--glycine ligase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 429

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 220/424 (51%), Positives = 292/424 (68%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWK+AQSPL  +L++ PGNPGIAQHA  VA+D+ +H++++ FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKLAQSPLTGKLYAAPGNPGIAQHADLVALDLTDHASVVTFCET 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVVVGPE PLV+G++D+L AAGF VFGPS+ AA+LE SK F K  C +  IPTA Y
Sbjct: 61  NRIGLVVVGPEAPLVDGLTDSLRAAGFSVFGPSRAAAQLEGSKGFTKDLCARADIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
                  +A+  +     P+V+KADGL AGKGVVVA T++EA +A+D  F        + 
Sbjct: 121 VRAKSLEEARAALAEFGAPVVIKADGLAAGKGVVVAMTMEEAEAAVDDMFDGAFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L G E SFFAL DG T +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL
Sbjct: 181 VVVEEFLTGEEASFFALTDGATIVPFASAQDHKRVGDGDTGPNTGGMGAYSPARVLTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +II PT++ M  E  P+ GVL+AGLM+TEQGP LIEYN RFGDPECQ +MMRLE
Sbjct: 241 EAQALSQIIAPTVKAMADEGMPYSGVLYAGLMLTEQGPKLIEYNARFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTGTTQ 354
           SD++E+L +C    L +     +  E A+TVV+A +GYP     G  I  IP    G  +
Sbjct: 301 SDLVELLLACADNKLSSIQPPRFSNEVAMTVVMAAQGYPGTPKKGGRIDHIPAAEAGGAK 360

Query: 355 LFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGT +  +  L+ANGGRVL+ TA G T+  +R+ AY  V+ I +  G+ R DIG ++
Sbjct: 361 VFHAGTVLSGDGVLSANGGRVLNVTAKGPTVKSARDAAYAAVDAISFPEGFCRRDIGWRE 420

Query: 414 KERN 417
            ER 
Sbjct: 421 IERE 424


>gi|114705589|ref|ZP_01438492.1| phosphoribosylamine-glycine ligase protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538435|gb|EAU41556.1| phosphoribosylamine-glycine ligase protein [Fulvimarina pelagi
           HTCC2506]
          Length = 425

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/412 (51%), Positives = 285/412 (69%), Gaps = 4/412 (0%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKH 62
           VLLIGSGGREHALAWK+ QSP L  L++ PGNPGI + A  V +DI +  A++ FC++K 
Sbjct: 5   VLLIGSGGREHALAWKLTQSPELGTLYAAPGNPGIDECASLVDLDIADQDAVVAFCKDKA 64

Query: 63  IDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQH 122
           I LVVVGPE PLV G++D L A    VFGPS  AA+LE SK F K  C+ + IPTA Y+ 
Sbjct: 65  IGLVVVGPEAPLVAGLADRLEAEAIAVFGPSASAARLEGSKGFTKDLCSLHDIPTARYKR 124

Query: 123 FSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ----INSTVI 178
           F++   A+  +++++ PIVVKADGL AGKGV +A +  EA +AID CF+     + + ++
Sbjct: 125 FNNAPDARAAIEDRAGPIVVKADGLAAGKGVTIAESRAEAVAAIDACFEGEFGGVGAELV 184

Query: 179 IEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYS 238
           IEEYLEG E S F +CDG  A+ F TA+DHKR+ DGD GPNTGGMGA SPA+GMS+    
Sbjct: 185 IEEYLEGEEASLFCICDGTRAVLFGTAQDHKRVFDGDRGPNTGGMGAYSPAIGMSEAQVD 244

Query: 239 TVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESD 298
            V+++I+ PT+ GM +   PF+GVL+AGLM+T+ GP LIEYNVRFGDPECQ +MMRL+SD
Sbjct: 245 RVMREIVEPTMRGMAEAGAPFKGVLYAGLMLTDTGPKLIEYNVRFGDPECQVLMMRLKSD 304

Query: 299 ILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHA 358
           +L +L +   G+L      W  +  +T+V+A+ GYP  Y  GT I+ +P       +FHA
Sbjct: 305 LLPVLLAAAKGDLSGVDPEWSNDRVVTIVMASNGYPGSYEKGTPIAALPLTGDDAFIFHA 364

Query: 359 GTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           GTA   + L A GGRVL+ TA G ++ E+   AY ++  ++W +G+WR DIG
Sbjct: 365 GTAREGDTLKATGGRVLNVTATGVSVYEAARKAYDVLAGVEWPNGFWRSDIG 416


>gi|209886358|ref|YP_002290215.1| phosphoribosylamine--glycine ligase [Oligotropha carboxidovorans
           OM5]
 gi|209874554|gb|ACI94350.1| phosphoribosylamine--glycine ligase [Oligotropha carboxidovorans
           OM5]
          Length = 421

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/419 (52%), Positives = 286/419 (68%), Gaps = 2/419 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA S  L++LW  PGN GIA+ A+C+A+D+ +H A+I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAASTELTKLWCAPGNAGIARDAECIALDVADHEAVIAFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L A   K FGP++ A++LESSK F K  C  + IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAAHDIKAFGPTRAASQLESSKGFTKDLCRAHNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           + F D   AK YV+ K  PIVVKADGL AGKGVVVAAT+ EA +AID  F    +  ++E
Sbjct: 121 ERFKDADSAKAYVRAKGAPIVVKADGLAAGKGVVVAATLAEAEAAIDALFASAGAEAVVE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E+L+G E SFF LCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+  + +  
Sbjct: 181 EFLQGEEASFFVLCDGEHALPLATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTDAMVART 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+  M++   P++GVLFAGLM+T QGP LIEYNVRFGDPE Q +MMRL SD++
Sbjct: 241 MDEIIRPTLRAMKERGMPYKGVLFAGLMVTPQGPKLIEYNVRFGDPETQVLMMRLMSDLV 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQLFHA 358
             L + V G L +  + W  + ALTVV+A +GYP  Y  G++IS +   +     ++FHA
Sbjct: 301 PALVAAVDGELAHFDLRWYPQPALTVVMAAQGYPGNYIKGSLISGLDDASRVEGVEIFHA 360

Query: 359 GTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           GT      + ANGGRVL+ TA GKT+ E++  AY  ++ I W  G+ R DIG Q  +R 
Sbjct: 361 GTRADGTRVLANGGRVLNVTATGKTVGEAQRRAYQAIDQIKWPEGFCRRDIGWQAIKRE 419


>gi|23015506|ref|ZP_00055280.1| COG0151: Phosphoribosylamine-glycine ligase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 429

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 283/425 (66%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WK+  SPLL+ LW  PGN GIA  A+CVAI  +    ++ F + 
Sbjct: 6   MKVLVVGSGGREHALCWKLKSSPLLTRLWCAPGNAGIADSAECVAIGAEKVDELLAFAKA 65

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G++D   AAG KVFGPS  AA+LE SK F K    K GIPTA Y
Sbjct: 66  NAVDLVVVGPEAPLVLGLADKCRAAGIKVFGPSAAAAELEGSKGFMKDVAAKAGIPTAWY 125

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F++  KAK +++ K  PIVVK DGL AGKGVVVA T++EA SA+D     R F    +
Sbjct: 126 GRFTNMEKAKDFIRQKGAPIVVKTDGLAAGKGVVVAMTLEEALSAVDMMMGERVFGDAGN 185

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+L+G E SFFALCDG TA+P   A+DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 186 ELVIEEFLDGEECSFFALCDGSTALPLVAAQDHKRVGDGDTGPNTGGMGAYSPAPVVTDA 245

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + + ++++ ILP ++ M +   P+ GVLFAG+M+T  GP L+EYNVRFGDPECQ +M RL
Sbjct: 246 IQAEIMERSILPLVKTMAEMGKPYTGVLFAGIMVTSAGPKLLEYNVRFGDPECQVLMARL 305

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGT 352
           +SD+L +L +   G L   ++ W  + AL VV+A KGYP  Y   T+I    +  Q  G 
Sbjct: 306 DSDLLPVLAAGAEGKLAGVNLQWSDDVALVVVMAAKGYPGTYEKNTVIGGLDRAAQVEGV 365

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           T L HAGTA+ +  + A GGRVL  TA G T+ E+RE AY  V+ +DW  G+ R DI  +
Sbjct: 366 TVL-HAGTALKDGQVVATGGRVLGITAKGATVAEARERAYKAVDALDWPGGFCRRDIAWR 424

Query: 413 KKERN 417
              R+
Sbjct: 425 ALARD 429


>gi|144897276|emb|CAM74140.1| Phosphoribosylglycinamide synthetase [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 427

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/425 (51%), Positives = 282/425 (66%), Gaps = 8/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHAL WK+AQSPLL++LW  PGN GI   A+CVAI  ++ + ++ F Q 
Sbjct: 1   MKVLVVGGGGREHALCWKLAQSPLLTKLWCAPGNAGIGTVAECVAIGAEDVAGLVAFAQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  G++D L+ AG KVFGPSQ AA+LE SK F K    K GIPTA Y
Sbjct: 61  NTVDLVVVGPEGPLCLGLADRLSEAGIKVFGPSQAAAELEGSKGFMKDIVWKAGIPTAWY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F+D  KAK +V+ K  PIVVK DGL AGKGVVVA T+DEA  AID     + F    +
Sbjct: 121 GRFTDIDKAKAFVREKGAPIVVKTDGLAAGKGVVVAMTLDEALGAIDDMMGTKVFGDAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEEYL+G E SFFALCDGKTA+    A+DHKR+ DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 ELVIEEYLDGEEASFFALCDGKTALGLVAAQDHKRVGDGDTGPNTGGMGAYSPAPVVTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
             + V++  ILP I  M  E  P+ GVLFAGLM T+ GP L+E+NVRFGDPECQ +M RL
Sbjct: 241 REALVMETCILPAIRTMAAEGKPYTGVLFAGLMFTKNGPRLLEFNVRFGDPECQVLMARL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           +SD+L +L +   G L    + W+ + AL VV+A  GYP  Y   T+I  + Q       
Sbjct: 301 KSDLLPVLLAAAEGRLDQVSLEWRDQCALVVVMAAAGYPGSYQKNTVIGGLDQAGAVDGV 360

Query: 354 QLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            + HAGTA  +   + A GGRVL  TA+G T+ ++RE AY  V+ +DW+ G+ R DI  +
Sbjct: 361 TVLHAGTAFNDQGQVVATGGRVLGVTAIGDTVKQARERAYKAVDALDWQQGFCRRDIAWR 420

Query: 413 KKERN 417
              R+
Sbjct: 421 ALARD 425


>gi|299134219|ref|ZP_07027412.1| phosphoribosylamine/glycine ligase [Afipia sp. 1NLS2]
 gi|298590966|gb|EFI51168.1| phosphoribosylamine/glycine ligase [Afipia sp. 1NLS2]
          Length = 421

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/418 (52%), Positives = 287/418 (68%), Gaps = 2/418 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA S  L++LW  PGN GIA+ A+C+A+D+ +H+A++ FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAASAELAKLWCAPGNAGIAREAECIALDVADHAAVVAFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGPS+ A++LESSK F K  C    IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAAAGIKAFGPSKAASQLESSKGFTKDLCKANNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           + F D   AK YV  +  PIVVKADGL AGKGVVVA T+ EA +A+D  F    +  +IE
Sbjct: 121 ERFKDAAAAKAYVHAQGAPIVVKADGLAAGKGVVVAMTLAEADAALDALFSSAGAEAVIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E++EG E SFF LCDG  A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+  + +  
Sbjct: 181 EFMEGEEASFFVLCDGDHALPLATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTDAMIART 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+  M+ +  P++GVLFAGLMIT +GP LIEYNVRFGDPE Q +MMR+ SD++
Sbjct: 241 MDEIIRPTLRAMKDKGMPYKGVLFAGLMITAEGPKLIEYNVRFGDPETQVLMMRMMSDLV 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQLFHA 358
             L + V G L +  + W  + ALTVV+A KGYP +Y  G++IS + +  +    ++FHA
Sbjct: 301 PALMAAVDGELQHFDLRWYPQSALTVVMAAKGYPGDYIKGSVISGLDEAGSLEGVEIFHA 360

Query: 359 GTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           GT      + ANGGRVL+ TA+G  + ++++ AY  V+ I W  G+ R DIG Q  +R
Sbjct: 361 GTKSDGARILANGGRVLNVTAIGDNVGQAQQRAYQAVDRIQWPEGFCRRDIGWQAIKR 418


>gi|300024097|ref|YP_003756708.1| phosphoribosylamine/glycine ligase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299525918|gb|ADJ24387.1| phosphoribosylamine/glycine ligase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 424

 Score =  446 bits (1146), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 225/423 (53%), Positives = 293/423 (69%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAW ++ SPLL +L+  PGN GIA  A+CV +D  +H+A+I FC+E
Sbjct: 1   MNLLLIGSGGREHALAWALSASPLLDKLYCAPGNAGIADVAECVRLDPADHAAVIGFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +I+LVV+GPE PLV G+ DAL  AG + FGP++ AA+LE SK F K  C +  IPTA Y
Sbjct: 61  HNIELVVIGPEAPLVAGLGDALGVAGIRYFGPTKAAAQLEGSKGFTKDLCREANIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             FSD   AK Y+  +S+PIVVKADGL AGKGV++A T +EA +AID CF        S 
Sbjct: 121 GRFSDAASAKTYLAAQSVPIVVKADGLAAGKGVIIATTREEAEAAIDACFSGAFGAAGSE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+L+G E SFFALCDG+TA+P  +A+DHKR+ +GD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVIEEFLDGEEASFFALCDGETALPLVSAQDHKRVGEGDTGPNTGGMGAYSPAPVMTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+++II+PT+E M K   PF+GVLFAGLMIT  GP LIEYNVRFGDPE Q +MMRL+
Sbjct: 241 TDRVMREIIVPTVETMAKRGTPFKGVLFAGLMITASGPKLIEYNVRFGDPETQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTTQ 354
           SD+L  L +   G L +  + W  + ALTVV+A  GYP     GT I  +   +     +
Sbjct: 301 SDLLAALLATADGVLKDFDLRWSEDAALTVVMAANGYPGTPTKGTEIKGLEAAKLIPDVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + L A+GGRVL+ T  G+T+ E+R+ AY  +  IDW  G++R DIG +  
Sbjct: 361 IFHAGTRRDGDRLLADGGRVLNVTGRGRTVAEARDAAYAAIAKIDWPGGFYRSDIGWRAL 420

Query: 415 ERN 417
           +R 
Sbjct: 421 QRR 423


>gi|298293865|ref|YP_003695804.1| phosphoribosylamine/glycine ligase [Starkeya novella DSM 506]
 gi|296930376|gb|ADH91185.1| phosphoribosylamine/glycine ligase [Starkeya novella DSM 506]
          Length = 425

 Score =  444 bits (1143), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 216/418 (51%), Positives = 283/418 (67%), Gaps = 9/418 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCV-AIDIQNHSAIIHFCQ 59
           M VLL+GSGGREHALAWK+AQSPL+   +++PGNPGIA+HA C   I + +H AI+  C 
Sbjct: 1   MNVLLLGSGGREHALAWKLAQSPLMGRFFALPGNPGIAEHATCFETIPLTDHDAIVAVCA 60

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
            + IDLVVVGPE PLV+GI+D L A GF VFGP + AA+LE SK F K+ C  + IPTA 
Sbjct: 61  AEKIDLVVVGPEAPLVDGIADRLIAEGFPVFGPRRVAAQLEGSKLFTKELCKAHDIPTAA 120

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ------I 173
           +  F+   +A+ +V+    PIV+KADGL AGKGV+VA T++EA + +D  F         
Sbjct: 121 FGRFTQAEEARAFVRKHGAPIVLKADGLMAGKGVIVAMTLEEALAGVDEVFAMSGEDGGF 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + ++IEE+L+G EVSFF L DG+T +PF +A+DHKR +DGD GPNTGGMGA SPA   S
Sbjct: 181 RTEILIEEFLDGEEVSFFCLVDGETVLPFGSAQDHKRAYDGDKGPNTGGMGAYSPAPIFS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
            E+    + +II PT   +    +P++GVLFAGLMIT QGP LIEYNVRFGDPECQ + M
Sbjct: 241 AEMERRTLHEIIRPTARALADAASPYRGVLFAGLMITAQGPKLIEYNVRFGDPECQVLTM 300

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTG 351
           RLE D+L +L++   G L +  I  K E A+TVV+A  GYP  Y  G+ I  +   +   
Sbjct: 301 RLEGDLLPLLHAVATGRLEDHDIGMKPEAAITVVMAANGYPGPYEKGSRIGGLVEAETVP 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
             ++FHAGT  V  ++ ANGGRVL+ TA+G  + E+RE AY  +  IDW  G+ R DI
Sbjct: 361 GVKVFHAGTRRVGEDIVANGGRVLAVTAIGANVAEARERAYDAIGRIDWPEGFHRTDI 418


>gi|149914436|ref|ZP_01902967.1| phosphoribosylamine--glycine ligase [Roseobacter sp. AzwK-3b]
 gi|149811955|gb|EDM71788.1| phosphoribosylamine--glycine ligase [Roseobacter sp. AzwK-3b]
          Length = 421

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/416 (50%), Positives = 279/416 (67%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREH++AW + Q+P   +L   PGN GIAQ A+C ++DI N +A+++FC E
Sbjct: 1   MNILILGGGGREHSIAWAVMQNPKCDKLIVAPGNAGIAQIAECASLDILNGAAVVNFCDE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G+SD L  AG  VFGPSQ AA+LE+SK F K  C   G PTA Y
Sbjct: 61  NTIDFVIVGPEAPLAAGVSDRLRDAGLLVFGPSQAAAQLEASKHFTKSICDAAGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ YV  +  PIVVKADGL AGKGV+VA T  +A +AID  F        + 
Sbjct: 121 GHFTDAASARAYVTAQGAPIVVKADGLAAGKGVIVAETEAQALAAIDDMFGGEFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF LCDG+ A+P  TA+DHKR+ DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEEFMTGEEASFFVLCDGENALPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLTDAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+  M +   P+QGVL+AGLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 ADLAMERIIRPTLREMARRGTPYQGVLYAGLMIQNGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           +  L+++ +   G L    +NW  ++ALTVV+A KGYP  Y  G+ I+ +   T  +   
Sbjct: 301 AQALDLMQAAAEGRLAEAQVNWATDHALTVVMAAKGYPGSYEKGSAINGLDDTTEDSFHM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA+ +  + A+GGRVL+ TA G ++ ++R+ AY MV+ IDW  G+ R DIG
Sbjct: 361 IFHAGTAMADGRIVASGGRVLNVTARGASLQQARDRAYMMVDRIDWPEGFCRRDIG 416


>gi|217979003|ref|YP_002363150.1| phosphoribosylamine/glycine ligase [Methylocella silvestris BL2]
 gi|217504379|gb|ACK51788.1| phosphoribosylamine/glycine ligase [Methylocella silvestris BL2]
          Length = 449

 Score =  443 bits (1139), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/414 (51%), Positives = 280/414 (67%), Gaps = 6/414 (1%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKH 62
           VLL+GSGGREHA+A  +++SPLL  L++ PGNPGI   A+   +DI +  AI+ FC+ K 
Sbjct: 22  VLLLGSGGREHAIALALSKSPLLGRLFAAPGNPGIGALAELAPLDIADFDAILAFCKAKG 81

Query: 63  IDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQH 122
           +DLV+VGPE PLV G+ DAL A G + FGPS  AA+LE SK+FAK+FC ++ IPTA +  
Sbjct: 82  VDLVIVGPEGPLVAGLVDALEAGGVRAFGPSAAAARLEGSKAFAKEFCARFSIPTAAFGR 141

Query: 123 FSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINSTVI 178
           F  P  AK Y + K  PIVVKADGL AGKGV+VA ++ EA +AID  F+        TV+
Sbjct: 142 FEAPAPAKAYAREKGAPIVVKADGLAAGKGVIVAMSLSEAEAAIDMMFEGAFGAAGQTVV 201

Query: 179 IEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYS 238
           IEE+L G E SFFALCDG  A+ F +A+DHKR+ +GD GPNTGGMGA SPA  M   + +
Sbjct: 202 IEEFLSGEEASFFALCDGTHAVAFGSAQDHKRVGEGDTGPNTGGMGAYSPAPIMDAAMSA 261

Query: 239 TVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESD 298
            V+ +II PT++GM +   PF+GVLFAGLMI   GP LIEYNVRFGDPE Q ++ RLE D
Sbjct: 262 RVMAEIIDPTMKGMAELGAPFRGVLFAGLMIGADGPKLIEYNVRFGDPETQVILPRLEDD 321

Query: 299 ILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQLF 356
           +L ++ +CV   L    +    + ALTVV+A KGYP+    G+ I  + +   T    + 
Sbjct: 322 LLTLIIACVEERLPQAALPLSPQSALTVVLAAKGYPDAPAKGSEIRGVDEAAATPFVTIT 381

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           HAGT IV+  L A+GGRVL+ T +G+ I E++  AY  V  IDW  G+WR DIG
Sbjct: 382 HAGTKIVDGRLVADGGRVLNVTGVGEDIREAQSRAYAAVAVIDWPGGFWRRDIG 435


>gi|118590710|ref|ZP_01548111.1| phosphoribosylamine--glycine ligase [Stappia aggregata IAM 12614]
 gi|118436686|gb|EAV43326.1| phosphoribosylamine--glycine ligase [Stappia aggregata IAM 12614]
          Length = 425

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 222/422 (52%), Positives = 286/422 (67%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++LLIGSGGREHALAW +A+SP L++L++ PGN GIA+ A+   ++  +H A+I FC++
Sbjct: 1   MKLLLIGSGGREHALAWALAKSPKLTKLYAAPGNAGIAEVAELCNLNTTDHQAVIGFCRD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV G+ D L AAG K FGPS+ AA+LE SK+F K  C +  IPTA Y
Sbjct: 61  HEIDLVVVGPEAPLVAGLVDDLEAAGIKAFGPSKAAAQLEGSKAFTKGVCDEADIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F     A  YV+ +  PIVVKADGL AGKGVVVA T+ EA  A+  CF+    +  + 
Sbjct: 121 GRFDTAEDALTYVRKQGAPIVVKADGLAAGKGVVVAMTLKEAEDAVTACFEGSFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E SFF L DG  A+P  TA+DHKR +DGD GPNTGGMGA SPA  ++  L
Sbjct: 181 VVIEEFLEGEEASFFVLSDGTNALPLATAQDHKRAYDGDEGPNTGGMGAYSPAPVLTDAL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V++ II PTI  + K   PF+GVL+AGLMI + GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 IADVMRTIIEPTIATLAKRGTPFKGVLYAGLMIGKNGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTGTTQL 355
           SD+L++L + V G L     +W+ E ALTVV+A KGYP  Y  GT I  +    T    +
Sbjct: 301 SDLLDLLLASVEGRLDQMTADWRDEAALTVVMAAKGYPGSYDKGTEIRGLDTAATDDVAV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT      + ANGGRVL+ TA+G T+ E+++ AY  + +IDW  G+ R DIG +   
Sbjct: 361 FHAGTKRNGTQILANGGRVLNVTAVGATVHEAQQRAYERIRDIDWPEGFCRSDIGWRAIA 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|242068061|ref|XP_002449307.1| hypothetical protein SORBIDRAFT_05g007470 [Sorghum bicolor]
 gi|241935150|gb|EES08295.1| hypothetical protein SORBIDRAFT_05g007470 [Sorghum bicolor]
          Length = 525

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 226/422 (53%), Positives = 286/422 (67%), Gaps = 14/422 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQ 59
           VL+IG GGREHAL + + +SP  S +   PGN GIAQ   A C+A +DI + + +I FC+
Sbjct: 91  VLVIGGGGREHALCYALNRSPSCSAVLCAPGNAGIAQSGDATCIADLDISSSADVISFCR 150

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           E+ + +VVVGPE PLV G+ + L   G   FGPS  AA LE SK F KK C KY IPTA 
Sbjct: 151 ERGVGMVVVGPEAPLVAGLVNDLVKVGIPTFGPSSEAAALEGSKDFMKKLCDKYNIPTAK 210

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           Y+ F D ++AKQYV+++  PIVVKADGL AGKGVVVA T+DEA  AID       F    
Sbjct: 211 YRTFMDAVEAKQYVKHEGAPIVVKADGLAAGKGVVVAMTLDEAFEAIDSMLVEGSFGSAG 270

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VIIEE+LEG E SFFAL DG+ A+P  +A+DHKR+ DGD+GPNTGGMGA SPA  ++ 
Sbjct: 271 SRVIIEEFLEGEEASFFALVDGENALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTD 330

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           EL   V++ II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M
Sbjct: 331 ELKRIVMESIIVPTVKGMAAEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLM 390

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQN 349
           MRLESD+ ++L S   G L N  + W  E A+ VV+A++GYP  Y  GT+I    K  Q 
Sbjct: 391 MRLESDLAQVLLSACRGGLSNVSLTWSPEMAMVVVMASQGYPGSYKKGTVIKNLDKAEQV 450

Query: 350 TGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +   ++FHAGTA+  + NL A GGRVL  TA GK I E+R  AY  V+ +DW  G++R D
Sbjct: 451 SPFVKIFHAGTALDEDGNLVAVGGRVLGVTAKGKDIEEARARAYDAVDAVDWPEGFFRRD 510

Query: 409 IG 410
           IG
Sbjct: 511 IG 512


>gi|115475147|ref|NP_001061170.1| Os08g0191200 [Oryza sativa Japonica Group]
 gi|40253644|dbj|BAD05587.1| putative glycinamide ribonucleotide synthetase [Oryza sativa
           Japonica Group]
 gi|40253815|dbj|BAD05752.1| putative glycinamide ribonucleotide synthetase [Oryza sativa
           Japonica Group]
 gi|113623139|dbj|BAF23084.1| Os08g0191200 [Oryza sativa Japonica Group]
 gi|125560417|gb|EAZ05865.1| hypothetical protein OsI_28100 [Oryza sativa Indica Group]
 gi|125602447|gb|EAZ41772.1| hypothetical protein OsJ_26312 [Oryza sativa Japonica Group]
 gi|215695422|dbj|BAG90613.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215741075|dbj|BAG97570.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 527

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 224/422 (53%), Positives = 286/422 (67%), Gaps = 14/422 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQ 59
           VL+IG GGREHAL + + +SP    +   PGN GIAQ   A C++ +D+ +  A+I FC 
Sbjct: 94  VLVIGGGGREHALCYALNRSPSCDAVLCAPGNAGIAQSGDATCISDLDVSDSDAVIAFCC 153

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           ++ + +VVVGPE PLV G+ + L  A    FGPS  AA LE SK F KK C KY IPTA 
Sbjct: 154 KRGVGMVVVGPEAPLVAGLVNDLVKAEIPAFGPSSEAAALEGSKDFMKKLCDKYNIPTAK 213

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           Y+ F+DP +AKQYV+++  PIVVKADGL AGKGVVVA T+DEA  AID       F    
Sbjct: 214 YRTFTDPAEAKQYVKDQGAPIVVKADGLAAGKGVVVAMTLDEAFEAIDSMLVQGSFGSAG 273

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VIIEEYLEG E SFFAL DG+ A+P  +A+DHKR+ DGD+GPNTGGMGA SPA  +++
Sbjct: 274 SRVIIEEYLEGEEASFFALVDGENALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTE 333

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           EL  T++  II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M
Sbjct: 334 ELKHTIMDSIIIPTVQGMAAEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLM 393

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQN 349
           MRLESD+ ++L S   G L +  + W  E A+ VV+A++GYP  Y  GT+I    K  Q 
Sbjct: 394 MRLESDLAQVLMSACRGELGDVSLTWSPEMAMVVVMASEGYPGSYKKGTVIRNLEKAEQV 453

Query: 350 TGTTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +   ++FHAGTA+  + NL A GGRVL  TA GK I E+R  AY  V+ +DW  G++R D
Sbjct: 454 SPAVKIFHAGTALDGDGNLVAVGGRVLGITAKGKDIEEARARAYDAVDVVDWPEGFFRRD 513

Query: 409 IG 410
           IG
Sbjct: 514 IG 515


>gi|296086828|emb|CBI32977.3| unnamed protein product [Vitis vinifera]
          Length = 527

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 224/428 (52%), Positives = 289/428 (67%), Gaps = 14/428 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVA-IDIQNHSAIIHFCQ 59
           VL+IGSGGREHAL + + +SP    ++  PGN GI+    A C++ +DI + SA+I FC 
Sbjct: 93  VLVIGSGGREHALCYALKRSPSCDAVFCAPGNAGISNSGDATCISDLDISDSSAVISFCH 152

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  + LVVVGPE PLV G+S+ L  AG   FGPS  AA LE SK+F K  C KYGIPTA 
Sbjct: 153 KWGVGLVVVGPEAPLVAGLSNDLVKAGIPSFGPSSEAAALEGSKNFMKNLCDKYGIPTAK 212

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           YQ F+DP  AKQY+Q +  PIV+KADGL AGKGV+VA T+DEA  A+D       F    
Sbjct: 213 YQTFTDPAAAKQYIQEQGAPIVIKADGLAAGKGVIVAMTLDEAYEAVDLMLVKGAFGSAG 272

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VI+EE+LEG E SFFAL DG+ AIP  +A+DHKR+ DGD GPNTGGMGA SPA  +++
Sbjct: 273 SQVIVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPIITE 332

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           EL S V++ II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M
Sbjct: 333 ELQSLVMKSIIIPTVKGMAAEGCRFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLM 392

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--- 349
           +RLESD+ ++L +   G L    +NW    A+ VV+A+KGYP  Y  GT+IS + +    
Sbjct: 393 IRLESDLAQVLLAACKGELSGVSLNWSPGSAMVVVMASKGYPGSYEKGTVISNLDEAELV 452

Query: 350 TGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
             + ++FHAGT +  + N  A GGRVL  TA GK + E+RE AY  VE I+W  G++R D
Sbjct: 453 APSVKVFHAGTNLDSDGNFIAVGGRVLGVTAKGKNLEEARERAYRAVEEINWPGGFYRRD 512

Query: 409 IGLQKKER 416
           IG +   R
Sbjct: 513 IGWRALPR 520


>gi|225448255|ref|XP_002269017.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 461

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 289/429 (67%), Gaps = 14/429 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQ 59
           VL+IGSGGREHAL + + +SP    ++  PGN GI+    A C++ +DI + SA+I FC 
Sbjct: 27  VLVIGSGGREHALCYALKRSPSCDAVFCAPGNAGISNSGDATCISDLDISDSSAVISFCH 86

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  + LVVVGPE PLV G+S+ L  AG   FGPS  AA LE SK+F K  C KYGIPTA 
Sbjct: 87  KWGVGLVVVGPEAPLVAGLSNDLVKAGIPSFGPSSEAAALEGSKNFMKNLCDKYGIPTAK 146

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           YQ F+DP  AKQY+Q +  PIV+KADGL AGKGV+VA T+DEA  A+D       F    
Sbjct: 147 YQTFTDPAAAKQYIQEQGAPIVIKADGLAAGKGVIVAMTLDEAYEAVDLMLVKGAFGSAG 206

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VI+EE+LEG E SFFAL DG+ AIP  +A+DHKR+ DGD GPNTGGMGA SPA  +++
Sbjct: 207 SQVIVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPIITE 266

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           EL S V++ II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M
Sbjct: 267 ELQSLVMKSIIIPTVKGMAAEGCRFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLM 326

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--- 349
           +RLESD+ ++L +   G L    +NW    A+ VV+A+KGYP  Y  GT+IS + +    
Sbjct: 327 IRLESDLAQVLLAACKGELSGVSLNWSPGSAMVVVMASKGYPGSYEKGTVISNLDEAELV 386

Query: 350 TGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
             + ++FHAGT +  + N  A GGRVL  TA GK + E+RE AY  VE I+W  G++R D
Sbjct: 387 APSVKVFHAGTNLDSDGNFIAVGGRVLGVTAKGKNLEEARERAYRAVEEINWPGGFYRRD 446

Query: 409 IGLQKKERN 417
           IG +   R 
Sbjct: 447 IGWRALPRG 455


>gi|260428436|ref|ZP_05782415.1| phosphoribosylamine--glycine ligase [Citreicella sp. SE45]
 gi|260422928|gb|EEX16179.1| phosphoribosylamine--glycine ligase [Citreicella sp. SE45]
          Length = 427

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/417 (50%), Positives = 280/417 (67%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW + Q+P   +L   PGN GIAQ A+C A+D ++  A+  F  E
Sbjct: 8   MNILILGGGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIAECAALDTEDGGAVTEFAGE 67

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PL  G++D L  AGF VFGPSQ AA+LE+SKSF K  C     PTA Y
Sbjct: 68  HAIDLVIVGPEAPLAAGVADRLREAGFLVFGPSQAAAELEASKSFTKAICDAANAPTAAY 127

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK YV+ +  PIVVKADGL AGKGV++A TVDEA +AID  F          
Sbjct: 128 GHFTDAEAAKAYVRAQGAPIVVKADGLAAGKGVIIAETVDEACAAIDDMFGGAFGGAGAE 187

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+  +P  TA+DHKR+ +GD GPNTGGMGA SPA  ++ E+
Sbjct: 188 VVIEEFMTGEEASFFVLVDGEDVLPIGTAQDHKRVGEGDTGPNTGGMGAYSPAPVLTDEI 247

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PT+  M +   P+ GVL+AGLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 248 AQKALDRIVKPTMAEMARRGTPYSGVLYAGLMIESGEPRLVEYNVRFGDPECQVLMMRLG 307

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++++C  G L +  ++W  ++A+TVV+A +GYP  Y  GT+I     +P+++   
Sbjct: 308 AQALDLIHACAEGRLADARVDWAEDHAMTVVLAAEGYPGSYRKGTVIGGLDGLPEDS-FH 366

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           Q+FHAGTA+    + A GGRVL+ATA G T+ E+ E AY +V+ +DW  G+ R DIG
Sbjct: 367 QMFHAGTALREGKVVATGGRVLNATARGATLAEAAERAYALVDAVDWPEGFCRRDIG 423


>gi|90426090|ref|YP_534460.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisB18]
 gi|90108104|gb|ABD90141.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisB18]
          Length = 427

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 223/422 (52%), Positives = 283/422 (67%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA S L++ LW  PGN GIA+ A+C A+D+ +H+A+I FCQ 
Sbjct: 1   MNILLLGSGGREHALAWKIAASHLVANLWCAPGNAGIAKIAECAALDLADHAAVIGFCQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  GI D L AAG K FGPS+ AA+LE SKSF K+ C    IPTA Y
Sbjct: 61  NGVDFVVVGPEAPLAAGIVDDLAAAGIKAFGPSKAAARLEGSKSFTKQICAAQNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF D + AK ++     PIV+KADGL AGKGVVVA T+ EA +A++  F+    Q  + 
Sbjct: 121 GHFRDILAAKAHLAAHGAPIVIKADGLAAGKGVVVAMTLAEAEAALEMMFEGGFGQAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF LCDG  A+P   A+DHKR +DGD GPNTGGMGA SPA  M + +
Sbjct: 181 VVIEEFMQGEEASFFVLCDGAHALPLAAAQDHKRAYDGDQGPNTGGMGAYSPAPVMDEAM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +II PT+  M     P++GVLFAGLMIT QGP LIEYNVRFGDPECQ +M+RL 
Sbjct: 241 IARTMDEIINPTLREMAARGTPYKGVLFAGLMITAQGPKLIEYNVRFGDPECQVLMLRLA 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SD++  L +   G L    +NW A+ ALTVV+A  GYP +Y  G++I  +         Q
Sbjct: 301 SDLVPALLASCDGGLDRIALNWSADPALTVVMAANGYPGDYAKGSVIEGLDDAAQVEGVQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT      + ANGGRVL+ TA GKT+ E++  AY  V+ I W  G+ R DIG Q  
Sbjct: 361 IFHAGTKADGEKILANGGRVLNVTASGKTVAEAQRRAYAAVDLIRWPQGFCRRDIGWQAI 420

Query: 415 ER 416
            R
Sbjct: 421 RR 422


>gi|260753164|ref|YP_003226057.1| phosphoribosylamine/glycine ligase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|59803039|sp|Q9FDL5|PUR2_ZYMMO RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|258552527|gb|ACV75473.1| phosphoribosylamine/glycine ligase [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 417

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/417 (50%), Positives = 279/417 (66%), Gaps = 6/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIG+GGREHALAWKIAQSP L   ++  GNPGIA+ A+   I + +H+A++ FCQ+
Sbjct: 1   MNVLLIGTGGREHALAWKIAQSPSLDTFYATTGNPGIAKLAKPADITVTDHAAVVRFCQD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVV+GPE PLV+G+ ++L AA   VFGP + AA+LE SK F K  C +Y IPTA Y
Sbjct: 61  NAIDLVVIGPEAPLVDGLGNSLRAASIAVFGPDKAAAQLEGSKGFTKDLCARYNIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
           Q      +AK  + N S P+V+KADGL  GKGV++A +  EA  AI       F +    
Sbjct: 121 QRCRSAEEAKAALDNFSTPVVIKADGLAGGKGVIIAESRLEAEQAIQDMTAGAFGKAGLE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++EE+++G E SFFA+ DG+T  PF TARDHKR+ DGD GPNTGGMGA SPA  ++ +L
Sbjct: 181 IVVEEFMQGEEASFFAISDGETVRPFGTARDHKRVGDGDTGPNTGGMGAYSPATRLTADL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+Q+I+ PT++ M+++  PF G+L+AGLM+T +GP LIEYN R GDPECQ +MMRLE
Sbjct: 241 EKRVMQEIVTPTVQAMKEQGMPFVGILYAGLMLTSEGPKLIEYNARLGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLH-NTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTGTTQ 354
           SDIL +L +   G L       +  +YA+TVV+A +GYP     G II+++ +       
Sbjct: 301 SDILPLLYAAATGKLQAQPEPTFSKDYAVTVVIAAQGYPASPKKGGIITRLNEAEANGAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           +F AGT + N  L ANGGRVL+ TA       +R+LAY  V  ID+  G+WR DIGL
Sbjct: 361 VFQAGTTLDNQTLKANGGRVLNVTAKAADFNAARDLAYQAVNVIDYPDGFWRGDIGL 417


>gi|126733163|ref|ZP_01748910.1| phosphoribosylamine--glycine ligase [Roseobacter sp. CCS2]
 gi|126716029|gb|EBA12893.1| phosphoribosylamine--glycine ligase [Roseobacter sp. CCS2]
          Length = 457

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 218/419 (52%), Positives = 279/419 (66%), Gaps = 8/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P    L   PGN GIA  A+C  I+I +  A+  F +E
Sbjct: 38  MNILILGSGGREHSLAWAVKQNPKCDRLIVAPGNAGIATIAECADINILDGGAVATFAEE 97

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AG  VFGPSQ AA+LE+SKSF K  C     PTA Y
Sbjct: 98  NAIDFVIVGPEAPLAAGVADRLRKAGLLVFGPSQAAAQLEASKSFTKSICDAANAPTAAY 157

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   AK Y++ +  PIVVKADGL AGKGV+VA T D A +AID  F        + 
Sbjct: 158 AHFTDADAAKSYIRAQGAPIVVKADGLAAGKGVIVAMTEDNALAAIDDMFDGSFGDAGAE 217

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDGKT +P  TA+DHKR +DGD GPNTGGMGA SPA  MS E+
Sbjct: 218 VVIEEFMEGEEASFFVLCDGKTILPVGTAQDHKRAYDGDTGPNTGGMGAYSPAPVMSDEI 277

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT++ M K   PFQGVLF GLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 278 TQKALDEIIKPTMDEMYKRGTPFQGVLFCGLMIQNGQPRLVEYNVRFGDPECQCLMMRLG 337

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI---PQNTGTT 353
             IL+++ +C    L     NW  ++ALT+V+A KGYP  Y  GT+I  +   P+++   
Sbjct: 338 GQILDLMQACAEERLDEVQANWADDHALTIVMAAKGYPGSYAKGTVIKGLENQPEDS-FH 396

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAGTA V+  +TA+GGRVL+ TA G +++E+ E AY M + IDW  G++R DIG Q
Sbjct: 397 AVFHAGTAQVDGQITASGGRVLNITARGNSLSEAHEKAYAMAQGIDWDDGFYRSDIGWQ 455


>gi|325294623|ref|YP_004281137.1| phosphoribosylamine--glycine ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065071|gb|ADY73078.1| Phosphoribosylamine--glycine ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 424

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/419 (50%), Positives = 292/419 (69%), Gaps = 8/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WK+AQSP + +++  PGNPGIAQ  +C+ I   +   + +F ++
Sbjct: 1   MKVLVVGSGGREHALVWKLAQSPKVEKVYGAPGNPGIAQVGECIDISPTDIERLANFAEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PLV GI D     G KVFGPS+ AA+LE SK+F+K+   KYG+PTA +
Sbjct: 61  EGIDLTVVGPEAPLVAGIVDEFEKRGLKVFGPSKEAARLEGSKAFSKEMMKKYGVPTADF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F DP KAK+Y++ K  PIVVKADGL AGKGVVVA +V+EA  AID     R F    +
Sbjct: 121 EVFDDPEKAKEYIRKKGAPIVVKADGLAAGKGVVVAKSVEEALEAIDKIMIERVFGDAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++E+ L G E S+  + DG+  IP  TA+DHK + D D GPNTGGMGA SPA  +S+E
Sbjct: 181 KVVVEDCLFGEEASYLVVTDGENFIPLATAQDHKAVFDEDKGPNTGGMGAYSPAPVLSKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V +K+I P ++GM++E +PF+G+L+AGLMIT  GP ++E+NVRFGDPE Q ++ RL
Sbjct: 241 MEKEVQEKVIKPILKGMKQEGHPFKGILYAGLMITSDGPKVLEFNVRFGDPEAQVILRRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTT 353
           ++D++++  S + GNL +  + W  E A+ VV+A+KGYP +Y  G  IS I   +N    
Sbjct: 301 KTDLVDVCLSVIEGNLVDG-LEWIDETAICVVLASKGYPGKYEKGKFISGIEEAENIDNV 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAGTAI +     NGGRVL+ TALGK I E+RE  Y+ VE I ++  ++R+DIGL+
Sbjct: 360 VVFHAGTAIKDGKFITNGGRVLNVTALGKDIVEARENVYNAVEKIYFEGMHYRKDIGLK 418


>gi|115487740|ref|NP_001066357.1| Os12g0197100 [Oryza sativa Japonica Group]
 gi|77553855|gb|ABA96651.1| Phosphoribosylamine-glycine ligase, chloroplast precursor,
           putative, expressed [Oryza sativa Japonica Group]
 gi|113648864|dbj|BAF29376.1| Os12g0197100 [Oryza sativa Japonica Group]
 gi|215701285|dbj|BAG92709.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 518

 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 225/434 (51%), Positives = 289/434 (66%), Gaps = 18/434 (4%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQ 59
           VL+IG GGREHAL + + +SP    ++  PGN GIAQ   A C+  +DI N  A+I FC+
Sbjct: 85  VLVIGGGGREHALCYALERSPSCDAVFCAPGNSGIAQSGDATCIPDLDISNSDAVISFCR 144

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
              + LVVVGPE PLV G+++ L  AG   FGPS  AA LE SK F KK C KY IPTA 
Sbjct: 145 NWGVGLVVVGPEAPLVAGLANELVKAGIPTFGPSSEAAALEGSKDFMKKLCDKYHIPTAK 204

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           YQ F+DP  AK+YV+ +  PIVVKADGL AGKGVVVA T+++A  AID       F    
Sbjct: 205 YQSFTDPSDAKKYVEEQGAPIVVKADGLAAGKGVVVAMTLEKAFEAIDSMLVEGSFGSAG 264

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VI+EEYLEG EVSFFAL DG+TA+P  +A+DHKR+ DGD+GPNTGGMGA SPA  +++
Sbjct: 265 SRVIVEEYLEGEEVSFFALVDGETALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTE 324

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           +L   V++ II+PT++GM  E   F GVL+AG+MI ++   P LIEYNVRFGDPECQ +M
Sbjct: 325 KLKCKVMESIIVPTVKGMATEGCKFVGVLYAGIMIEKKSGLPKLIEYNVRFGDPECQVLM 384

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP---QN 349
           MRL+SD+ ++L +   G L +  + W  E A  VV+A++GYP  Y  GT+I  I    Q 
Sbjct: 385 MRLQSDLAQVLLAACRGELGSVSLTWSPELATVVVMASEGYPGVYKKGTVIKNIDEAEQV 444

Query: 350 TGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +   ++FHAGTA+  + N  A GGRVL  TA GK I E+R  AY  ++ +DW  G++R D
Sbjct: 445 SPAVKIFHAGTALDRDGNFVAAGGRVLGVTAKGKDIEEARAKAYDALDVVDWPEGFFRHD 504

Query: 409 IGLQKKERNVKYRN 422
           IG     R  KYR 
Sbjct: 505 IGW----RAQKYRR 514


>gi|125536060|gb|EAY82548.1| hypothetical protein OsI_37769 [Oryza sativa Indica Group]
          Length = 557

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 225/434 (51%), Positives = 289/434 (66%), Gaps = 18/434 (4%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQ 59
           VL+IG GGREHAL + + +SP    ++  PGN GIAQ   A C+  +DI N  A+I FC+
Sbjct: 124 VLVIGGGGREHALCYALERSPSCDAVFCAPGNSGIAQSGDATCIPDLDISNSDAVISFCR 183

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
              + LVVVGPE PLV G+++ L  AG   FGPS  AA LE SK F KK C KY IPTA 
Sbjct: 184 NWGVGLVVVGPEAPLVAGLANELVKAGIPTFGPSSEAAALEGSKDFMKKLCDKYHIPTAK 243

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           YQ F+DP  AK+YV+ +  PIVVKADGL AGKGVVVA T+++A  AID       F    
Sbjct: 244 YQSFTDPSDAKKYVEEQGAPIVVKADGLAAGKGVVVAMTLEKAFEAIDSMLVEGSFGSAG 303

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VI+EEYLEG EVSFFAL DG+TA+P  +A+DHKR+ DGD+GPNTGGMGA SPA  +++
Sbjct: 304 SRVIVEEYLEGEEVSFFALVDGETALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTE 363

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           +L   V++ II+PT++GM  E   F GVL+AG+MI ++   P LIEYNVRFGDPECQ +M
Sbjct: 364 KLKCKVMESIIVPTVKGMATEGCKFVGVLYAGIMIEKKSGLPKLIEYNVRFGDPECQVLM 423

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP---QN 349
           MRL+SD+ ++L +   G L +  + W  E A  VV+A++GYP  Y  GT+I  I    Q 
Sbjct: 424 MRLQSDLAQVLLAACRGELGSVSLTWSPELATVVVMASEGYPGVYKKGTVIKNIDEAEQV 483

Query: 350 TGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +   ++FHAGTA+  + N  A GGRVL  TA GK I E+R  AY  ++ +DW  G++R D
Sbjct: 484 SPAVKIFHAGTALDRDGNFVAAGGRVLGVTAKGKDIEEARAKAYDALDVVDWPEGFFRHD 543

Query: 409 IGLQKKERNVKYRN 422
           IG     R  KYR 
Sbjct: 544 IGW----RAQKYRR 553


>gi|319789917|ref|YP_004151550.1| phosphoribosylamine/glycine ligase [Thermovibrio ammonificans HB-1]
 gi|317114419|gb|ADU96909.1| phosphoribosylamine/glycine ligase [Thermovibrio ammonificans HB-1]
          Length = 426

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 210/423 (49%), Positives = 289/423 (68%), Gaps = 8/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHALAWK+AQSP + +++  PGNPGIA+  +CV I   +  A+  F Q 
Sbjct: 1   MKVLVVGGGGREHALAWKLAQSPEVEKVYGAPGNPGIAKVGECVPISPTDVKALAEFAQR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I+L VVGPE PLV GI+D     G KVFGPS+ AA+LE SK FAK+   + G+PTA +
Sbjct: 61  EGIELTVVGPEAPLVAGITDEFQKKGLKVFGPSKEAARLEGSKVFAKEIMRELGVPTAPF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQINS 175
             F DP KAK++++ K  PIVVKADGL AGKGVVVA TV+EA  A++R      F +  +
Sbjct: 121 WVFEDPNKAKEFIKEKGAPIVVKADGLAAGKGVVVAQTVEEALEAVERIMVQKVFGEAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE L+G EVS+  + DG+  IP   A+DHK + DGD GPNTGGMGA SPA  MS+E
Sbjct: 181 RIVVEECLKGEEVSYLVVTDGERYIPLEPAQDHKAVFDGDRGPNTGGMGAYSPAPVMSKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V +++I P ++GM++   PF+GVL+AGLMITE GP ++E+NVRFGDPE Q +M RL
Sbjct: 241 LEAEVQKRVIEPILKGMRERGTPFRGVLYAGLMITESGPQVLEFNVRFGDPEAQTLMRRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTT 353
           ESD+ ++  S   G L    + W  E ++ VV+A+KGYP +Y  G +I+ +   +   + 
Sbjct: 301 ESDLAQVCLSAAEGRLVE-ELRWSPETSICVVLASKGYPGKYEKGKVITGVEEAEKEPSV 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT + N  L  NGGRVL+ TALGK I E+RE  Y  +E I ++  ++R DIGL+ 
Sbjct: 360 VVFHAGTKLENGKLVTNGGRVLNVTALGKDIVEARERVYRAIEKIHFEGMHYRRDIGLKA 419

Query: 414 KER 416
            +R
Sbjct: 420 VKR 422


>gi|293334485|ref|NP_001169545.1| hypothetical protein LOC100383422 [Zea mays]
 gi|224030027|gb|ACN34089.1| unknown [Zea mays]
          Length = 522

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 221/422 (52%), Positives = 283/422 (67%), Gaps = 14/422 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQ 59
           VL+IG GGREHAL + +  SP  + +   PGN GIAQ   A C+  +DI +   +I FC+
Sbjct: 89  VLVIGGGGREHALCYALNHSPSCAAVLCAPGNAGIAQSRDATCIPDLDISSSDDVISFCR 148

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           ++ + +VVVGPE PLV G+++ L   G   FGPS  AA LE SK F KK C KY IPTA 
Sbjct: 149 KRGVGMVVVGPEAPLVAGLANDLVKVGIPTFGPSSEAAALEGSKDFMKKLCDKYNIPTAK 208

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           Y  F+D ++AK+YV+N+  PIVVKADGL AGKGVVVA T+DEA  AID       F    
Sbjct: 209 YHTFTDAVEAKKYVKNEGAPIVVKADGLAAGKGVVVAMTLDEALEAIDSMLVEGSFGSAG 268

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VIIEE+LEG E SFFAL DG+ A+P  +A+DHKR+ DGD+GPNTGGMGA SPA  ++ 
Sbjct: 269 SRVIIEEFLEGEEASFFALVDGENALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTD 328

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           EL   V++ II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M
Sbjct: 329 ELKRIVMESIIIPTVKGMAAEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLM 388

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--- 349
           MRLESD+ ++L S   G L N  + W  E A+ VV+A++GYP  Y  GT+I  + +    
Sbjct: 389 MRLESDLAQVLLSACKGELSNVSLTWSPEMAMVVVMASQGYPGSYKKGTVIKNVDKAERV 448

Query: 350 TGTTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +   ++FHAGTA+  + NL A GGRVL  TA GK I E+R  AY  V+ I+W  G+ R D
Sbjct: 449 SPAVKIFHAGTAVDGDGNLVAVGGRVLGFTAKGKDIEEARARAYGAVDAIEWVEGFCRRD 508

Query: 409 IG 410
           IG
Sbjct: 509 IG 510


>gi|84515407|ref|ZP_01002769.1| phosphoribosylamine--glycine ligase [Loktanella vestfoldensis
           SKA53]
 gi|84510690|gb|EAQ07145.1| phosphoribosylamine--glycine ligase [Loktanella vestfoldensis
           SKA53]
          Length = 420

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/416 (49%), Positives = 270/416 (64%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW I Q+P    L   PGN GIAQ A C  ++I +  A+ +F +E
Sbjct: 1   MNILILGSGGREHSLAWAIKQNPKCDRLIVAPGNAGIAQIADCADLNILDGDAVANFVEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L   G  VFGPSQ AA+LE+SKSF K  C   G PTA Y
Sbjct: 61  NTIDFVIIGPEGPLAAGVADRLRRTGTLVFGPSQAAAQLEASKSFTKAICDAAGAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++   A+ YVQ +  PIV+KADGL AGKGV VA TVDEA  A+D  F        + 
Sbjct: 121 ARFTEAAPARAYVQAQGAPIVIKADGLAAGKGVTVAMTVDEALDALDHMFDGSFGPAGTA 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG T +P  TA+DHKR  DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVIEEFMEGEEASFFVLCDGTTILPVGTAQDHKRAFDGDQGPNTGGMGAYSPAPVMTDEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT++ M +   PFQGVLF GLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 TQKALREIIQPTMDEMARRGTPFQGVLFCGLMIENGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
             +L++L +C    LH   +NW  ++ALT+V+A  GYP +Y  G++I  +      +   
Sbjct: 301 GQVLDLLQACAEQRLHEISVNWADDHALTIVMAANGYPGDYAKGSVIGGLDSQPADSFHM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT        A+GGRVL+ TA G ++ E+ E AY M + +DW  G++R DIG
Sbjct: 361 VFHAGTKRFEGQYQAHGGRVLNITARGASLAEAHEQAYAMAQGVDWPGGFYRSDIG 416


>gi|192973055|gb|ACF06954.1| phosphoribosylamine--glycine ligase [uncultured Roseobacter sp.]
          Length = 420

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/417 (49%), Positives = 276/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW +AQ+P    L   PGN GIA+ A CV ++I + +A++ F + 
Sbjct: 1   MNILILGSGGREHSLAWAVAQNPKCDHLMVAPGNAGIAKIADCVDLNILDGAAVLAFVRS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID V++GPE PL  G++D L AA    FGPSQ AA+LE+SK F K  C   G PTA Y
Sbjct: 61  QAIDFVIIGPEAPLAAGVADVLRAADVLCFGPSQAAAQLEASKFFTKSICDAAGAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A  YV+    PIVVKADGL AGKGV+VA +  EA  A+D  F        + 
Sbjct: 121 GHFTDQPSAADYVRKMGAPIVVKADGLAAGKGVIVAMSEQEALEALDDMFSGEFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S+F LCDG+  +   TA+DHKR+ +GD GPNTGGMGA SPA  ++ E+
Sbjct: 181 VVIEEFMEGEEASYFILCDGRDVLAIGTAQDHKRVGEGDTGPNTGGMGAYSPAPVLTDEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+  M +   P+QGVL+AGLMI      L+EYN RFGDPECQ +MMRL 
Sbjct: 241 AEQAMREIIKPTMAEMARRGTPYQGVLYAGLMIKNGKARLVEYNARFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI---PQNTGTT 353
           +  L++L +C    L    +NW A++ALTVV+A KGYP  Y  GT+IS +   P ++  T
Sbjct: 301 AQALDLLLACAEERLSEVQVNWAADHALTVVMAAKGYPGAYKKGTVISGVNALPDSSSAT 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             FHAGTA +  NLTA GGRVL+ TA   +++E+R +AY MV+ IDW  G+ R DIG
Sbjct: 361 -CFHAGTAQIGANLTAQGGRVLNVTARAASLSEARTMAYDMVDQIDWPEGFCRRDIG 416


>gi|163797949|ref|ZP_02191891.1| phosphoribosylamine--glycine ligase [alpha proteobacterium BAL199]
 gi|159176743|gb|EDP61314.1| phosphoribosylamine--glycine ligase [alpha proteobacterium BAL199]
          Length = 424

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/424 (50%), Positives = 273/424 (64%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL++GSGGREHAL W I+ SPL+  L+  PGN GIA+ A CV I + +   ++ F Q 
Sbjct: 1   MRVLVVGSGGREHALCWAISASPLVDALYCAPGNAGIAREATCVPIPVDDLDGLVAFAQS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID VVVGPE PLV G+ D L  AG K FGP+  AA LE SK+F K FC ++ IPTA Y
Sbjct: 61  ERIDFVVVGPEGPLVAGLVDRLTDAGIKAFGPTAAAAALEGSKAFTKDFCARHNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
             F+D   AK Y++ +  PIVVKADGL AGKGVVVA T+D+A +A+     D+ F +  +
Sbjct: 121 GRFTDADAAKTYIRQQGAPIVVKADGLAAGKGVVVAETLDDALAAVDAMMADKAFGEAGT 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE++ G E SFFAL DG++ +P   A+DHKR+ DGD GPNTGGMGA SPA  +   
Sbjct: 181 EIVVEEFMTGEEASFFALADGESVLPLAGAQDHKRVGDGDTGPNTGGMGAYSPAPVVDHA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   ++ +II PT+ GM+ E   F+GVLFAGLMI   GP LIEYN RFGDPECQA+MMRL
Sbjct: 241 MAKRIMAEIIEPTVAGMKSEGRTFKGVLFAGLMIGPDGPRLIEYNARFGDPECQALMMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGT-IISKIPQNTGTTQ 354
           +SD+L  L +   G L +  + W    AL VV+A  GYP +Y  GT I       T  T 
Sbjct: 301 KSDLLPALIAVSDGQLAHVDLRWDDRAALCVVMAANGYPGDYRKGTEIFGADAAETDGTV 360

Query: 355 LFHAGTA-IVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGT    +  L A GGRVL  TALG    E+   AY  V+ IDW  G+ R DIG + 
Sbjct: 361 VFHAGTTRDPDGRLRAIGGRVLGVTALGADAAEAGRRAYAAVDRIDWPSGFCRRDIGWRA 420

Query: 414 KERN 417
             R+
Sbjct: 421 VARD 424


>gi|224129712|ref|XP_002328784.1| predicted protein [Populus trichocarpa]
 gi|222839082|gb|EEE77433.1| predicted protein [Populus trichocarpa]
          Length = 528

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/424 (50%), Positives = 286/424 (67%), Gaps = 14/424 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHF 57
           + VL+IG GGREHAL + + +SP    ++  PGN GI+   +A C+  +DI + SA+I F
Sbjct: 92  LVVLVIGGGGREHALCYALQRSPSCDAVFCAPGNAGISNSGNATCIPELDISDSSAVISF 151

Query: 58  CQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT 117
           C++  + LVVVGPE PLV+G+++ L  AG   FGPS  AA LE SK+F K  C KY IPT
Sbjct: 152 CRKWGVGLVVVGPEAPLVSGLANDLVKAGIPTFGPSAEAAALEGSKNFMKNLCDKYKIPT 211

Query: 118 ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQ 172
           A YQ F+DP  AKQY++++  PIV+KADGL AGKGV+VA T++EA  A+D       F  
Sbjct: 212 AKYQTFTDPSSAKQYIEDQGAPIVIKADGLAAGKGVIVAMTLEEAYEAVDSMLVKSVFGS 271

Query: 173 INSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM 232
               V++EE+LEG E SFFAL DG+ AIP  +A+DHKR+ DGD GPNTGGMGA SPA  +
Sbjct: 272 AGCCVVVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPVL 331

Query: 233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQA 290
           ++EL S V+Q II PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ 
Sbjct: 332 TKELQSVVMQTIIHPTVKGMAAEGCKFVGVLYAGLMIEKKTGLPKLIEYNVRFGDPECQV 391

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           +M+RLESD+ ++L +   G L    + W    A+ VV+A+KGYP  Y  GT+I  + +  
Sbjct: 392 LMVRLESDLAQVLLAASRGELSGVSLKWSPGSAMVVVMASKGYPGSYEKGTVIQNLEEAE 451

Query: 351 G---TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
               T ++FHAGTA+  + N  A GGRVL  TA G+ + E+R+ AY  VE I+W  G++R
Sbjct: 452 NVAPTVKIFHAGTALNSDGNFIATGGRVLGVTATGRDLEEARDRAYQAVEEINWPGGFYR 511

Query: 407 EDIG 410
            DIG
Sbjct: 512 RDIG 515


>gi|85375370|ref|YP_459432.1| phosphoribosylamine--glycine ligase [Erythrobacter litoralis
           HTCC2594]
 gi|84788453|gb|ABC64635.1| phosphoribosylamine-glycine ligase [Erythrobacter litoralis
           HTCC2594]
          Length = 426

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/425 (49%), Positives = 283/425 (66%), Gaps = 6/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWK+AQSP  ++L++ PGNPGIA+ A+CV +D+ +H A+  FC  
Sbjct: 1   MNILLIGSGGREHALAWKLAQSPSCTKLYAAPGNPGIAEDAECVTLDVADHGAVAEFCTN 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I LVVVGPE PLV+G+ D+L AAG  VFGP+ + A+LE SK F K  C + GIPTA Y
Sbjct: 61  KDIALVVVGPEAPLVDGLGDSLRAAGIAVFGPNAKPAQLEGSKGFTKDLCERAGIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
              +   +A Q ++    P V+KADGL AGKGVV+A T ++A +A+       F +  + 
Sbjct: 121 VRTTSLDEATQALERFEAPHVLKADGLAAGKGVVIAETREDAQAALADMFGGQFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFFAL DG   +P  TA+DHKRI DGD+GPNTGGMGA SPA  ++ +L
Sbjct: 181 VVIEEFMAGEEASFFALTDGTAIVPIGTAQDHKRIGDGDVGPNTGGMGAYSPAPILTDDL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V+ +II PT+  +++E  P+ GVL+AGLM+TE GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 QARVMAEIIEPTVTTLREEGMPYSGVLYAGLMLTETGPKLIEYNARFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGNLHN-THINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
            D+ E++ +C  G L   +      E ALTVV+A KGYP     G  I          ++
Sbjct: 301 EDLAELMLACAEGRLGEFSDAKMAPETALTVVMAAKGYPGTPEKGGSIDLGQAQANGAKV 360

Query: 356 FHAGTA-IVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           FHAGT    N  L ANGGRVL+ TA G  ++E++  AY  V+ ID+  G+ R DIG ++ 
Sbjct: 361 FHAGTKRDANGTLVANGGRVLNVTATGPNVSEAQRAAYQAVDAIDFPTGFCRRDIGWREI 420

Query: 415 ERNVK 419
           +R  K
Sbjct: 421 KRERK 425


>gi|302831065|ref|XP_002947098.1| hypothetical protein VOLCADRAFT_79479 [Volvox carteri f.
           nagariensis]
 gi|300267505|gb|EFJ51688.1| hypothetical protein VOLCADRAFT_79479 [Volvox carteri f.
           nagariensis]
          Length = 472

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 213/432 (49%), Positives = 285/432 (65%), Gaps = 18/432 (4%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFCQE 60
           VL+IGSGGREH+LAWK++QSP+ + L+  PGNPG         V ID+ NH  ++ FC+E
Sbjct: 33  VLVIGSGGREHSLAWKLSQSPICNHLFCAPGNPGTETEPNVTNVGIDVANHQKVVQFCRE 92

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + + LVVVGPE+PLV G++D + AAG   +GPS RAA+LE SK+F K  C KY IPTA Y
Sbjct: 93  RDVRLVVVGPEVPLVAGLADDMQAAGIPTWGPSARAAQLEGSKAFMKDICRKYDIPTAAY 152

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F+DP +AK ++++   PIVVKA GL AGKGVVVA TV+EA  A+D     + F     
Sbjct: 153 EKFTDPARAKSFIKHLGAPIVVKASGLAAGKGVVVARTVEEAYQAVDDMLVHKVFGGAGD 212

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+L+G EVSFFAL DG+ AIP  +A+DHK + DGD GPNTGGMGA SPA  M++ 
Sbjct: 213 ELVIEEFLDGEEVSFFALVDGEAAIPLVSAQDHKAVGDGDTGPNTGGMGAYSPAPVMNEA 272

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG---PYLIEYNVRFGDPECQAMM 292
           ++  V+ +II  T  GM  E  PF+G LFAGLMI +       L+E+NVRFGDPECQ +M
Sbjct: 273 IFKQVMDEIIYRTARGMAAEGAPFRGTLFAGLMIKDGKVGCAKLLEHNVRFGDPECQGLM 332

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-- 350
            R +SD+ E L     G L + ++ WK E ALTVV+A  GYP ++  G++I  + + T  
Sbjct: 333 ARCDSDLTEALLRATQGKLDDVNLMWKPEAALTVVMAANGYPGKHLKGSVIRGLDRVTTA 392

Query: 351 -----GTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGY 404
                   Q+FHAGTA      + +NGGRVL+ TALGK + E++  AY  V+ I+W   Y
Sbjct: 393 KVAPAAAVQVFHAGTARNTAGEVVSNGGRVLNVTALGKDVAEAQARAYEAVKQIEWADAY 452

Query: 405 WREDIGLQKKER 416
           +R DIG +   R
Sbjct: 453 YRSDIGWRAVAR 464


>gi|110679216|ref|YP_682223.1| phosphoribosylamine--glycine ligase [Roseobacter denitrificans OCh
           114]
 gi|109455332|gb|ABG31537.1| phosphoribosylamine--glycine ligase [Roseobacter denitrificans OCh
           114]
          Length = 421

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 207/416 (49%), Positives = 276/416 (66%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P    L   PGN GIA  A+C +++I++  A+  F   
Sbjct: 1   MNILILGSGGREHALAWAVKQNPKCDRLIMAPGNAGIAGIAECASLNIEDGGAVAGFADA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PL  G++D L  AG  VFGP   AAKLE+SK+F K  C   G PTA Y
Sbjct: 61  NAIDLVIVGPEAPLAAGVADRLRDAGISVFGPGLEAAKLEASKAFTKTICDAAGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
            HF+D   A+ YV+ +  PIV+KADGL AGKGV++A TVDEA +A+D      F    + 
Sbjct: 121 AHFTDRAAARAYVKAQGAPIVIKADGLAAGKGVIIAQTVDEALNALDDMFGGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG+T +P  TA+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVIEEFMEGEEASFFVLCDGETVLPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PT+  M +   P+QGVLF GLMI +  P L+EYNVRFGDPECQA+MMRL 
Sbjct: 241 TQAALDQIVQPTMAEMTRRGTPYQGVLFVGLMIKDGAPRLVEYNVRFGDPECQALMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           + +L+++ +   G L    +NW  ++ALTVV+A +GYP  Y  G++I  +   +      
Sbjct: 301 AQVLDLIQATAEGRLGEVQVNWADDHALTVVLAARGYPGSYEKGSVIGGLEGFKEDSKQM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA  +    A+GGRVL  TA   +++E+RE AY MV+ IDW  G+ R DIG
Sbjct: 361 IFHAGTARRDGRYIASGGRVLGVTARAASLSEARERAYAMVDQIDWPDGFCRRDIG 416


>gi|307296249|ref|ZP_07576076.1| phosphoribosylamine/glycine ligase [Sphingobium chlorophenolicum
           L-1]
 gi|306878051|gb|EFN09274.1| phosphoribosylamine/glycine ligase [Sphingobium chlorophenolicum
           L-1]
          Length = 427

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/427 (48%), Positives = 280/427 (65%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+G GGREHALAWK+AQSP LS L++ PGNPGIAQHA  V +D  +H A++ FC  
Sbjct: 1   MNILLLGGGGREHALAWKLAQSPALSTLYAAPGNPGIAQHATLVDLDATDHRAVVDFCLR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVV+GPE PLV+G++D L   G+ VFGP ++AA+LE SK F K  C + GIPTA Y
Sbjct: 61  HSIGLVVIGPEAPLVDGLADNLRVKGYPVFGPGKKAAQLEGSKGFTKDLCKRAGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           +  +    A   + + ++P+V+KADGL AGKGV++A T ++A  AI+  F        + 
Sbjct: 121 ERVTSKDGAIAALDDFALPVVIKADGLAAGKGVIIAETREQAVEAIEDMFSGAFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EEY+ G E SFFAL DG   +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL
Sbjct: 181 VVLEEYMTGEEASFFALTDGSAILPFGSAQDHKRVGDGDTGPNTGGMGAYSPARVLTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + VI+KI+ PT++ +  E  P+ GVL+AGLM+T +GP LIEYN RFGDPECQ +MMR +
Sbjct: 241 EAEVIEKIVRPTVDTLAAEGTPYSGVLYAGLMLTAEGPKLIEYNARFGDPECQVLMMRFD 300

Query: 297 SDILEILNSCVHGNL-HNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI-PQNTGTTQ 354
            D++ +L +   G L     +      ALT+V+A  GYP     G  IS I     G  +
Sbjct: 301 GDLVALLLAVAEGRLAEQGPVQLADRTALTIVMAANGYPGTPEKGGAISGIDAAEAGGAR 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  +  + ANGGRVL+ TA G+T+  ++E AY  V+ I +  G+ R DIG ++ 
Sbjct: 361 VFHAGTADKDGAIVANGGRVLNVTATGETVKAAQEAAYRAVDAIGFPTGFCRRDIGWREV 420

Query: 415 ERNVKYR 421
            R    R
Sbjct: 421 AREEAAR 427


>gi|163733310|ref|ZP_02140753.1| phosphoribosylamine--glycine ligase [Roseobacter litoralis Och 149]
 gi|161393098|gb|EDQ17424.1| phosphoribosylamine--glycine ligase [Roseobacter litoralis Och 149]
          Length = 421

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/416 (49%), Positives = 273/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P    L   PGN GIA  A+C +++I++  A+  F  E
Sbjct: 1   MNILILGSGGREHALAWAVKQNPKCDRLIVAPGNAGIAGIAECASLEIEDGGAVARFSDE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PL  G++D L  AG  VFGP   AAKLE+SK+F K  C   G PTA Y
Sbjct: 61  NAIDLVIVGPEAPLAAGVADRLRDAGISVFGPGLDAAKLEASKAFTKAICDAAGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
            HF+D   A+ YV+ +  PIV+KADGL AGKGV++A TVDEA  A+D      F    + 
Sbjct: 121 AHFTDRAAARAYVEAQGAPIVIKADGLAAGKGVIIAQTVDEALDALDDMFGGSFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG+T +P  TA+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVIEEFMEGEEASFFMLCDGETVLPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++I+ PT+  M +   P+QGVLF GLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 TQAALEQIVQPTMTEMMRRGTPYQGVLFVGLMIQNGAPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           +  L+++ +   G L    +NW  ++ALTVV+A +GYP  Y  G++I  +   +      
Sbjct: 301 AQALDLIQAAAEGRLDEVQVNWADDHALTVVLAARGYPGSYEKGSVIGGLDGFKEDSKHM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT   +   TA+GGRVL  TA   ++ E+RE AY MV+ IDW  G+ R DIG
Sbjct: 361 VFHAGTTRKDGQYTASGGRVLGVTARASSLAEAREQAYGMVDQIDWPEGFCRRDIG 416


>gi|226530106|ref|NP_001147908.1| phosphoribosylamine--glycine ligase [Zea mays]
 gi|195614514|gb|ACG29087.1| phosphoribosylamine--glycine ligase [Zea mays]
          Length = 520

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/426 (52%), Positives = 286/426 (67%), Gaps = 14/426 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSA-IIHF 57
           + VL+IG GGREHAL + + +SP  + +   PGN GIAQ   A C++    + S  +I F
Sbjct: 86  ITVLVIGGGGREHALCYALNRSPSCAAVLCAPGNAGIAQSGDATCISDLDISSSDDVISF 145

Query: 58  CQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT 117
           C+++ + +VVVGPE PLV G+ + L   G   FGPS  AA LE SK F KK C KY IPT
Sbjct: 146 CRKREVGMVVVGPEAPLVAGLVNDLVKVGIPTFGPSSEAAALEGSKDFMKKLCDKYNIPT 205

Query: 118 ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQ 172
           A Y+ F+D ++AK+YV+N+  PIVVKADGL AGKGVVVA T+DEA  AID       F  
Sbjct: 206 AKYRTFTDAVEAKKYVKNEGAPIVVKADGLAAGKGVVVAMTLDEAFEAIDSMLVEGSFGS 265

Query: 173 INSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM 232
             S VIIEE+LEG E SFFAL DG  A+P  +A+DHKR+ DGD+GPNTGGMGA SPA  +
Sbjct: 266 AGSLVIIEEFLEGEEASFFALVDGTNALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIV 325

Query: 233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQA 290
           + EL  TV++ II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ 
Sbjct: 326 TDELKRTVMESIIIPTVKGMSTEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQV 385

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIP 347
           +MMRLESD+ ++L S   G L N  + W  E A+ VV+A++GYP  Y  GT+I    K  
Sbjct: 386 LMMRLESDLAQVLLSACQGKLGNVSLTWSPEMAMVVVMASQGYPGPYKKGTVIKNVDKAE 445

Query: 348 QNTGTTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
           Q +   ++FHAGTA+  + NL A GGRVL  TA GK I E+R  AY  V+ ++W  G++R
Sbjct: 446 QVSPAVKIFHAGTALDGDGNLVAVGGRVLGVTAKGKDIEEARARAYGAVDAVEWPEGFFR 505

Query: 407 EDIGLQ 412
            DIG +
Sbjct: 506 HDIGWR 511


>gi|219885115|gb|ACL52932.1| unknown [Zea mays]
 gi|219885235|gb|ACL52992.1| unknown [Zea mays]
          Length = 520

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 222/426 (52%), Positives = 286/426 (67%), Gaps = 14/426 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSA-IIHF 57
           + VL+IG GGREHAL + + +SP  + +   PGN GIAQ   A C++    + S  +I F
Sbjct: 86  ITVLVIGGGGREHALCYALNRSPSCAAVLCAPGNAGIAQSGDATCISDLDISSSDDVISF 145

Query: 58  CQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT 117
           C+++ + +VVVGPE PLV G+ + L   G   FGPS  AA LE SK F KK C KY IPT
Sbjct: 146 CRKREVGMVVVGPEAPLVAGLVNDLVKVGIPTFGPSSEAAALEGSKDFMKKLCDKYNIPT 205

Query: 118 ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQ 172
           A Y+ F+D ++AK+YV+N+  PIVVKADGL AGKGVVVA T+DEA  AID       F  
Sbjct: 206 AKYRTFTDAVEAKKYVKNEGAPIVVKADGLAAGKGVVVAMTLDEAFEAIDSMLVEGSFGS 265

Query: 173 INSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM 232
             S VIIEE+LEG E SFFAL DG  A+P  +A+DHKR+ DGD+GPNTGGMGA SPA  +
Sbjct: 266 AGSLVIIEEFLEGEEASFFALVDGTNALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIV 325

Query: 233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQA 290
           + EL  TV++ II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ 
Sbjct: 326 TDELKRTVMESIIIPTVKGMSTEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQV 385

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIP 347
           +MMRLESD+ ++L S   G L N  + W  E A+ VV+A++GYP  Y  GT+I    K  
Sbjct: 386 LMMRLESDLAQVLLSACQGELGNVSLTWSPEMAMVVVMASQGYPGPYKKGTVIKNVDKAE 445

Query: 348 QNTGTTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
           Q +   ++FHAGTA+  + NL A GGRVL  TA GK I E+R  AY  V+ ++W  G++R
Sbjct: 446 QVSPAVKIFHAGTALDGDGNLVAVGGRVLGVTAKGKDIEEARARAYGAVDAVEWPEGFFR 505

Query: 407 EDIGLQ 412
            DIG +
Sbjct: 506 HDIGWR 511


>gi|149202159|ref|ZP_01879132.1| Phosphoribosylamine--glycine ligase [Roseovarius sp. TM1035]
 gi|149144257|gb|EDM32288.1| Phosphoribosylamine--glycine ligase [Roseovarius sp. TM1035]
          Length = 420

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/417 (50%), Positives = 278/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHAL W + Q+P    L   PGN GIA+ A+C A+DI +  AI  FC+ 
Sbjct: 1   MNILILGSGGREHALGWAVLQNPKCDRLIVAPGNAGIAEIAECAALDILDGGAIAGFCEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID V++GPE PL  G++D L  AG  VFGPS  AA+LE+SKSF K  C     PTA Y
Sbjct: 61  EAIDFVIIGPEAPLAAGVADRLREAGLLVFGPSAAAARLEASKSFTKAICDAANAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ YV  +  PIVVKADGL AGKGV+VA T DEA +A++  F     Q  + 
Sbjct: 121 AHFTDLAAARAYVTAQGAPIVVKADGLAAGKGVIVAMTEDEALAALEDMFGGEFGQAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG+TA+P  TA+DHKR+ +GD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVIEEFMEGEEASFFVLCDGETALPIGTAQDHKRVGEGDTGPNTGGMGAYSPAPVMTDAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PT+  M +   P+QGVLF GLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 241 TQQALDQIVRPTLAEMARRGTPYQGVLFVGLMIKDGTPRLVEYNCRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI---PQNTGTT 353
           +  L++L +   G L +  +NW  ++ALTVV+A +GYP  Y  G++I+ +   P+++   
Sbjct: 301 AQALDLLLATAEGRLGDISVNWAEDHALTVVLAARGYPGTYEKGSVINGLENCPEDS-FH 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT      +TA GGRVL+ATA G T+ E+ E AY MV+ IDW  G+ R DIG
Sbjct: 360 MVFHAGTTRAEGQITATGGRVLAATARGTTLQEAAERAYAMVDQIDWPEGFCRRDIG 416


>gi|149185203|ref|ZP_01863520.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. SD-21]
 gi|148831314|gb|EDL49748.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. SD-21]
          Length = 425

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/422 (49%), Positives = 281/422 (66%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWK+AQSP   +LW  PGNPG+ + AQCVA+D  +H+A++ FC+E
Sbjct: 1   MNILLLGSGGREHALAWKVAQSPRCDKLWVSPGNPGMEECAQCVALDSSDHAAVVKFCEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             + LVV+GPE+PLV G++D+L  A    FGPS+ AA+LE SKSF K+ C + GIPTA +
Sbjct: 61  NAVQLVVIGPEVPLVEGLADSLKTADILSFGPSKAAAQLEGSKSFTKELCQRAGIPTARF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI----DRCFQQINST 176
           +  +    A   ++    P V+KADGL AGKGVV+A T DEA  A+    D  F    S 
Sbjct: 121 ERCTSLEAAWGALKKFDAPFVLKADGLAAGKGVVIAETRDEAQEALSEMFDGKFGSAGSE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE++L G E SFFAL DG+T +P  +A+DHKR+ DGD GPNTGGMGA SPA  ++  L
Sbjct: 181 VVIEQFLTGEEASFFALTDGETIVPLASAQDHKRVGDGDEGPNTGGMGAYSPAPVLTDTL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               I++II PT+  M++E  P+ GVL+AGLM+T  GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 REQAIREIIEPTVRTMREEGMPYSGVLYAGLMLTNTGPQLIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHI-NWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           SD++E++ +C    L          ++ALTVV+A +GYP     G  I          ++
Sbjct: 301 SDLVELMLACAKRRLGEIEAPKMSDDFALTVVMAAEGYPGTPKKGGSIDLGKAEANGAKV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT+   + L ++GGRVL+ TA G + TE++  AY  V+ ID+  G+ R DIG ++  
Sbjct: 361 FHAGTSREGDQLVSSGGRVLNVTAKGSSATEAQRAAYAAVDAIDFADGFCRRDIGQREVR 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|146276687|ref|YP_001166846.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554928|gb|ABP69541.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 420

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/416 (50%), Positives = 272/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW I Q+P    L   PGN GIA+ A+C  +DI + +A++ FC+ 
Sbjct: 1   MNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIARIAECSDLDILDGAAVVAFCEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  G++DA  AAG   FGPSQ AA+LE+SK F K+ C   G PTA Y
Sbjct: 61  NSVDFVVVGPEAPLAAGVADATRAAGILTFGPSQAAARLEASKGFTKEICDACGAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++   A+ +V+    PIVVKADGL AGKGVVVA T  EA +AID  F        + 
Sbjct: 121 ARFTEAEAARAHVRASGAPIVVKADGLAAGKGVVVAMTEAEAIAAIDDMFAGSLGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+T +P  TA+DHKR  DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEEFMAGEEASFFVLTDGRTVLPIGTAQDHKRAFDGDEGPNTGGMGAYSPAPVLTPAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PTI  M +   P+ GVL+AGLMI +    L+EYNVRFGDPECQ +M+RL 
Sbjct: 241 QRQALDEIIKPTIAEMARRGAPYSGVLYAGLMIEQGRARLVEYNVRFGDPECQVLMLRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-- 354
           +  L++L +C  G L    +NW  ++ALTVV+A +GYP  Y  G+ I  +     T++  
Sbjct: 301 AQALDLLLACAEGRLDEMRVNWAEDHALTVVLAARGYPGRYEKGSEIRGLEALPETSRQV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT   +  +TA GGRVL+ATA G T+ E+RE AY MV+ IDW  G+ R DIG
Sbjct: 361 VFHAGTTARDGRITAVGGRVLAATARGGTLAEAREAAYAMVDAIDWPEGFCRRDIG 416


>gi|83950853|ref|ZP_00959586.1| phosphoribosylamine--glycine ligase [Roseovarius nubinhibens ISM]
 gi|83838752|gb|EAP78048.1| phosphoribosylamine--glycine ligase [Roseovarius nubinhibens ISM]
          Length = 421

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/417 (49%), Positives = 278/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P    L   PGN GIAQ A C  +DI +  A++ F +E
Sbjct: 1   MNILILGSGGREHSLAWAVKQNPKCDRLIVAPGNAGIAQIADCAKLDIMDGGAVVTFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AG   FGPS+ AA+LE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIVGPEAPLAVGVADRLREAGLLCFGPSEGAARLEASKSFTKEICDAANAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF++   A+ +V+ K  PIV+KADGL AGKGV++A T DEA +AID  F          
Sbjct: 121 GHFTEAEAARAHVRAKGAPIVIKADGLAAGKGVIIAMTEDEALAAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F LCDG+  +   TA+DHKR+ DGD GPNTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLCDGENILSVGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLSPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M +   PFQGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EAIAMEQIVKPTMAEMARRGMPFQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI---PQNTGTT 353
           + +L++L++   G L+   + W  ++ALTVV+A  GYP +Y  GT I  +   P+++   
Sbjct: 301 AQVLDLLHAAAEGRLNEMSVTWAEDHALTVVMAALGYPGDYEKGTPIGALDTMPEDS-HH 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGTA     + A GGRVL+ TA G T+ E+R+ AY MVE IDW  G++R DIG
Sbjct: 360 MVFHAGTAETGGKIVATGGRVLNVTARGATLQEARDRAYGMVEGIDWPGGFYRRDIG 416


>gi|254440630|ref|ZP_05054123.1| phosphoribosylamine--glycine ligase [Octadecabacter antarcticus
           307]
 gi|198250708|gb|EDY75023.1| phosphoribosylamine--glycine ligase [Octadecabacter antarcticus
           307]
          Length = 420

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/416 (48%), Positives = 272/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREH+LAW + Q+P    L   PGN GIAQ A+C A+DI++   +  FC +
Sbjct: 1   MNILILGGGGREHSLAWAVKQNPKCDRLIVAPGNAGIAQIAECAALDIEDGDVVAGFCAD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D V++GPE PL  G++D L A G  VFG SQ AA+LESSKSF K  C     PTA Y
Sbjct: 61  NAVDFVIIGPEAPLAAGVADVLRANGLVVFGCSQAAAQLESSKSFTKAICDACDAPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
            HF+D   A+ YV  + +PIVVKADGL AGKGVVVA  +  A +AID      F    + 
Sbjct: 121 GHFTDATAARDYVTAQGVPIVVKADGLAAGKGVVVAMDIATAHTAIDDMLGGQFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE++++G E SFF LCDGKT +P  +A+DHKR +DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEDFMDGEEASFFVLCDGKTVLPIGSAQDHKRAYDGDTGPNTGGMGAYSPAPVLTDNI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++ I+ PT+  M +   PFQG+L+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 VAIALRDIVEPTVAEMARRGTPFQGILYAGLMIKDGRPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
             IL++L++C    L +   NW  ++A+T+V+A KGYP  Y  G+ I+ +     T +  
Sbjct: 301 GQILDLLHACADNRLSDVAPNWADDHAMTIVMAAKGYPGAYEKGSPINNLNALSETSSEM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            FHAGTAI +  + A GGRVL+ TA G T+ ++   AY   + IDW  G++R DIG
Sbjct: 361 TFHAGTAIKDGQIVAAGGRVLNVTARGATLKDAHAKAYARAQKIDWPDGFYRTDIG 416


>gi|114771710|ref|ZP_01449114.1| Phosphoribosylamine--glycine ligase [alpha proteobacterium
           HTCC2255]
 gi|114547782|gb|EAU50672.1| Phosphoribosylamine--glycine ligase [alpha proteobacterium
           HTCC2255]
          Length = 420

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/416 (49%), Positives = 278/416 (66%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P    L+  PGN GI++ AQCV ++I+N S ++ FC +
Sbjct: 1   MNILILGSGGREHSLAWAVNQNPKCDILYCAPGNAGISKVAQCVDLNIENSSDVLKFCLD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I  V++GPE PL  GI+D L A     FGPS  AAKLESSK+F K  C     PTA Y
Sbjct: 61  ESIQFVIIGPEAPLAMGIADDLRANNILTFGPSASAAKLESSKAFTKGVCDSCNAPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++   A +YV  +  PIVVKADGL  GKGV+VA T+DEA + +   F     +  + 
Sbjct: 121 ARFTELESAIEYVHEQGAPIVVKADGLAGGKGVIVAMTLDEAINGLKDIFSGAFGKAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF L DGK  +P  TA+DHKR+ DGD GPNTGGMGA SPA  M++++
Sbjct: 181 VVIEEFMEGEEASFFILSDGKNILPIGTAQDHKRVFDGDTGPNTGGMGAYSPAPIMTKDV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            S  I +II PTI+ M K   P+QGVL+AG MI +  P L+EYNVRFGDPECQA+MMRL 
Sbjct: 241 TSKAISQIIQPTIDEMAKRGIPYQGVLYAGFMIKDGEPKLVEYNVRFGDPECQALMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           +  L+ + +C  G L+N  +NW  ++ALT+V A KGYP  Y  G+ I  +   + +T  Q
Sbjct: 301 AQALDAMLACAKGELNNYKLNWADDHALTIVYAAKGYPGTYEKGSNILGLDTISESTNIQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT    NN+ A GGRVL+ TA G ++ E+  LAY  +E I W++G++R DIG
Sbjct: 361 VFHAGTKEEENNIIATGGRVLNITARGSSLKEAHRLAYETIEKIQWENGFYRNDIG 416


>gi|312114722|ref|YP_004012318.1| phosphoribosylamine/glycine ligase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219851|gb|ADP71219.1| phosphoribosylamine/glycine ligase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 419

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 217/419 (51%), Positives = 273/419 (65%), Gaps = 7/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIG GGREHALAWK+ QSP L   +  PGN GIAQ A     +  + + +  FC+E
Sbjct: 1   MNVLLIGGGGREHALAWKLTQSPALGTFYCSPGNAGIAQIAAPGPTNPDDFAQVAEFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV G++D L AAG  VFGPS  AA+LE+SKSF K  C +  IPTA Y
Sbjct: 61  AAIDLVVVGPEAPLVAGLADYLRAAGLAVFGPSAAAAQLEASKSFTKAVCDERAIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF    +A  Y + K  P+VVKADGL AGKGV V  T+ EA +A+  CF     +  S+
Sbjct: 121 GHFVSREEAMAYARAKGAPLVVKADGLAAGKGVTVCETLAEAEAAVASCFDGAFGEGGSS 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE L G E SFFA+CDG  A+PF + +DHKR  DGD GPNTGGMG  SPA  M+  L
Sbjct: 181 VVIEEKLIGEEASFFAICDGTRAVPFGSGKDHKRAFDGDEGPNTGGMGVISPAPQMTPAL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+++I+ PT++ M     PFQGVL+AGLMIT  GP LIEYNVRFGDPECQ +M+RL+
Sbjct: 241 SECVMREIVTPTLDAMAARGTPFQGVLYAGLMITADGPKLIEYNVRFGDPECQVLMLRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SD+L IL +   G+L      W  E A+TVV+A +GYP +Y  G++I  +          
Sbjct: 301 SDLLPILYAAAKGDLSGVAPEWSDETAITVVLAAEGYPGDYEKGSVIRGLNAAGALPGVT 360

Query: 355 LFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           +FHAGT    +  + ANGGRVL+ +ALG+  TE+R  AY     IDW  G++R DIGL+
Sbjct: 361 VFHAGTKRGADGVVLANGGRVLNVSALGRDATEARARAYAAAAAIDWPEGFYRRDIGLR 419


>gi|254511647|ref|ZP_05123714.1| phosphoribosylamine--glycine ligase [Rhodobacteraceae bacterium
           KLH11]
 gi|221535358|gb|EEE38346.1| phosphoribosylamine--glycine ligase [Rhodobacteraceae bacterium
           KLH11]
          Length = 420

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 279/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P    L   PGN GIAQ A C A+DI+N  A++ F +E
Sbjct: 1   MNILILGSGGREHSLAWAVMQNPKCDRLIVAPGNAGIAQIADCAALDIENGGAVVSFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AG  VFGPS  AA+LE+SKSF K+ C   G PTA Y
Sbjct: 61  NAIDFVIVGPEAPLAAGVADRLREAGVLVFGPSAAAAQLEASKSFTKEICDAAGAPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
             F++   AK Y++ +  PIVVKADGL AGKGV+VA     A  AID  F          
Sbjct: 121 ARFTEAEPAKAYIRQQGAPIVVKADGLAAGKGVIVAMDEQTALDAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F LCDG   +   TA+DHKR+ +GD G NTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLCDGDEVLSIGTAQDHKRVGEGDTGLNTGGMGAYSPAPVLSAEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M++   PFQGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EARAMEEIVRPTMAEMKRRGMPFQGVLYAGLMIRDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIIS---KIPQNTGTT 353
           +  ++++++   G L  T +NW  ++A+T+V+A KGYP  Y  G++IS    +P+++ + 
Sbjct: 301 AQAMDLMHAAAEGRLGETRVNWADDHAMTIVMAAKGYPGSYEKGSVISGLNALPEDS-SN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT   +  + A+GGRVL+ TA G ++ ++R+ AY MV+ IDW  G++R DIG
Sbjct: 360 MVFHAGTKAESGQVLASGGRVLNVTARGDSLQDARDRAYAMVDGIDWPEGFYRRDIG 416


>gi|326386128|ref|ZP_08207752.1| phosphoribosylamine--glycine ligase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326209353|gb|EGD60146.1| phosphoribosylamine--glycine ligase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 426

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 216/424 (50%), Positives = 288/424 (67%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+G+GGREHALAWK+AQSP L +L + PGNPGIA+HAQ  A+D+ +H+A+I FC+ 
Sbjct: 1   MNILLLGAGGREHALAWKLAQSPRLGKLHAAPGNPGIAEHAQIHALDVTDHAAVIAFCEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDLVV+GPE PLV+G++D+L   G  VFGPSQ AA+LE SK F K  CT+ GIPTA Y
Sbjct: 61  ETIDLVVIGPEAPLVDGLADSLRGVGISVFGPSQAAAQLEGSKGFTKDLCTRAGIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
              +D  +A   +    +P+V+KADGL AGKGVV+A T +EA +AI       F    + 
Sbjct: 121 LRTTDQAEALAALDRFGLPVVIKADGLAAGKGVVIAETAEEARAAIADMFGGQFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFFAL DG T +   +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL
Sbjct: 181 VVIEEFMEGEEASFFALTDGATIVALASAQDHKRVGDGDTGPNTGGMGAYSPARVLTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              VI +II PT++ M  E  P+ GVL+AGLM+T QGP LIEYN RFGDPECQ +MMR+E
Sbjct: 241 EREVITRIIAPTVKTMADEGTPYSGVLYAGLMLTAQGPKLIEYNCRFGDPECQVLMMRME 300

Query: 297 SDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKI-PQNTGTTQ 354
           SD++E+L++     L       +  E ALTVV+A +GYP     G +I+ I        +
Sbjct: 301 SDLVELLSAVAENRLAAIQPPAFSPEPALTVVMAAQGYPGTPKKGGLIAGIDAAQADGAK 360

Query: 355 LFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGT +     L ANGGRVL+ +A G ++ E+R+ AY  V+ ID+  G+ R DIG ++
Sbjct: 361 VFHAGTMLDGEGTLRANGGRVLNVSARGASVREARDAAYRAVDAIDFAEGFCRRDIGWRE 420

Query: 414 KERN 417
             R 
Sbjct: 421 IARE 424


>gi|89055793|ref|YP_511244.1| phosphoribosylamine--glycine ligase [Jannaschia sp. CCS1]
 gi|88865342|gb|ABD56219.1| phosphoribosylamine--glycine ligase [Jannaschia sp. CCS1]
          Length = 422

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/416 (48%), Positives = 273/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           + +L++GSGGREH+LAW + Q+P    L   PGN GI Q A C ++D+ N SA+  F  E
Sbjct: 3   LNILILGSGGREHSLAWAVLQNPKCDRLIVAPGNAGIDQIADCASLDVDNPSAVCDFAVE 62

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G+ D L  AG  VFGP+Q AA+LE+SK+F K+ C   G PTA +
Sbjct: 63  NLIDFVIVGPEAPLAAGVVDMLRNAGILVFGPTQAAAQLEASKTFTKEVCDAAGAPTAAW 122

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++   A+ YV+ K  P+VVKADGL AGKGVVVA T  +A +AID  F        + 
Sbjct: 123 TRFTEAAPARDYVREKGAPVVVKADGLAAGKGVVVAMTDGDALAAIDHMFDGAFGAAGAE 182

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG T +P  TA+DHKR +DGD GPNTGGMGA SPA  ++  +
Sbjct: 183 VVIEEFMEGEEASFFVLCDGDTCLPIGTAQDHKRAYDGDEGPNTGGMGAYSPAPVLTDAI 242

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT+  M++   P+ GVL+AGLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 243 AQAALDQIIRPTMAEMKRRGTPYTGVLYAGLMIHDGKPRLVEYNARFGDPECQVLMMRLG 302

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
              L+++ +C  G L +  +NW  ++ALTVV+A +GYP  Y  G+ I+ +     T +  
Sbjct: 303 GQALDLMLACAEGRLADAQVNWANDHALTVVMAAQGYPGGYEKGSAIAGLDALPETSSQM 362

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT   +  +TA GGRVL+ TA G T+ E+R+ AY M  +I+W  G++R DIG
Sbjct: 363 VFHAGTTARDGQITATGGRVLNVTARGATLQEARDQAYAMASHIEWPEGFFRTDIG 418


>gi|255261619|ref|ZP_05340961.1| phosphoribosylamine--glycine ligase [Thalassiobium sp. R2A62]
 gi|255103954|gb|EET46628.1| phosphoribosylamine--glycine ligase [Thalassiobium sp. R2A62]
          Length = 420

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/416 (48%), Positives = 265/416 (63%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW   Q+P    +   PGN GIAQ  +  A+DI +  A++ F   
Sbjct: 1   MNILILGSGGREHALAWATLQNPKCDRVVVAPGNAGIAQICETCALDIMDGDAVVEFATS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID V+VGPE PL  G+SD L AAGF  FGPSQ AA+LE+SKSF K  C     PTA Y
Sbjct: 61  QSIDFVIVGPEAPLAVGVSDRLRAAGFATFGPSQAAAELEASKSFTKDVCAAVDAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ Y++ +  PIVVKADGL AGKGV+VA T  EA  AID  F        + 
Sbjct: 121 GHFTDADAARDYIRAQGAPIVVKADGLAAGKGVIVAMTEAEALDAIDDMFHGEFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF L DG   +P  TA+DHKR  DGDIGPNTGGMGA SPA  M+  +
Sbjct: 181 VVIEEFMDGEEASFFVLVDGTDVLPIGTAQDHKRAFDGDIGPNTGGMGAYSPAPVMTDAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PT+  M +   PFQG+LF GLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 TQKALDEIVKPTMAEMARRGTPFQGILFVGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           +   +++ +C  G L +  +NW  ++ALT+V+A  GYP  Y  G++I  +     T+   
Sbjct: 301 AQAFDLIQACATGGLTDARVNWANDHALTIVLAANGYPGAYEKGSVIRGLDTLPATSCDM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT   + ++ A GGRVL+ TA   T+ E+R  AY   E IDW  G+ R DIG
Sbjct: 361 VFHAGTGEKDGDIIATGGRVLAVTARADTLAEARARAYTTTEQIDWPEGFMRTDIG 416


>gi|163746078|ref|ZP_02153437.1| phosphoribosylamine--glycine ligase [Oceanibulbus indolifex HEL-45]
 gi|161380823|gb|EDQ05233.1| phosphoribosylamine--glycine ligase [Oceanibulbus indolifex HEL-45]
          Length = 421

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/417 (49%), Positives = 279/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P   +L   PGN GIA  AQC  +DI + +A++ FC+ 
Sbjct: 1   MNILILGSGGREHSLAWAVMQNPKCDKLIVAPGNAGIAAIAQCAKLDIMDGAAVVAFCEG 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +ID V++GPE PL  G+ D L AAGF VFGPS+ AA LE+SK+F K+ C     PTA Y
Sbjct: 61  NNIDFVIIGPEAPLAAGVGDDLRAAGFDVFGPSKAAAALEASKAFTKEICDACNAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ YV+ +  PIV+KADGL AGKGV++A T  EA +A+D  F        + 
Sbjct: 121 GHFTDAASARAYVEKQGAPIVIKADGLAAGKGVIIALTDAEALAAVDEMFDGAFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG+T +P  TA+DHKR+ DGD GPNTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASFFVLCDGETVLPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLSDEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II P +  M K   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 AERALDEIIRPCMAEMAKRGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +   +++ +   G L +  +NW  ++ALTVV+A  GYP  Y  G+ I     +P+++   
Sbjct: 301 AQAFDLMQATAKGTLADIQVNWAEDHALTVVMAANGYPGAYEKGSEIKGLKNLPEDS-AN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT   +  + ANGGRVL+ TA G T+ E++E AY MV+ IDW  G+ R DIG
Sbjct: 360 MVFHAGTVAKDGAILANGGRVLNVTARGATLAEAQERAYAMVDGIDWPEGFCRRDIG 416


>gi|159474088|ref|XP_001695161.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158276095|gb|EDP01869.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 432

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 283/424 (66%), Gaps = 9/424 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           + VL++GSGGREH+LAWK++QSPL + L+  PGNPG     +   VA+++  H  ++ FC
Sbjct: 4   VNVLVVGSGGREHSLAWKLSQSPLCNHLFCAPGNPGTETEPKVTNVAVNVTKHKDVVQFC 63

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK + LVVVGPE+PLV G++D L AAG   +GPS RAA LE SK+F K  C KY IPTA
Sbjct: 64  KEKDVGLVVVGPEVPLVAGLADDLQAAGVPTWGPSARAAALEGSKAFMKDVCRKYDIPTA 123

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y+ F+DP +AK +++    PIVVKA GL AGKGVVVA TV+EA  A+D     + F   
Sbjct: 124 AYEKFTDPARAKAFIKQLGAPIVVKASGLAAGKGVVVARTVEEAYQAVDDMLVRKVFGGA 183

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G EVSFFAL DG+ A+P  +A+DHK + DGD GPNTGGMGA SPA  M+
Sbjct: 184 GDELVIEEFLDGEEVSFFALVDGEAAVPLVSAQDHKAVGDGDTGPNTGGMGAYSPAPAMN 243

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
             ++  V+ +II  T  GM  E  PF+G LFAGLMI +    L+E+NVRFGDPECQ +M 
Sbjct: 244 DTIHKQVMDEIIYRTARGMAAEGAPFRGTLFAGLMIKDGKAKLLEHNVRFGDPECQGLMA 303

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT 353
              SD+ + + +   G L +  ++W+ E ALTVV+A +GYP EYP G++I  +   TG  
Sbjct: 304 LCASDLTDAMLAATRGRLGDVRLDWRPEAALTVVLAARGYPGEYPKGSVIRGLEGVTG-A 362

Query: 354 QLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           ++FHAGTA      + + GGRVL+ TALG  + E++  AY  V+ I W   Y+R DIG +
Sbjct: 363 KVFHAGTARNAAGEVVSAGGRVLNVTALGADVAEAQAKAYAAVKQIQWADAYYRSDIGWR 422

Query: 413 KKER 416
             ER
Sbjct: 423 AVER 426


>gi|154251075|ref|YP_001411899.1| phosphoribosylamine--glycine ligase [Parvibaculum lavamentivorans
           DS-1]
 gi|154155025|gb|ABS62242.1| phosphoribosylamine--glycine ligase [Parvibaculum lavamentivorans
           DS-1]
          Length = 427

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 219/422 (51%), Positives = 274/422 (64%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L+IGSGGREHAL W I +SPL   L+  PGN GIA  A+CV++   +  AI+ F +E
Sbjct: 1   MNILVIGSGGREHALCWAIRKSPLCDVLYCAPGNGGIAGVAECVSLSPNDFDAIVAFVRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I  VVVGPE PLVNG+ D L+A G K FGPS  AA+LE SK F K  C ++GIPTA Y
Sbjct: 61  KKIGFVVVGPEDPLVNGLVDRLDAEGIKSFGPSAAAARLEGSKGFTKDLCAEFGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F D   AK +V  K  PIVVKADGL AGKGV VA T  EA +AID  F        + 
Sbjct: 121 GRFQDAAAAKSFVAAKGAPIVVKADGLAAGKGVTVAMTEAEAAAAIDEIFSGRFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+LEG E SFFALCDG   +   TA+DHKR+ D D GPNTGGMGA SPA  M+ EL
Sbjct: 181 VVVEEFLEGEEASFFALCDGNYVLALATAQDHKRVFDNDQGPNTGGMGAYSPAPVMTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            S  +++I+ PT+  M+    PF+GVL+AGLMIT +GP LIEYN RFGDPE Q +MMRL 
Sbjct: 241 SSRAMKEIVEPTVAAMRARGTPFKGVLYAGLMITAEGPKLIEYNARFGDPETQVLMMRLA 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQ 354
           SD+L +L +   G L +   +WK E ALTVV+A +GYP +Y   T I  + +       +
Sbjct: 301 SDVLPLLIASHDGTLADAECHWKDEVALTVVMAAEGYPGDYKKNTEIKGLAEAGAIDGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + A GGRVL+ TA GK+  E++  AY  V  IDW  G+ R DIG +  
Sbjct: 361 IFHAGTKAEDGKIYATGGRVLNVTASGKSTAEAQARAYRAVAKIDWPQGFCRRDIGYRAI 420

Query: 415 ER 416
           ER
Sbjct: 421 ER 422


>gi|85706859|ref|ZP_01037950.1| Phosphoribosylamine--glycine ligase [Roseovarius sp. 217]
 gi|85668652|gb|EAQ23522.1| Phosphoribosylamine--glycine ligase [Roseovarius sp. 217]
          Length = 421

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/417 (50%), Positives = 276/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P    L   PGN GIA+ A+C A+D  +  AI  FC+ 
Sbjct: 1   MNILILGSGGREHALAWAVLQNPKCDRLIVAPGNAGIAEIAECAALDSLDGGAIAGFCEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID V++GPE PL  G++D L  AG  VFGPS  AA+LE+SKSF K  C     PTA Y
Sbjct: 61  EAIDFVIIGPEAPLAAGVADRLRDAGLLVFGPSAAAARLEASKSFTKAICDAAQAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ YV  +  PIVVKADGL AGKGV+VA T +EA +A+D  F        + 
Sbjct: 121 AHFTDLAAARAYVTAQGAPIVVKADGLAAGKGVIVAMTEEEALAALDDMFSGEFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG+TA+P  TA+DHKR+ DGD GPNTGGMGA SPA  M++ +
Sbjct: 181 VVIEEFMEGEEASFFVLCDGETALPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVMTEAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +  I+ PT+  M +   P+QGVLF GLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 241 TQQALDLIVRPTLREMSRRGTPYQGVLFVGLMIKDGTPRLVEYNCRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI---PQNTGTT 353
           +  L++L +   G L +  +NW  ++ALTVV+A  GYP +Y  G++I  +   P+++   
Sbjct: 301 AQALDLLLATSEGRLGDISVNWAEDHALTVVLAALGYPGDYTKGSVIKGLEACPEDS-FH 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT      +TA GGRVL+ATA G T+ E+ + AY MV+ IDW  G+ R DIG
Sbjct: 360 MVFHAGTTRAGTQITATGGRVLAATARGTTLREAADRAYAMVDQIDWPEGFCRRDIG 416


>gi|242088645|ref|XP_002440155.1| hypothetical protein SORBIDRAFT_09g026980 [Sorghum bicolor]
 gi|241945440|gb|EES18585.1| hypothetical protein SORBIDRAFT_09g026980 [Sorghum bicolor]
          Length = 521

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 220/422 (52%), Positives = 281/422 (66%), Gaps = 14/422 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVAIDIQNHSA-IIHFCQ 59
           VL+IG GGREHAL   +  SP  + +   PGN GIAQ   A C++    + S  +I FC+
Sbjct: 89  VLVIGGGGREHALCHALNHSPSCAAVLCAPGNAGIAQSGDATCISDLDISSSDDVISFCR 148

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
            + + +VVVGPE PLV G+++ L   G   FGP+  AA LE SK F KK C KY IPTA 
Sbjct: 149 NRGVGMVVVGPEAPLVAGLANDLVKVGIPTFGPTSEAAALEGSKDFMKKLCDKYDIPTAK 208

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQIN 174
           Y+ F+D ++AK+YV+N+  PIVVKADGL AGKGVVVA T+DEA  AID       F    
Sbjct: 209 YRTFTDAVEAKKYVKNEGAPIVVKADGLAAGKGVVVAMTLDEALEAIDSMLVEGSFGSAG 268

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VIIEE+LEG E SFFAL DG+ A+P  +A+DHKR+ DGD+GPNTGGMGA SPA  ++ 
Sbjct: 269 SRVIIEEFLEGEEASFFALVDGENALPLESAQDHKRVGDGDVGPNTGGMGAYSPAPIVTD 328

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           EL   V++ II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M
Sbjct: 329 ELKRIVMESIIIPTVKGMAAEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLM 388

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQN 349
           MRLESD+ ++L S   G L N  + W  E A+ VV+A++GYP  Y  GT+I    K  Q 
Sbjct: 389 MRLESDLAQVLLSACQGELGNVSLTWSPEMAMVVVMASQGYPGSYKKGTVIKNVDKAEQV 448

Query: 350 TGTTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +   ++FHAGTA+  + NL A GGRVL  TA GK I E+R  AY  V+ + W  G++R D
Sbjct: 449 SPAVKIFHAGTALDGDGNLVAVGGRVLGVTAKGKDIEEARARAYDAVDAVQWPEGFFRRD 508

Query: 409 IG 410
           IG
Sbjct: 509 IG 510


>gi|255659542|ref|ZP_05404951.1| phosphoribosylamine--glycine ligase [Mitsuokella multacida DSM
           20544]
 gi|260848096|gb|EEX68103.1| phosphoribosylamine--glycine ligase [Mitsuokella multacida DSM
           20544]
          Length = 427

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 202/423 (47%), Positives = 283/423 (66%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQ 59
           M +L+IGSGGREH LAWK+AQSP  ++L+++PGNPG+A  A+C+  +DI ++ A++   +
Sbjct: 1   MNILVIGSGGREHTLAWKLAQSPKATKLYAVPGNPGMADIAECIGGVDICDNEALVKLAE 60

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +K IDLVVVGPE+PL NG+ DA+NAAG K FGP + AA++E SKSF+K    KYGIPTA 
Sbjct: 61  DKAIDLVVVGPEVPLTNGVVDAMNAAGIKAFGPRKLAAEIEGSKSFSKNLMKKYGIPTAK 120

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQIN 174
           Y+ F+D  +A+ Y++ +  PIV+KADGL AGKGV+VA T++EA  A+     D  F +  
Sbjct: 121 YEVFTDADEARAYIKKEGAPIVIKADGLAAGKGVIVAMTLEEALDAVHEIMDDAAFGKAG 180

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S V+IEE++EG E S  A  DGKT  P  +++DHKR +DGD GPNTGGMG  +PA  M+ 
Sbjct: 181 SRVVIEEFMEGEEASLLAFTDGKTIYPMVSSQDHKRAYDGDKGPNTGGMGTYAPAPVMTD 240

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
           E+     ++I+ PTI  M KE  P++G L+AGLMIT++GP ++E+N RFGDPE Q ++  
Sbjct: 241 EMVKIATERILKPTIAAMAKEGRPYKGCLYAGLMITKEGPKVVEFNARFGDPETQVVLPL 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG-TT 353
           LESD+++I+ +C  G+L   HI W    A+ VV+A+ GYP+ Y  G  I  + +     T
Sbjct: 301 LESDLVDIMLACTDGHLDEEHIEWSKGAAVCVVIASGGYPKAYKKGYPIEGLAKAKALDT 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA  +  +  NGGRVL   A    I  + + AY  V  I +K  + R DI  + 
Sbjct: 361 LVFHAGTAEKDGKIVTNGGRVLGVVAKADDIRTAVDKAYKGVNAITFKDAFHRNDIAHRA 420

Query: 414 KER 416
            ER
Sbjct: 421 LER 423


>gi|163737652|ref|ZP_02145069.1| phosphoribosylamine--glycine ligase [Phaeobacter gallaeciensis
           BS107]
 gi|161389178|gb|EDQ13530.1| phosphoribosylamine--glycine ligase [Phaeobacter gallaeciensis
           BS107]
          Length = 421

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/417 (48%), Positives = 275/417 (65%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A C ++DI N  A+  F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIADCASLDIDNGGAVAAFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG  VFGPS+ AAKLE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIIGPEAPLAAGVADRLRDAGLLVFGPSEAAAKLEASKSFTKEICDAAKAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+N   P VVKADGL AGKGV++A T  EA  AID  F          
Sbjct: 121 GHFTDAEAAKAHVRNHGAPTVVKADGLAAGKGVIIAMTEAEAIEAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   +A+DHKR+ +GD GPNTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLVDGEDVLAIGSAQDHKRVGEGDTGPNTGGMGAYSPAPVLSAEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EAKAMEEIVKPTMRVMAERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++ +   G L  T +NW  ++A+TVV+A +GYP  Y  G+ I     +P+++ + 
Sbjct: 301 AQALDLMQAAAEGRLAETQVNWADDHAITVVMAAEGYPGSYKKGSEIKGLEALPEDS-SN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT      + A GGRVL+ TA G T+ E+R+ AY MV+ +DW  G++R DIG
Sbjct: 360 MVFHAGTKAEAGKMQAVGGRVLNVTARGDTLQEARDRAYAMVDGVDWPQGFFRRDIG 416


>gi|163740773|ref|ZP_02148166.1| phosphoribosylamine--glycine ligase [Phaeobacter gallaeciensis
           2.10]
 gi|161385764|gb|EDQ10140.1| phosphoribosylamine--glycine ligase [Phaeobacter gallaeciensis
           2.10]
          Length = 421

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/417 (48%), Positives = 275/417 (65%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A C ++DI N  A+  F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIADCASLDIDNGGAVAAFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG  VFGPS+ AAKLE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIIGPEAPLAAGVADRLRDAGLLVFGPSEAAAKLEASKSFTKEICDAAKAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+N   P VVKADGL AGKGV++A T  EA  AID  F          
Sbjct: 121 GHFTDAEAAKAHVRNHGAPTVVKADGLAAGKGVIIAMTEAEAIEAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   +A+DHKR+ +GD GPNTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLVDGEDVLAIGSAQDHKRVGEGDTGPNTGGMGAYSPAPVLSAEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EAKAMEEIVKPTMRVMAERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++ +   G L  T +NW  ++A+TVV+A +GYP  Y  G+ I     +P+++ + 
Sbjct: 301 AQALDLMQAAAKGRLAETQVNWADDHAITVVMAAEGYPGSYEKGSEIKGLEALPEDS-SN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT      + A GGRVL+ TA G T+ E+R+ AY MV+ +DW  G++R DIG
Sbjct: 360 MVFHAGTKAEAGKMQAVGGRVLNVTARGDTLQEARDRAYAMVDGVDWPQGFFRRDIG 416


>gi|119386736|ref|YP_917791.1| phosphoribosylamine--glycine ligase [Paracoccus denitrificans
           PD1222]
 gi|119377331|gb|ABL72095.1| phosphoribosylamine--glycine ligase [Paracoccus denitrificans
           PD1222]
          Length = 420

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 273/417 (65%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW I Q+P    L+  PGN G+   A+   +DI +  A+I FC+E
Sbjct: 1   MNILILGSGGREHALAWAIRQNPKCDRLFVAPGNAGMEPLARLADLDILSGPAVIGFCEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVV+GPE PL  G++D L AAG   FGPS+ AA LE+SKSF K+ C   G PTA +
Sbjct: 61  NAIDLVVIGPEAPLAAGVADELRAAGILAFGPSRAAAMLEASKSFTKEVCDACGAPTAAW 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F     A+ Y++ +  PIVVKADGL AGKGV VA T  EA +A+D  F     +  + 
Sbjct: 121 ARFDAAEPARAYIRAQGAPIVVKADGLAAGKGVTVAMTEAEAIAAVDDAFGGAFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF LCDGK  +P  TA+DHKR  DGD GPNTGGMGA SPA  ++Q +
Sbjct: 181 VVIEEFMAGEEASFFVLCDGKDCLPIGTAQDHKRAFDGDTGPNTGGMGAYSPAPVLTQAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+++I+ PT+  M +   PFQGVL+AGLMI      L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 QDQVMEQIVRPTVAEMARRGTPFQGVLYAGLMIEHGRARLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++ +C  G L +  ++W  ++ALTVV+A KGYP  Y  G+ I     +P+++   
Sbjct: 301 AQALDLILACAEGRLGDMAVSWAQDHALTVVLAAKGYPGAYEKGSAIRGLDALPEDS-FR 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGTA  +  + A GGRVL+AT  G T+ E+   AY +V+ IDW  G+ R DIG
Sbjct: 360 MVFHAGTARRDGQIVATGGRVLAATGRGATLAEAHARAYALVDAIDWPEGFCRRDIG 416


>gi|114763002|ref|ZP_01442432.1| phosphoribosylamine--glycine ligase [Pelagibaca bermudensis
           HTCC2601]
 gi|114544326|gb|EAU47334.1| phosphoribosylamine--glycine ligase [Roseovarius sp. HTCC2601]
          Length = 420

 Score =  421 bits (1082), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/416 (49%), Positives = 281/416 (67%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW + Q+P   +L   PGN GIAQ A+C ++DI++  A++ F  E
Sbjct: 1   MNILILGGGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIAECASLDIEDGGAVVEFSGE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL+++GPE PL  G++DAL  AGF VFGPS+ AA+LE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDLIIIGPEAPLAAGVADALRDAGFPVFGPSKAAAELEASKSFTKEICDAAKAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK YV+++  PIVVKADGL AGKGV++A TV+ A +AID  F          
Sbjct: 121 GHFTDAEAAKAYVRDQGAPIVVKADGLAAGKGVIIAETVEAAEAAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+  +P  TA+DHKR+ +GD GPNTGGMGA SPA  +S  +
Sbjct: 181 VVIEEFMTGEEASFFLLVDGEDVLPIGTAQDHKRVGEGDTGPNTGGMGAYSPAPVLSDAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++I+ PT+  M +   P+ GVL+AGLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 AEKALEEIVKPTMREMARRGTPYSGVLYAGLMIENGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           +  L+++++C  G L    + W  ++A+TVV+A +GYP  Y  GT+I  +   T  +  Q
Sbjct: 301 AQALDLIHACAEGRLAEAQVTWADDHAMTVVLAAEGYPGSYEKGTVIGGLDGLTEDSFHQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT+  +  + A+GGRVL+ATA G T+ E+ E AY +V+ +DW  G+ R DIG
Sbjct: 361 MFHAGTSKKDGKVVASGGRVLNATARGATLAEAAERAYALVDGVDWPEGFCRRDIG 416


>gi|296282930|ref|ZP_06860928.1| phosphoribosylamine--glycine ligase [Citromicrobium bathyomarinum
           JL354]
          Length = 426

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/423 (48%), Positives = 284/423 (67%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWK+A +   + L++ PGNPGIA HA  VA+D  +H A+I FC E
Sbjct: 1   MNILLLGSGGREHALAWKLAAARSCTMLYAAPGNPGIADHADIVALDASDHKAVIGFCHE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV G++D L   G  VFGP + AA+LE SK F K  C + GIPTA Y
Sbjct: 61  KGIDLVVVGPEAPLVAGLADDLRGEGIAVFGPGKAAAQLEGSKGFTKDLCARAGIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI----DRCFQQINST 176
           +  +    A   +++ + P V+KADGL AGKGVV+A T +EA  A+    D  F    S 
Sbjct: 121 ERATSLEAAWGALKHFNAPFVLKADGLAAGKGVVIAETREEAQHALSEMFDGRFGSAGSE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFFAL DG+T +PF +A+DHKR+ +GD GPNTGGMGA SPA  ++++L
Sbjct: 181 VVIEEFMRGEEASFFALTDGETILPFGSAQDHKRVGEGDTGPNTGGMGAYSPAPVLTEDL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++I++PT+  +  E  P+ GVL+AGLM+T++GP L+EYN+RFGDPECQ +MMR E
Sbjct: 241 VDRAMREIVVPTVRTLGAEGMPYCGVLYAGLMLTDEGPKLVEYNIRFGDPECQVLMMRFE 300

Query: 297 SDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
            D+  +L +C  G L +   + +  + ALTVV+A +GYP+    G  I       G  ++
Sbjct: 301 GDLAALLMACATGKLVDAEPVRFSDDTALTVVMAAEGYPDTPRKGGTIDLGNAEAGGAKV 360

Query: 356 FHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           FHAGTA   +  L A+GGRVL+ TA G+ +T+++  AY  V+ ID+  G+ R DIG ++ 
Sbjct: 361 FHAGTAREPDGTLIASGGRVLNVTARGRNVTQAQAAAYEAVDAIDFAQGFCRRDIGWREV 420

Query: 415 ERN 417
           ER 
Sbjct: 421 ERE 423


>gi|254451186|ref|ZP_05064623.1| phosphoribosylamine--glycine ligase [Octadecabacter antarcticus
           238]
 gi|198265592|gb|EDY89862.1| phosphoribosylamine--glycine ligase [Octadecabacter antarcticus
           238]
          Length = 420

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/418 (47%), Positives = 272/418 (65%), Gaps = 6/418 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREH+LAW + Q+P    L   PGN GIAQ A+C A++I++   +  FC +
Sbjct: 1   MNILILGGGGREHSLAWAVKQNPKCDRLIVAPGNAGIAQIAECAALNIEDGDVVAGFCAD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D V++GPE PL  G++D L + G  VFG SQ AA+LESSKSF K  C     PTA Y
Sbjct: 61  NAVDFVIIGPEAPLAAGVADVLRSNGLVVFGCSQAAAQLESSKSFTKAICDACDAPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
            HF+D   A  YV  +  PIV+KADGL AGKGVVVA  +D A +A+D      F    + 
Sbjct: 121 GHFTDAKAAHDYVTAQGAPIVIKADGLAAGKGVVVAMDIDTAHTAVDDMLGGQFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE++++G E SFF LCDG T +P  TA+DHKR  DGD GPNTGGMGA SPA  +++++
Sbjct: 181 VLIEDFMDGEEASFFVLCDGTTVLPVGTAQDHKRAFDGDNGPNTGGMGAYSPAPVLTEDI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++ I+ PT+  M K   PFQG+L+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 VTIALRDIVEPTVAEMAKRGTPFQGILYAGLMIKDGLPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTTQ 354
             IL++L++C    L +   NW  ++A+TVV+A KGYP  Y  G+ I+ +     T +  
Sbjct: 301 GQILDLLHACAENRLSDVTPNWADDHAMTVVMAAKGYPGAYEKGSQINNLIALSETSSEM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            FHAGTA  +  + A GGRVL+ TA G T+ ++    Y MV +IDW  G++R DIG +
Sbjct: 361 TFHAGTATKDGQIVATGGRVLNVTARGATLKDAHAKVYAMVHHIDWPDGFYRTDIGYR 418


>gi|254563192|ref|YP_003070287.1| phosphoribosylglycinamide synthetase [Methylobacterium extorquens
           DM4]
 gi|254270470|emb|CAX26470.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Methylobacterium extorquens DM4]
          Length = 435

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/428 (48%), Positives = 277/428 (64%), Gaps = 8/428 (1%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQEK 61
           +LLIGSGGREHALAW IA+SPL + L+  PGNPG AQH +    + + +H+A++ FC+ +
Sbjct: 7   ILLIGSGGREHALAWAIAKSPLCTRLFIAPGNPGTAQHGENRPDLTVSDHAAVVAFCRAE 66

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            + LVVVGPE PLV G+ D L AAG   FGP++ AA+LE SK F K  C ++ IPTA + 
Sbjct: 67  GVGLVVVGPEAPLVAGLVDDLQAAGIPAFGPTKAAAQLEGSKGFTKDLCAEHDIPTAAFA 126

Query: 122 HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIE 180
            F+D   A  Y++ +  PIVVKADGL AGKGV VA T+ EA +A+           ++IE
Sbjct: 127 RFTDLEPALAYLRERGAPIVVKADGLAAGKGVTVAETLPEAEAAVRAILDGTEGGALVIE 186

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E L G E SFFALCDG  A+P  TA+DHKR+HDGD+GPNTGGMGA SPA  ++ E+  TV
Sbjct: 187 ECLFGEEASFFALCDGTRAVPIGTAQDHKRVHDGDLGPNTGGMGAYSPASIVTPEITETV 246

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+ GM     PF G+L+AGLM+T +GP LIEYN RFGDPE Q +M RL  D++
Sbjct: 247 MTRIIAPTLAGMAARGTPFSGILYAGLMLTAEGPKLIEYNTRFGDPEAQVLMPRLTGDLV 306

Query: 301 EILNSCVHGNLHNTHINWKA-EYALTVVVATKGYPEEYPHGTIISKIPQNTG-----TTQ 354
             L +   G+L    I + A   ALTVV+A +GYP     GT I  +    G     T  
Sbjct: 307 PALLAAAQGDLSGVAIGFDASRAALTVVMAAQGYPGAVTRGTEIRGVEAAGGEAGDATVL 366

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT    + L A+GGRVL+ TALG ++ ++++ AY  V+ IDW  G++R DIG ++ 
Sbjct: 367 VFQAGTRRDGDRLLADGGRVLAVTALGASVGQAKDRAYAAVKRIDWPDGFFRSDIGGREV 426

Query: 415 ERNVKYRN 422
            R    + 
Sbjct: 427 AREAASKG 434


>gi|126729212|ref|ZP_01745026.1| phosphoribosylamine--glycine ligase [Sagittula stellata E-37]
 gi|126710202|gb|EBA09254.1| phosphoribosylamine--glycine ligase [Sagittula stellata E-37]
          Length = 420

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/416 (48%), Positives = 273/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW   Q+P   +L   PGN GIA+ A+C  IDI++   ++ F  +
Sbjct: 1   MNILILGSGGREHALAWAALQNPKCDKLIVAPGNAGIAKIAECARIDIEDGGVVVEFASD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PL  G++D L  AG  VFGPS  AA+LE+SKSF K+ C   G PTA Y
Sbjct: 61  NAIDLVIVGPEAPLAAGVADRLREAGLSVFGPSAAAARLEASKSFTKEICDACGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +++    P+VVKADGL AGKGV++A T+++A +A+D  F          
Sbjct: 121 GHFTDLDAAKAHIRGGRAPVVVKADGLAAGKGVIIAETLEDACAAVDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+T +P  TA+DHKR+ +GD GPNTGGMGA SPA  M   +
Sbjct: 181 VVIEEFMTGEEASFFVLVDGETCLPVGTAQDHKRVGEGDTGPNTGGMGAYSPAPIMDDAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +I+ P +  M +   P+QGVL+ GLMI    P L+EYNVRFGDPECQ +M+RL 
Sbjct: 241 TAKALDQIVRPCMAEMVRRGTPYQGVLYVGLMIENGQPRLVEYNVRFGDPECQVLMLRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
              L+++++C  G L +  +NW  ++A+TVV+A  GYP  Y  GT+I  +   T  +   
Sbjct: 301 GQALDLIHACAEGRLADAQVNWADDHAMTVVMAADGYPGGYTKGTVIRGLDALTEDSFNV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT      +TA GGRVL+ATA G T+ E+R+ AY MV+ +DW  G+ R DIG
Sbjct: 361 MFHAGTTEAGGAVTATGGRVLNATARGATLREARDRAYGMVDAVDWPEGFCRRDIG 416


>gi|126740018|ref|ZP_01755708.1| phosphoribosylamine--glycine ligase [Roseobacter sp. SK209-2-6]
 gi|126718837|gb|EBA15549.1| phosphoribosylamine--glycine ligase [Roseobacter sp. SK209-2-6]
          Length = 442

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/417 (48%), Positives = 276/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A C + +I++  A+  F +E
Sbjct: 21  MNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIADCASFNIEDGGAVAAFAEE 80

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG  VFGPS+ AAKLE+SKSF K+ C     PTA Y
Sbjct: 81  NAIDFVIIGPEAPLAAGVADRLREAGLLVFGPSEAAAKLEASKSFTKEICDAANAPTAGY 140

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+    P VVKADGL AGKGV++A T DEA +AID  F          
Sbjct: 141 GHFTDAEAAKAHVRKHGAPTVVKADGLAAGKGVIIAMTEDEALAAIDDMFGGAFGGAGAE 200

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   +A+DHKR+ +GD GPNTGGMGA SPA  +S  +
Sbjct: 201 VVIEEFMEGEEASLFVLVDGEDVLAIGSAQDHKRVGEGDTGPNTGGMGAYSPAPVLSPAI 260

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT++ M     P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 261 EAKAMEEIVKPTMKVMADRGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 320

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++ +   G L    +NW  ++A+TVV+A +GYP  Y  G+II     +P+++ + 
Sbjct: 321 AQALDLMQAAAEGRLREAQVNWAEDHAITVVLAAEGYPGSYEKGSIIKGLDALPEDS-SN 379

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT      + A GGRVL+ TA G T++E+R+ AY MV+ IDW  G++R DIG
Sbjct: 380 MVFHAGTKASEGQIQAVGGRVLNVTARGATLSEARDRAYAMVDGIDWPQGFFRRDIG 436


>gi|168043807|ref|XP_001774375.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162674367|gb|EDQ60877.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 459

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/428 (50%), Positives = 283/428 (66%), Gaps = 14/428 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI--AQHAQCVA-IDIQNHSAIIHFCQ 59
           VL+IG GGREHAL + + +SP  SE++  PGN GI  +  A CV  +DI   SA+I FCQ
Sbjct: 25  VLVIGGGGREHALCYALQRSPTCSEVFCAPGNAGINTSGDAICVGELDITYSSAVIEFCQ 84

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  + LVVVGPE PLV G+ D L  AG   FGPS  AA LE SK F K+ C KY IPTA 
Sbjct: 85  KSGVGLVVVGPEAPLVAGLVDDLVEAGIPAFGPSASAAALEGSKDFMKRLCDKYEIPTAK 144

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQIN 174
           YQ F+D  KAK Y++ +  PIVVKADGL AGKGVVVA T++EA +A+D       F    
Sbjct: 145 YQSFTDAEKAKTYIKEQGAPIVVKADGLAAGKGVVVAMTLEEAYAAVDSMLVSSEFGSAG 204

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
             V++EE+L+G EVSFFA+ DG+ A+P  +A+DHKR+ DGD GPNTGGMGA SPA  +S 
Sbjct: 205 GLVLVEEFLDGEEVSFFAIVDGENAVPMASAQDHKRVGDGDTGPNTGGMGAYSPAPALSP 264

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ--GPYLIEYNVRFGDPECQAMM 292
           EL   V++ II PT++GM+ E   + GVL+AG++I ++   P L+EYNVRFGDPECQ +M
Sbjct: 265 ELERKVMETIIYPTVKGMRAEGCKYVGVLYAGVIIEKKNGSPKLLEYNVRFGDPECQVLM 324

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--- 349
           +RL+SD++++L S   GNL+   + W  + AL VV+A+ GYP +Y  GT I  +      
Sbjct: 325 IRLQSDLVQVLLSACKGNLNGVQLEWAEDPALVVVMASNGYPGKYVTGTRIKNLDVAEVV 384

Query: 350 TGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
               ++FHAGT +   N + A GGRVL  TA+GK I E++  AY  V+ IDW  G+ R D
Sbjct: 385 APGVKVFHAGTTMNSENEIVAAGGRVLGVTAVGKDIAEAQSKAYSAVDQIDWPEGFCRRD 444

Query: 409 IGLQKKER 416
           IG +   R
Sbjct: 445 IGWRAVSR 452


>gi|218532086|ref|YP_002422902.1| phosphoribosylamine/glycine ligase [Methylobacterium
           chloromethanicum CM4]
 gi|218524389|gb|ACK84974.1| phosphoribosylamine/glycine ligase [Methylobacterium
           chloromethanicum CM4]
          Length = 435

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 276/428 (64%), Gaps = 8/428 (1%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQEK 61
           +LLIGSGGREHALAW IA+SPL + L+  PGNPG AQH +    + + +H+A++ FC+ +
Sbjct: 7   ILLIGSGGREHALAWAIAKSPLCARLFIAPGNPGTAQHGENRPDLAVSDHAAVVAFCRAE 66

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            + LVVVGPE PLV G+ D L AAG   FGP++ AA+LE SK F K  C ++ IPTA + 
Sbjct: 67  GVGLVVVGPEAPLVAGLVDDLQAAGIPAFGPTKAAAQLEGSKGFTKDLCAEHDIPTAAFA 126

Query: 122 HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIE 180
            F+D   A  Y++ +  PIVVKADGL AGKGV VA T+ EA +A+           ++IE
Sbjct: 127 RFTDLEPALAYLRERGAPIVVKADGLAAGKGVTVAETLPEAEAAVRAILDGTEGGALVIE 186

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E L G E SFFALCDG  A+P  TA+DHKR+HDGD+GPNTGGMGA SPA  ++ E+  TV
Sbjct: 187 ECLFGEEASFFALCDGTRAVPIGTAQDHKRVHDGDLGPNTGGMGAYSPASIVTPEITETV 246

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+ GM     PF G+L+AGLM+T +GP LIEYN RFGDPE Q +M RL  D++
Sbjct: 247 MTRIIAPTLAGMAARSTPFSGILYAGLMLTAEGPKLIEYNTRFGDPEAQVLMPRLTGDLV 306

Query: 301 EILNSCVHGNLHNTHINWKA-EYALTVVVATKGYPEEYPHGTIISKI-----PQNTGTTQ 354
             L +   G+L    I + A   ALTVV+A +GYP     GT I  +          T  
Sbjct: 307 PALLAAAQGDLSGVAIGFDASRAALTVVMAAQGYPGAVTRGTEIRGVEAAEDEAGDATVL 366

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT    + L A+GGRVL+ TALG ++ ++++ AY  V+ IDW  G++R DIG ++ 
Sbjct: 367 VFQAGTRRDGDRLLADGGRVLAVTALGASVGQAKDRAYAAVKRIDWPDGFFRSDIGGREV 426

Query: 415 ERNVKYRN 422
            R    + 
Sbjct: 427 AREAASKG 434


>gi|296132352|ref|YP_003639599.1| phosphoribosylamine/glycine ligase [Thermincola sp. JR]
 gi|296030930|gb|ADG81698.1| phosphoribosylamine/glycine ligase [Thermincola potens JR]
          Length = 422

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/423 (48%), Positives = 286/423 (67%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHAL WKI+QSP +++++  PGN G+AQ A+CVAI +++   ++ F Q+
Sbjct: 1   MKVLVVGGGGREHALVWKISQSPKVTKVYCAPGNAGMAQIAECVAISVEDIDGLLTFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID+ VVGPE PL  G++D    AG KVFGPS++AA+LE SK  AK+  +KY IPTA Y
Sbjct: 61  EGIDMTVVGPEAPLTMGLADKFRVAGLKVFGPSRQAAELEGSKVMAKELMSKYNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
             F+D   A +Y++    P VVKADGL AGKGVVVA   + A +A+     D+ F Q   
Sbjct: 121 AKFTDAGSAIEYIKETGAPCVVKADGLAAGKGVVVARDEETAINAVRMMMEDKAFGQAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +IIEE LEG EVS  A  DGKT +P  +++DHKR+ D D GPNTGGMGA SPA   + E
Sbjct: 181 MIIIEECLEGEEVSILAFTDGKTVVPMVSSQDHKRVFDNDEGPNTGGMGAYSPAPVYTDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L+  V++KI+ PT++GM +E   ++GVL+AGLMIT+ GP ++E+NVRFGDPE QA++ RL
Sbjct: 241 LHRQVMEKILKPTVQGMAQEGRLYEGVLYAGLMITKDGPKVLEFNVRFGDPETQAVLTRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD++EI+ + +   LH  +I WK E A+ VV+A  GYP  Y  G  I+ +        +
Sbjct: 301 DSDLVEIMEAVIDKRLHEVNIRWKPEAAVCVVLAAGGYPGSYKKGDPITGLDDAAREAIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT + +  +  +GGRVL  TALG +I  + E AY  V  I + + ++R+DIG QK  
Sbjct: 361 FHAGTGLQDGRIVTSGGRVLGVTALGPSIPAAIENAYKAVGKIHFDNMHYRKDIG-QKAL 419

Query: 416 RNV 418
           R++
Sbjct: 420 RHL 422


>gi|163853271|ref|YP_001641314.1| phosphoribosylamine--glycine ligase [Methylobacterium extorquens
           PA1]
 gi|163664876|gb|ABY32243.1| phosphoribosylamine--glycine ligase [Methylobacterium extorquens
           PA1]
          Length = 435

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 277/428 (64%), Gaps = 8/428 (1%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQEK 61
           +LLIGSGGREHALAW IA+SPL + L+  PGNPG AQH +    + + +H+A++ FC+ +
Sbjct: 7   ILLIGSGGREHALAWAIAKSPLCTRLFIAPGNPGTAQHGENRPDLAVSDHAAVVAFCRAE 66

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            + LVVVGPE PLV G+ D L AAG   FGP++ AA+LE SK F K  C ++ IPTA + 
Sbjct: 67  GVGLVVVGPEAPLVAGLVDDLQAAGIPAFGPTKAAAQLEGSKGFTKDLCAEHDIPTAAFA 126

Query: 122 HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIE 180
            F+D   A  Y++ +  PIVVKADGL AGKGV VA T+ EA +A+           ++IE
Sbjct: 127 RFTDLEPALAYLRARGAPIVVKADGLAAGKGVTVAETLPEAEAAVRAILDGTEGGALVIE 186

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E L G E SFFALCDG  A+P  TA+DHKR+HDGD+GPNTGGMGA SPA  ++ ++  TV
Sbjct: 187 ECLFGEEASFFALCDGTRAVPIGTAQDHKRVHDGDLGPNTGGMGAYSPASIVTPKIAETV 246

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+ GM     PF G+L+AGLM+T +GP LIEYN RFGDPE Q +M RL  D++
Sbjct: 247 MTRIIAPTLAGMAARGTPFSGILYAGLMLTAEGPKLIEYNTRFGDPEAQVLMPRLTGDLV 306

Query: 301 EILNSCVHGNLHNTHINWKA-EYALTVVVATKGYPEEYPHGTIISKIPQNTG-----TTQ 354
             L +   G+L    I + A   ALTVV+A +GYP     GT I  +    G     T  
Sbjct: 307 PALLAAAQGDLSGVAIGFDASRAALTVVMAAQGYPGAVTRGTEIRGVEAAGGEAGDATVL 366

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT    + L A+GGRVL+ TALG ++ ++++ AY  V+ IDW  G++R DIG ++ 
Sbjct: 367 VFQAGTRRDGDRLLADGGRVLAVTALGASVGQAKDRAYAAVKRIDWPDGFFRSDIGGREV 426

Query: 415 ERNVKYRN 422
            R    + 
Sbjct: 427 AREAASKG 434


>gi|323136915|ref|ZP_08071995.1| phosphoribosylamine/glycine ligase [Methylocystis sp. ATCC 49242]
 gi|322397676|gb|EFY00198.1| phosphoribosylamine/glycine ligase [Methylocystis sp. ATCC 49242]
          Length = 432

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 279/423 (65%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHA+A  +A+SP L  L+  PGNPG A+    V +D  +H A++ FC+E
Sbjct: 1   MNVLLIGSGGREHAMANALAKSPRLRRLFIAPGNPGTARVGTNVDLDASDHGAVVRFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I LVVVGPE PL+ G+ DAL+ A    FGP++ AA+LE SK F K  C +  IPTA Y
Sbjct: 61  EGIALVVVGPEQPLIGGLVDALDRAEILAFGPTRAAAQLEGSKGFTKDMCREARIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
           + F D  KA  Y++ K  PIVVKADGL AGKGVVVA T+DEA  A+       F +  + 
Sbjct: 121 ERFDDKDKALAYLREKGAPIVVKADGLAAGKGVVVAMTLDEAERAVAAMFAGAFGKSGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEEYLEG E SFFA+CDG  A+PF TA+DHKR+ DGD GPNTGGMGA SPA  ++ E+
Sbjct: 181 VVIEEYLEGEEASFFAICDGVRALPFATAQDHKRVGDGDTGPNTGGMGAYSPASVVTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V+++II PT+  M +  +PF+GVL+AGLM+T+ GP LIEYN RFGDPE Q ++ R E
Sbjct: 241 EARVMREIIEPTMAAMSRMGSPFKGVLYAGLMLTKDGPKLIEYNNRFGDPEAQVILPRFE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTTQ 354
            D+L+++ +   G L +    +  + ALTVV+A K YP     G+ I  +   +      
Sbjct: 301 GDLLDLMIAAARGALPDALPRFSTQAALTVVLAAKNYPGAPMTGSEIRGVERAETMANVI 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           + HAGT      L A GGRVL+ TALG+ + +++E AY  V+ IDW  G++R DIG ++ 
Sbjct: 361 VTHAGTREEGGRLIAAGGRVLNVTALGENVAQAQERAYAAVDAIDWPGGFYRRDIGWREV 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|85709866|ref|ZP_01040931.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. NAP1]
 gi|85688576|gb|EAQ28580.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. NAP1]
          Length = 428

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 203/421 (48%), Positives = 276/421 (65%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWK+AQSP L +L++ PGNPGIA+ A+CV++D  +H A++ FC+ 
Sbjct: 1   MNVLLLGSGGREHALAWKLAQSPSLGKLFAAPGNPGIAEEAECVSLDASDHGAVVSFCRS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVV+GPE PLV+G++D+L AA    FGPS+ AA+LE SK F K  C +  IPT  Y
Sbjct: 61  HEIALVVIGPEAPLVDGLADSLAAADIPAFGPSKAAAQLEGSKGFTKDLCARAEIPTGGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
                  +A   +   S P V+KADGL AGKGVV++ T + A + +   F        + 
Sbjct: 121 VRTHSRDEAVAALDGFSAPFVLKADGLAAGKGVVISPTREHAEATLSDMFGGQFGSAGAQ 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E SFFA+ DG   IP  TA+DHK++ +GD G NTGGMGA SPA  +++ L
Sbjct: 181 VVIEEFLEGEEASFFAITDGTHVIPLGTAQDHKQVGEGDKGANTGGMGAYSPAPVLTEAL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+ +II PT++ M+ E  P+ GVL+AGLM+T  GP LIEYN RFGDPECQ +MMR +
Sbjct: 241 QQRVMDEIIRPTVDTMRSEGMPYSGVLYAGLMLTATGPQLIEYNCRFGDPECQVLMMRYQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
            D+  ++ +C  G L      +  E ALTVV+A KGYP     G  I+         ++F
Sbjct: 301 GDLAAMMLACAKGELEGAGAAFAQETALTVVMAAKGYPGTPQKGGAIALGDAEANGAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTAI + +L ANGGRVL+ TA G ++TE+++ AY  V  +D+  G++R DIG ++  R
Sbjct: 361 HAGTAIKDGSLVANGGRVLNVTATGASVTEAQKAAYDAVAKVDFASGFYRSDIGWKEVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|109896597|ref|YP_659852.1| phosphoribosylamine--glycine ligase [Pseudoalteromonas atlantica
           T6c]
 gi|109698878|gb|ABG38798.1| phosphoribosylamine--glycine ligase [Pseudoalteromonas atlantica
           T6c]
          Length = 427

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/425 (48%), Positives = 287/425 (67%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALA+K AQS  +S+++  PGN G A   +   VAID+++ SA++ F 
Sbjct: 1   MKVLIIGGGGREHALAYKAAQSNGVSQVYVAPGNAGTALEPKLENVAIDVEDISALVTFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  I L +VGPE+PLV G+ DA  A G  +FGPS+ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KQNAIALTIVGPEVPLVLGVVDAFQAEGLAIFGPSKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y+Q    PIV+KADGL AGKGV+VA T+DEA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLQQTGAPIVIKADGLAAGKGVIVAMTLDEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT++GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 DEIHRRVMDEVIYPTVQGMASEGNDYHGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MRL+SD++E++   V G L      +    A+ VV+A  GYP+ Y  G +IS + QN + 
Sbjct: 301 MRLQSDLVELVQLAVDGKLDQATAKFDPRAAVGVVLAAGGYPQAYKKGDVISGLNQNESD 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT  VN N+T NGGRVL ATALG+++TE+++ AY + ++I W   ++R+DI  
Sbjct: 361 VAKVFHAGTKDVNGNVTTNGGRVLCATALGESVTEAQQRAYELAKSISWNGMFYRDDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|56696230|ref|YP_166587.1| phosphoribosylamine--glycine ligase [Ruegeria pomeroyi DSS-3]
 gi|56677967|gb|AAV94633.1| phosphoribosylamine--glycine ligase [Ruegeria pomeroyi DSS-3]
          Length = 420

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 202/419 (48%), Positives = 276/419 (65%), Gaps = 12/419 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A+C  +DI +   +  F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIAECAELDIMDGGLVATFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AGF VFGPS  AA+LE+SKSF K+ C   G PTA Y
Sbjct: 61  NAIDFVIVGPEAPLAAGVADRLREAGFLVFGPSAAAARLEASKSFTKEICDAAGAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS--AIDR----CFQQIN 174
             F+    AK Y++ +  PIV+KADGL AGKGV+VA  +DEAT+  AID      F    
Sbjct: 121 ARFTQAGPAKDYIRAQGAPIVIKADGLAAGKGVIVA--MDEATALEAIDDMLGGAFGDAG 178

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           + V+IEE++EG E S F L DG+  +   TA+DHKR+ +GD GPNTGGMGA SPA  +S 
Sbjct: 179 AEVVIEEFMEGEEASLFVLVDGEEVLSIGTAQDHKRVGEGDTGPNTGGMGAYSPAPVLSA 238

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
           E+ +  +++I+ PT+  M +   PFQGVL+ GLMI +  P L+EYNVRFGDPECQ +M+R
Sbjct: 239 EVEARAMEEIVKPTMAEMARRGVPFQGVLYVGLMIKDGAPRLVEYNVRFGDPECQVLMLR 298

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTG 351
           L +  ++++++   G L    +NW  ++A+TVV+A  GYP  Y  G+ I     +P+++ 
Sbjct: 299 LGAQAMDLMHATAEGRLREARVNWAEDHAITVVMAANGYPGSYQKGSEIKGLDTLPEDS- 357

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
              +FHAGTA     + A GGRVL+ TA G ++ E+R+ AY MVE IDW  G++R DIG
Sbjct: 358 RNMVFHAGTAAREGAIVATGGRVLNVTARGDSLAEARDRAYAMVEAIDWPGGFYRRDIG 416


>gi|84686143|ref|ZP_01014038.1| phosphoribosylamine--glycine ligase [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84665670|gb|EAQ12145.1| phosphoribosylamine--glycine ligase [Rhodobacterales bacterium
           HTCC2654]
          Length = 420

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/416 (49%), Positives = 275/416 (66%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW + Q+P   +L   PGN GIA+ A+C  IDI++   ++ FC  
Sbjct: 1   MNILILGGGGREHALAWAVMQNPKCDKLIVAPGNAGIAEIAECAKIDIEDGEKVVDFCNV 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I  V++GPE PL  G++DAL AAG   FGPSQ AA+LE+SKSF K+ C     PTA Y
Sbjct: 61  NAITFVIIGPEAPLAAGVADALEAAGILAFGPSQAAARLEASKSFTKEVCDAASAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F++   AK Y++ +  PIVVKADGL AGKGV+VA   D A +AID  F        + 
Sbjct: 121 ARFTEADPAKAYIREQGAPIVVKADGLAAGKGVIVAMDEDTALAAIDDMFGGEFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF L DG+T +P  TA+DHKR+ DGD G NTGGMGA SPA  ++ E+
Sbjct: 181 VVIEEFMEGEEASFFILSDGETLLPIGTAQDHKRVGDGDTGLNTGGMGAYSPAPVLTDEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT+  M +   P++GVL+AGLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 AQKAMDEIIAPTMRVMAERGMPYKGVLYAGLMIENGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
           +  L+++ +C  G L    +NW  ++A+TVV+A  GYP  Y  G++IS + Q   T    
Sbjct: 301 AQALDLMIACAEGRLAGRSVNWADDHAMTVVMAANGYPGAYEKGSVISGLDQIEETSKQM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT  V+  +TANGGRVL+ TA G ++ E+R+ AY M++ IDW  G+ R DIG
Sbjct: 361 VFHAGTREVDGKITANGGRVLNVTARGDSLQEARDTAYAMIDQIDWPEGFNRSDIG 416


>gi|209966850|ref|YP_002299765.1| phosphoribosylamine--glycine ligase [Rhodospirillum centenum SW]
 gi|209960316|gb|ACJ00953.1| phosphoribosylamine--glycine ligase [Rhodospirillum centenum SW]
          Length = 430

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/430 (48%), Positives = 269/430 (62%), Gaps = 13/430 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL W IA SPL   LW  PGN GIAQ A+CV +   + + ++ F + 
Sbjct: 1   MKVLVVGSGGREHALCWAIAASPLCDRLWCAPGNAGIAQAAECVPVAADDVAGLVAFARA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PLV G+ D L   G K FGPSQ AA++E SK F K  C ++GIPTA Y
Sbjct: 61  NGVDFVVVGPEQPLVAGLVDRLTEVGIKAFGPSQAAAEIEGSKGFMKDLCARHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F D   AK +V+    PIVVKADGL AGKGVV+  TV EA +A+D       F    +
Sbjct: 121 GRFRDAAAAKAFVRRTGAPIVVKADGLAAGKGVVICQTVAEAEAAVDDVLVGGRFGTAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+L+G E SFFALCDG TA+P   A+DHKR  DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 ELVIEEFLDGEEASFFALCDGTTALPLAGAQDHKRAFDGDRGPNTGGMGAYSPAPVLTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-----EQGPYLIEYNVRFGDPECQA 290
           L   ++ +I+ P + GM  E  PF GVLFAG+M+      +  P L+E+N RFGDPECQ 
Sbjct: 241 LERRIMAEIVEPAVRGMAAEGRPFTGVLFAGIMVVPGPDGQPVPKLLEFNARFGDPECQV 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           +  RL SD+L  L +   G L +  + W+ E AL VV+A +GYP +Y  GT I  + +  
Sbjct: 301 ICRRLASDLLPALVAAADGQLDHVSLRWREEVALCVVMAAEGYPGDYVKGTEIRGLDRAA 360

Query: 351 GTTQ--LFHAGTA-IVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRE 407
                 +FHAGTA   +  + A GGRVL  TA  +TI +++  AY  V+ IDW  G+ R 
Sbjct: 361 EIEDAVVFHAGTARAADGRVLATGGRVLGVTASARTIIDAQRQAYAAVDLIDWPEGFCRR 420

Query: 408 DIGLQKKERN 417
           DIG +  ER 
Sbjct: 421 DIGWRALERT 430


>gi|254477088|ref|ZP_05090474.1| phosphoribosylamine--glycine ligase [Ruegeria sp. R11]
 gi|214031331|gb|EEB72166.1| phosphoribosylamine--glycine ligase [Ruegeria sp. R11]
          Length = 421

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 275/417 (65%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A C A DI++  A+ +F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIADCAAFDIEDGGAVANFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG  VFGPS+ AAKLE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIIGPEAPLAAGVADRLREAGLLVFGPSEAAAKLEASKSFTKEICDAANAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+    P VVKADGL AGKGV++A +  EA  AID  F          
Sbjct: 121 GHFTDAEAAKAHVRQHGAPTVVKADGLAAGKGVIIAMSEAEAIDAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   +A+DHKR+ +GD GPNTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLVDGENVLAIGSAQDHKRVGEGDTGPNTGGMGAYSPAPVLSAEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT++ M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EARAMEEIVKPTMKVMAERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++ +   G L    +NW  ++A+TVV+A  GYP  Y  G+ I     +P+++ + 
Sbjct: 301 AQALDLMQAAAEGRLGEAQVNWADDHAITVVMAAAGYPGSYEKGSEIKGLDTLPEDS-SN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT   +  + A GGRVL+ TA G T+ E+R+ AY MV+ +DW  G++R DIG
Sbjct: 360 MVFHAGTKAEDGKVLAVGGRVLNVTARGDTLQEARDRAYAMVDGVDWPQGFFRRDIG 416


>gi|240140678|ref|YP_002965158.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Methylobacterium extorquens AM1]
 gi|240010655|gb|ACS41881.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Methylobacterium extorquens AM1]
          Length = 435

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 275/428 (64%), Gaps = 8/428 (1%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQEK 61
           +LLIGSGGREHALAW IA+SPL + L   PGNPG AQH +    + + +H+A++ FC+ +
Sbjct: 7   ILLIGSGGREHALAWAIAKSPLCARLCIAPGNPGTAQHGENRPDLAVSDHAAVVAFCRAE 66

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            + LVVVGPE PLV G+ D L AAG   FGP++ AA+LE SK F K  C ++ IPTA + 
Sbjct: 67  GVGLVVVGPEAPLVAGLVDDLQAAGIPAFGPTKAAAQLEGSKGFTKDLCAEHDIPTAAFA 126

Query: 122 HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI-NSTVIIE 180
            F+D   A  Y++ +  PIVVKADGL AGKGV VA T+ EA +A+           ++IE
Sbjct: 127 RFTDLEPALAYLRERGAPIVVKADGLAAGKGVTVAETLPEAEAAVRAILDGTEGGALVIE 186

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E L G E SFFALCDG  A+P  TA+DHKR+HDGD+GPNTGGMGA SPA  ++ E+  TV
Sbjct: 187 ECLFGEEASFFALCDGTRAVPIGTAQDHKRVHDGDLGPNTGGMGAYSPASIVTPEITETV 246

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+ GM     PF G+L+AGLM+T +GP LIEYN RFGDPE Q +M RL  D++
Sbjct: 247 MTRIIAPTLAGMAARGTPFSGILYAGLMLTAEGPKLIEYNTRFGDPEAQVLMPRLTGDLV 306

Query: 301 EILNSCVHGNLHNTHINWKA-EYALTVVVATKGYPEEYPHGTIISKI-----PQNTGTTQ 354
             L +   G+L    I + A   ALTVV+A +GYP     GT I  +          T  
Sbjct: 307 PALLAAAQGDLSGVAIGFDASRAALTVVMAAQGYPGAVTRGTEIRGVEAAEDEAGDATVL 366

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT    + L A+GGRVL+ TALG ++ ++++ AY  V+ IDW  G++R DIG ++ 
Sbjct: 367 VFQAGTRRDGDRLLADGGRVLAVTALGASVGQAKDRAYAAVKRIDWPDGFFRSDIGGREV 426

Query: 415 ERNVKYRN 422
            R    + 
Sbjct: 427 AREAASKG 434


>gi|296445744|ref|ZP_06887697.1| phosphoribosylamine/glycine ligase [Methylosinus trichosporium
           OB3b]
 gi|296256724|gb|EFH03798.1| phosphoribosylamine/glycine ligase [Methylosinus trichosporium
           OB3b]
          Length = 694

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/417 (50%), Positives = 277/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHA+A  +A+SP L+ L+  PGNPG+A+  + VA+D  +H+++  FC E
Sbjct: 1   MNVLLIGSGGREHAIALTLARSPSLTRLYIAPGNPGMAEVGKIVALDAADHASVARFCAE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I LVVVGPE PLV+G++D L  AG  VFGPS+ AA+LE SK F K  C  + IPTA Y
Sbjct: 61  QDIGLVVVGPEQPLVDGLADVLRTAGVAVFGPSKAAARLEGSKGFVKDLCRAHAIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI----NST 176
             FSD   A  +V++   PIVVKADGL AGKGVVVA T++EA  A++  F        + 
Sbjct: 121 ARFSDKDAALAHVRSHGAPIVVKADGLAAGKGVVVAETLEEAERAVEAMFAGAFGASGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE LEG E+SFFA+CDG  A+PF +A+DHKR+ + D GPNTGGMGA SPA   + E+
Sbjct: 181 VVIEEKLEGEELSFFAICDGARALPFASAQDHKRVGESDTGPNTGGMGAYSPAPAATAEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + ++ +I+ PT+  M++   PF GVLFAGLM+T  GP LIE+NVRFGDPE QAM+ RLE
Sbjct: 241 EAQIMSRIVAPTLAAMREMGAPFSGVLFAGLMLTRDGPKLIEFNVRFGDPETQAMLPRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-- 354
            D+LE++ +   G L      +    ALTVV+A +GYP     GT I  + +  G  +  
Sbjct: 301 DDLLELMRAAAAGALPTRRPRFSPRVALTVVLAARGYPGTPLTGTEIRGL-ERAGALEGV 359

Query: 355 -LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            + HAGT      L A GGRVL+ TAL  T++E++  AY  V+ IDW  G+ R DIG
Sbjct: 360 VVTHAGTRRDGARLLAAGGRVLNVTALADTVSEAQRRAYAGVDAIDWPEGFCRRDIG 416


>gi|255570982|ref|XP_002526442.1| phosphoribosylamine-glycine ligase, putative [Ricinus communis]
 gi|223534222|gb|EEF35937.1| phosphoribosylamine-glycine ligase, putative [Ricinus communis]
          Length = 534

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 277/416 (66%), Gaps = 14/416 (3%)

Query: 11  REHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQEKHIDLVV 67
           REHAL + + +SP    ++  PGN GIA   +A C+  +DI + SA+I FC +  + LVV
Sbjct: 108 REHALCYALQRSPSCDAVFCAPGNAGIANSGNATCIPDLDISDSSAVISFCHKWGVGLVV 167

Query: 68  VGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPM 127
           VGPE PLV G+++ L   G   FGPS  AA LE SK+F K  C KY IPTA Y+ F+DP 
Sbjct: 168 VGPEAPLVAGLANDLVKVGIPTFGPSAEAAALEGSKNFMKSLCDKYKIPTAKYKTFTDPF 227

Query: 128 KAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQINSTVIIEEY 182
            AK+Y+Q +  PIV+KADGL AGKGV+VA T++EA  A+D       F      VI+EEY
Sbjct: 228 AAKEYIQAEGAPIVIKADGLAAGKGVIVAMTLEEANEAVDSMLVKGAFGSAGCRVIVEEY 287

Query: 183 LEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQ 242
           LEG E SFFAL DG+TAIP  +A+DHKR+ DGD G NTGGMGA SPA  +++EL S V++
Sbjct: 288 LEGEEASFFALVDGETAIPLESAQDHKRVGDGDTGSNTGGMGAYSPAPVLTRELQSIVME 347

Query: 243 KIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMMMRLESDIL 300
            II+PT++GM  E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M+RLESD+ 
Sbjct: 348 TIIIPTVKGMAAEGCKFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLMVRLESDLA 407

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG---TTQLFH 357
           ++L +   G L    +NW    A+ VV+A+KGYP  Y  GT+I  + +      T Q+FH
Sbjct: 408 QVLLAACRGELSGVSLNWSPGSAMVVVMASKGYPGSYEKGTVIGNLEEAENVAPTVQIFH 467

Query: 358 AGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           AGTA+  + N  A GGRVL  TA G+ + E+++ AY  VE I+W  G++R DIG +
Sbjct: 468 AGTALDADGNFIATGGRVLGVTAKGRDLQEAKDRAYQAVEEINWPGGFYRRDIGWR 523


>gi|220926367|ref|YP_002501669.1| phosphoribosylamine/glycine ligase [Methylobacterium nodulans ORS
           2060]
 gi|219950974|gb|ACL61366.1| phosphoribosylamine/glycine ligase [Methylobacterium nodulans ORS
           2060]
          Length = 423

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/425 (50%), Positives = 270/425 (63%), Gaps = 16/425 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNH--------S 52
           + +LLIGSGGREHALAWK+AQSP    L   PGNPG A H         NH        +
Sbjct: 6   LTILLIGSGGREHALAWKLAQSPACQRLLVAPGNPGTAAHGT-------NHPDLDVADAA 58

Query: 53  AIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTK 112
           A++ FC+ + +D VVVGPE PLV G+ DAL AAG   FGP+  AA+LE SK F K+ C +
Sbjct: 59  AVVAFCRREGVDFVVVGPEAPLVAGLVDALAAAGIPAFGPTAAAAQLEGSKGFTKELCAE 118

Query: 113 YGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ 172
           +GIPTA +  FS    A  Y++ +  PIVVKADGL AGKGVVVA T+ EA +A+      
Sbjct: 119 FGIPTAGFARFSAAEPALAYLRARGAPIVVKADGLAAGKGVVVAETLPEAEAAVASLLAA 178

Query: 173 INSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM 232
             + V+IEEYL G E SFFALCDG  A+ F TA+DHKR+HDGD GPNTGGMGA SPA  +
Sbjct: 179 PGAEVVIEEYLAGEEASFFALCDGTRAVAFGTAQDHKRVHDGDRGPNTGGMGAYSPAPIL 238

Query: 233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMM 292
           +  L + V+++II PT++G++    PF+G+L+AGLM+T +GP LIEYNVRFGDPECQ +M
Sbjct: 239 TPALEAEVMKRIIQPTLDGLRARGTPFRGILYAGLMLTPEGPKLIEYNVRFGDPECQVLM 298

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
            RL  D++  L +   G+L      W  + ALTVV+A  GYP     G+ I  I    G 
Sbjct: 299 PRLAGDLVPALLAASAGDLSGVAPAWSPQAALTVVMAAPGYPGPVARGSEIRGIGAAEGA 358

Query: 353 TQL-FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             L F AGT      L A+GGRVL+ TA G  I E++  AY  V  IDW  G++R DIG 
Sbjct: 359 GALVFQAGTRREGERLLADGGRVLAVTATGAGIAEAQTRAYAAVARIDWPEGFFRRDIGW 418

Query: 412 QKKER 416
           +   R
Sbjct: 419 RAVGR 423


>gi|83942804|ref|ZP_00955265.1| phosphoribosylamine--glycine ligase [Sulfitobacter sp. EE-36]
 gi|83846897|gb|EAP84773.1| phosphoribosylamine--glycine ligase [Sulfitobacter sp. EE-36]
          Length = 421

 Score =  415 bits (1067), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 202/419 (48%), Positives = 279/419 (66%), Gaps = 8/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P   +L   PGN GIA  A C + DI + +A++ F  E
Sbjct: 1   MNILILGSGGREHSLAWAVLQNPKCDKLIVAPGNAGIAAIADCASFDINDGAAVVGFVDE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +ID V++GPE PL  G+ D L AAG  VFGPS+ AA LE+SK+F K+ C     PTA Y
Sbjct: 61  NNIDFVIIGPEAPLAAGVGDDLRAAGVLVFGPSKAAAALEASKAFTKEICDAANAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ Y+ +   PIV+KADGL AGKGV++A T  EA +A+D  F        + 
Sbjct: 121 GHFTDADAARAYLADHPAPIVIKADGLAAGKGVIIAETDAEALAAVDTMFDGTFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF LCDG T +P  TA+DHKR+ DGD GPNTGGMGA SPA  ++ E+
Sbjct: 181 VVIEEFMDGEEASFFVLCDGDTVLPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLTDEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT+  M K   P+QGVL+AGLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 241 AERALAEIIRPTMAEMAKRGTPYQGVLYAGLMIKDGAPRLVEYNARFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +   +++++   G L+   +NW  ++A+TVV+A +GYP  Y  G++I     +P+++   
Sbjct: 301 AQAFDLMHAAAEGRLNEARVNWADDHAVTVVMAAQGYPGSYDKGSVIKGLDALPEDS-RN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAGTA  +  +TA GGRVL+ TA G T+ E++  AY MVE IDW  G++R DIG +
Sbjct: 360 MVFHAGTAKKDGAITAIGGRVLNVTARGDTLAEAQARAYEMVEAIDWPGGFYRRDIGWR 418


>gi|148556053|ref|YP_001263635.1| phosphoribosylamine--glycine ligase [Sphingomonas wittichii RW1]
 gi|148501243|gb|ABQ69497.1| phosphoribosylamine--glycine ligase [Sphingomonas wittichii RW1]
          Length = 433

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/426 (48%), Positives = 283/426 (66%), Gaps = 8/426 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWK++QS  L++L++ PGNPGIAQHA+CV +D  +  +++ F +E
Sbjct: 1   MIILLLGSGGREHALAWKLSQSERLTKLFAAPGNPGIAQHAECVDLDPTHVESVVAFARE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +++ LVV+GPE PLV G++D L   G   FGP+Q AA+LE SK F K  C +  IPTA Y
Sbjct: 61  ENVGLVVIGPEAPLVAGLADRLRENGILTFGPNQAAAQLEGSKGFTKDLCQRENIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
             F     AK  + +  +P+V+KADGL AGKGVV+A +  +A +AID  F     T    
Sbjct: 121 GRFGGAGSAKAALDSFGVPVVIKADGLAAGKGVVIAESRAQAENAIDDMFGGTFGTAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+L G E SFFAL DG T +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL
Sbjct: 181 VVIEEFLTGEEASFFALTDGTTVVPFGSAQDHKRVGDGDTGPNTGGMGAYSPAPVLTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M     P+ GVL+AGLM+T +GP LIEYN RFGDPECQ +M+RLE
Sbjct: 241 EARTMREIVEPTVRAMAAAGIPYSGVLYAGLMLTAEGPKLIEYNARFGDPECQVLMLRLE 300

Query: 297 SDILEILNSCVHGNLHN-THINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQ 354
            D++ ++ +   G L      +     ALTVV+A KGYP     G  I  I +      +
Sbjct: 301 DDLVTLMLAVAEGRLAELARPSLSPNTALTVVMAAKGYPGTPAKGGAIRNIVEAEAKGAK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK- 413
           +FHAGTA     L ANGGRVL+ TA+G+ I E+R+ AY  V+ +D+  G+ R DIG ++ 
Sbjct: 361 VFHAGTAEGPGGLVANGGRVLNVTAIGQDIGEARDSAYAAVDALDFASGFCRRDIGWREL 420

Query: 414 -KERNV 418
            ++RNV
Sbjct: 421 ARQRNV 426


>gi|258624507|ref|ZP_05719451.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM603]
 gi|258583204|gb|EEW08009.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM603]
          Length = 429

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/425 (47%), Positives = 279/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V+I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVSIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q T 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQETA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I+W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQINWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|332799034|ref|YP_004460533.1| phosphoribosylamine--glycine ligase [Tepidanaerobacter sp. Re1]
 gi|332696769|gb|AEE91226.1| Phosphoribosylamine--glycine ligase [Tepidanaerobacter sp. Re1]
          Length = 417

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 271/417 (64%), Gaps = 6/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREH L WK+AQSP +  ++S PGNPGI   A CV I + + + +  F ++
Sbjct: 1   MKVLVVGGGGREHTLVWKLAQSPRVDRIYSAPGNPGIKNLATCVDISVNDINRLADFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +IDL +VGPE PLV GI D   + G  +FGPS+ AA++E SK F+K    KY IPTA Y
Sbjct: 61  NNIDLTIVGPEAPLVAGIVDEFESRGLGIFGPSKAAAQIEGSKVFSKDLMKKYKIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
           + F     A  Y+    MP+VVKA+GL AGKGV++A   D A  A     IDR F +  S
Sbjct: 121 RVFERAQDAADYINTAQMPLVVKAEGLAAGKGVIIAHDRDTAKEAVKSIMIDRAFGESGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEEYLEG EV+  A CDGK A+P  ++RDHKR+ D + GPNTGGMGA SPA   + E
Sbjct: 181 RIVIEEYLEGPEVTVLAFCDGKVAVPMVSSRDHKRVFDNNEGPNTGGMGAVSPAPAYTLE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L  TV   II  T++ M  E  PF+G+L+ GLM+T+ GP ++EYN RFGDPE Q ++ RL
Sbjct: 241 LAKTVEHDIIQRTVDAMASEGIPFKGILYTGLMLTKSGPKVLEYNCRFGDPETQVVIPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTGTTQ 354
           ++D+++I+ S ++GNL NT I WK E A+ VV+A+ GYP  Y  G  I  +       + 
Sbjct: 301 KTDLVDIVESVINGNLLNTKIEWKQEAAVCVVIASGGYPGSYETGKPIRGLADAEKNGSI 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           +FHAGTA+ N  +   GGRVL  TALGK + ++REL Y  V  I +   ++R+DIGL
Sbjct: 361 VFHAGTALKNGEIVTAGGRVLGVTALGKDVQDARELVYKSVSKIYFDGMHYRKDIGL 417


>gi|296532675|ref|ZP_06895370.1| phosphoribosylamine-glycine ligase [Roseomonas cervicalis ATCC
           49957]
 gi|296266997|gb|EFH12927.1| phosphoribosylamine-glycine ligase [Roseomonas cervicalis ATCC
           49957]
          Length = 425

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/420 (50%), Positives = 281/420 (66%), Gaps = 8/420 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLL+G GGREHALAW ++ S LLS+LW  PGN GI+  A CVAI  ++  A++ F ++
Sbjct: 1   MKVLLVGGGGREHALAWALSGSGLLSKLWVAPGNAGISDIADCVAIGAEDVPALVAFAKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +DLVV GPE PL  G++DA  AAG + FGPS  AA+LE SK+F ++  T  G+P A +
Sbjct: 61  QAVDLVVAGPEAPLTLGLADACAAAGIRCFGPSAAAARLEGSKAFTREVATAAGVPGAEW 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
             F++   A+ YV+ K  PIVVKADGL AGKGVVVAATV+EA  AI     DR      +
Sbjct: 121 AQFTEAAAARAYVRQKGAPIVVKADGLAAGKGVVVAATVEEAEQAITEIMEDRVHGAAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           +++IEE L G E+SFFALCDG+TA+P   A+DHKR+ DGD GPNTGGMGA SP    +  
Sbjct: 181 SILIEECLVGQEISFFALCDGETALPMAAAQDHKRVGDGDTGPNTGGMGAYSPPPAFTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V+ +II PT++ M +   PF+GVLFAGLM+T  GP LIEYNVRFGDPECQ +M+RL
Sbjct: 241 LEAEVMDRIIRPTLKEMARRGTPFRGVLFAGLMLTGSGPRLIEYNVRFGDPECQVLMLRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           +SD+L  L +   G L    + W  E A+ VV+A KGYP  Y  G++I  + +       
Sbjct: 301 QSDLLAALLAACDGELDRFTLRWSKEAAMVVVMAAKGYPGAYAKGSVIEGLERAAQVPGA 360

Query: 354 QLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           Q+FHAGTA   + +L A GGRVL   A G T+  +R+ AY  V+ ++W  G+ R DIG +
Sbjct: 361 QIFHAGTARDEHGHLVATGGRVLGIAATGATLRAARDAAYAAVDAVEWPGGFCRRDIGWR 420


>gi|259416666|ref|ZP_05740586.1| phosphoribosylamine--glycine ligase [Silicibacter sp. TrichCH4B]
 gi|259348105|gb|EEW59882.1| phosphoribosylamine--glycine ligase [Silicibacter sp. TrichCH4B]
          Length = 420

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 277/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P    L   PGN GIA+ A C +++ ++  A++ F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDRLIVAPGNAGIAKIADCASLNAEDGGAVVTFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AG  VFGPS+ AA+LE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIVGPEAPLAAGVADRLRDAGILVFGPSEAAARLEASKSFTKEICDAANAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+    PIVVKADGL AGKGV+VA     A  AID  F          
Sbjct: 121 GHFTDAEAAKAHVRANGAPIVVKADGLAAGKGVIVAMDEQTALDAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F LCDG+  +   TA+DHKR+ +GD G NTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLCDGEKILSIGTAQDHKRVGEGDTGLNTGGMGAYSPAPILSAEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EAKAMEEIVKPTMRVMAERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++++   G L +  +NW  ++A+TVV+A  GYP +Y  G+ I   + +P+++   
Sbjct: 301 AQALDLMHAAAEGRLADARVNWAEDHAITVVMAANGYPGDYQKGSEIKGLAALPEDS-MN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT    + + ANGGRVL+ TA G+++TE+R+ AY MV+ IDW  G+ R DIG
Sbjct: 360 MVFHAGTKAEGDKILANGGRVLNVTARGESLTEARDRAYAMVDQIDWPEGFVRRDIG 416


>gi|262404999|ref|ZP_06081551.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC586]
 gi|262348838|gb|EEY97979.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC586]
          Length = 429

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/425 (47%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V+I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVSIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q T 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPSDYAKGDVISGLPTQETA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    N +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGNQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|83955627|ref|ZP_00964207.1| phosphoribosylamine--glycine ligase [Sulfitobacter sp. NAS-14.1]
 gi|83839921|gb|EAP79097.1| phosphoribosylamine--glycine ligase [Sulfitobacter sp. NAS-14.1]
          Length = 421

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/419 (47%), Positives = 280/419 (66%), Gaps = 8/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P   +L   PGN GIA  A C + DI + +A++ F  E
Sbjct: 1   MNILILGSGGREHSLAWAVLQNPKCDKLIVAPGNAGIAAIADCASFDINDGAAVVGFVDE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +ID V++GPE PL  G+ D L AAG  VFGPS+ AA LE+SK+F K+ C     PTA Y
Sbjct: 61  NNIDFVIIGPEAPLAAGVGDDLRAAGVLVFGPSKAAAALEASKAFTKEICDAANAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ Y+ +   PIV+KADGL AGKGV++A T  +A +A+D  F        + 
Sbjct: 121 GHFTDAEAARAYLADHPAPIVIKADGLAAGKGVIIAETDTQALAAVDTMFDGTFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF LCDG T +P  TA+DHKR+ DGD GPNTGGMGA SPA  ++ E+
Sbjct: 181 VVIEEFMDGEEASFFVLCDGDTVLPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLTDEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT+  M K   P+QGVL+AGLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 241 AERALAEIIRPTMAEMAKRGTPYQGVLYAGLMIKDGAPRLVEYNARFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +   +++++   G L+   +NW  ++A+T+V+A +GYP  Y  G++I   + +P+++   
Sbjct: 301 AQAFDLMHAAAEGRLNEARVNWADDHAVTIVMAAQGYPGSYDKGSVIKGLNALPEDS-RN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAGTA  +  +TA GGRVL+ TA G T+ E++  AY MVE IDW  G++R DIG +
Sbjct: 360 MVFHAGTAKKDGAITAIGGRVLNVTARGDTLAEAQARAYEMVEAIDWPGGFYRRDIGWR 418


>gi|254462262|ref|ZP_05075678.1| phosphoribosylamine--glycine ligase [Rhodobacterales bacterium
           HTCC2083]
 gi|206678851|gb|EDZ43338.1| phosphoribosylamine--glycine ligase [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 420

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 274/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW + Q+P   +L   PGN GIA+ A C A DI++ +A+I F Q 
Sbjct: 1   MNILILGGGGREHALAWAVMQNPKCDKLIVAPGNAGIAKIATCAAFDIEDSAAVIEFAQN 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +D V++GPE PL  G+SD L  AGF VFGPS+ AA+LE+SK+F K+ C      TA Y
Sbjct: 61  ESVDFVIIGPEAPLAAGVSDDLINAGFLVFGPSKEAAQLEASKAFTKEICDAANAATAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK Y+     PIVVKADGL AGKGVVVA  +DEA +A+D  F          
Sbjct: 121 GHFTDAESAKAYILKNGAPIVVKADGLAAGKGVVVAMDLDEALAAVDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDG   +P  TA+DHKR+ +GD GPNTGGMGA SPA  +++ +
Sbjct: 181 VVIEEFMEGEEASFFVLCDGINVLPIGTAQDHKRVGEGDTGPNTGGMGAYSPAPVLTEAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ P +  M +   P+QGVL+AGLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 241 AERALDEIVKPCMAEMARRGTPYQGVLYAGLMIKDGAPRLVEYNARFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
             IL++L +    +L +  +NW  ++A+TVV+A  GYP  Y +G++I+ +    +     
Sbjct: 301 GQILDLLLATAEESLADAQVNWANDHAMTVVMAANGYPSAYENGSVINGLDALSDDSFNV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA  +    A GGRVL+ T+ G+++ ++ + AY  V++I+W  G++R DIG
Sbjct: 361 VFHAGTAKKDGQTIAAGGRVLNVTSRGESLADAHQRAYAAVDSIEWPEGFFRRDIG 416


>gi|99081787|ref|YP_613941.1| phosphoribosylamine--glycine ligase [Ruegeria sp. TM1040]
 gi|99038067|gb|ABF64679.1| phosphoribosylamine--glycine ligase [Ruegeria sp. TM1040]
          Length = 420

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 274/417 (65%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P    L   PGN GIAQ A C +++ ++  A++ F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDRLIVAPGNAGIAQIADCASLNAEDGGAVVTFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AG  VFGPS+ AA+LE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIVGPEAPLAAGVADRLRDAGILVFGPSEAAARLEASKSFTKEICDAANAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+    PIVVKADGL AGKGV+VA     A  AID  F          
Sbjct: 121 GHFTDAEAAKAHVRANGAPIVVKADGLAAGKGVIVAMDEQTALDAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F LCDG+  +   TA+DHKR+ +GD G NTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLCDGEEILSIGTAQDHKRVGEGDTGLNTGGMGAYSPAPVLSAEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EAKAMEEIVKPTMRVMAERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++ +   G L +  +NW  ++A+TVV+A  GYP  Y  G+ I     +P+++   
Sbjct: 301 AQALDLMQAAAEGRLADARVNWADDHAITVVMAAAGYPGSYEKGSEIKGLDALPEDS-MN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT    + + ANGGRVL+ TA G++++E+R+ AY MV+ IDW  G+ R DIG
Sbjct: 360 MVFHAGTKADGDKILANGGRVLNVTARGESLSEARDRAYAMVDQIDWPEGFVRRDIG 416


>gi|302390048|ref|YP_003825869.1| phosphoribosylamine--glycine ligase [Thermosediminibacter oceani
           DSM 16646]
 gi|302200676|gb|ADL08246.1| phosphoribosylamine--glycine ligase [Thermosediminibacter oceani
           DSM 16646]
          Length = 417

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 200/417 (47%), Positives = 278/417 (66%), Gaps = 6/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHAL WKIAQSP + +++ +PGN GIA  AQCV I  ++   +  F Q+
Sbjct: 1   MKVLVVGGGGREHALVWKIAQSPRVKKIFCLPGNAGIAALAQCVDIKAEDVKGLAGFAQK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PLV GI D     G ++FGPS+ AA++E SK FAK+   KYGIPTA Y
Sbjct: 61  QGIDLTVVGPEAPLVAGIVDEFEKRGLRIFGPSKAAARIEGSKVFAKELMKKYGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
           + F DP +A +Y++    P+V+KA+GL AGKGV+VA   +EA  A+     D  F     
Sbjct: 121 RVFDDPEEAGRYIREAETPLVIKAEGLAAGKGVMVAREREEALDAVKSIMKDGIFGDSGR 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG EV+  A CDG TA+P   +RD+KR +D D GPNTGGMGA SPA   + +
Sbjct: 181 RVVIEEFLEGREVTVLAFCDGVTAVPMECSRDYKRAYDKDRGPNTGGMGAVSPAHYYTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V + II  T+E M+ E  PF+GVL+AGLM+T +GP ++E+N RFGDPE Q ++ RL
Sbjct: 241 VSEYVNKNIIQKTLEAMRLEGIPFKGVLYAGLMLTSKGPKVLEFNCRFGDPETQVVVPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQ 354
           ++D+++++ + + G L   +INW  E A+ VV+A+ GYP +Y  G  I+ I    G    
Sbjct: 301 KTDLVDVIEAVIEGRLSECNINWTGEKAVCVVLASAGYPGDYEKGKEIAGIEDAEGEGAM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           +FHAGTA+ +  +   GGRVL  TALG+T  E+RE+AY  V  I +   ++R+DIGL
Sbjct: 361 VFHAGTALKDGKIITAGGRVLGVTALGRTEEEAREIAYRAVSRIRFDGMHYRKDIGL 417


>gi|154245359|ref|YP_001416317.1| phosphoribosylamine--glycine ligase [Xanthobacter autotrophicus
           Py2]
 gi|154159444|gb|ABS66660.1| phosphoribosylamine--glycine ligase [Xanthobacter autotrophicus
           Py2]
          Length = 422

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/422 (47%), Positives = 273/422 (64%), Gaps = 3/422 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCV-AIDIQNHSAIIHFCQ 59
           M +LL+GSGGREHALAWK+AQSP + + ++IPGNPGIA+HA+ +  I +  H  I+ +CQ
Sbjct: 1   MNILLLGSGGREHALAWKLAQSPSMGQFYAIPGNPGIAEHAELIEGIPLSAHDTIVKWCQ 60

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  ID VVVGPE PLV G+ D L A G   FGP+  AA+LE SK F K+ C    IPTA 
Sbjct: 61  DHGIDFVVVGPEAPLVAGLVDRLEAVGIPAFGPTAAAARLEGSKLFTKELCKANSIPTAA 120

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII 179
           +  F+   +   YV+ +  PIVVKADGL AGKGVVVA + +EA  A+++ F    + V+I
Sbjct: 121 FGRFTSAAEGAAYVRQQGAPIVVKADGLMAGKGVVVALSEEEAVDAVEQVFAGGGTEVLI 180

Query: 180 EEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYST 239
           EE++EG E S FAL DG+T + F +A+DHKR  DGD+GPNTGGMGA SPA  ++ EL   
Sbjct: 181 EEFMEGEEASLFALVDGETVVLFGSAQDHKRAFDGDLGPNTGGMGAYSPAPVLTPELERR 240

Query: 240 VIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDI 299
            + +I++PT   M     P++GVL+AGLM+T  GP L+EYN RFGDPECQ +M R + D+
Sbjct: 241 ALDEILIPTARAMVAAGAPYRGVLYAGLMLTADGPKLVEYNCRFGDPECQVLMPRFKGDL 300

Query: 300 LEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTTQLFH 357
           +++L++   G L      W  + A+TVV A++GYP  +  G+ I  I          +F 
Sbjct: 301 VQVLHATATGQLAQVTPEWSQDAAMTVVYASRGYPGPHQVGSPIGGIEAAAELDGVLVFQ 360

Query: 358 AGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           AGT      L +NGGRVL+ TA G T+ E+R+ AY  +  IDW  G++R DIG +   + 
Sbjct: 361 AGTRRKGVALVSNGGRVLNVTATGATLGEARDRAYAGIARIDWPDGFYRSDIGWRALGKG 420

Query: 418 VK 419
            +
Sbjct: 421 AR 422


>gi|294013433|ref|YP_003546893.1| phosphoribosylamine-glycine ligase [Sphingobium japonicum UT26S]
 gi|292676763|dbj|BAI98281.1| phosphoribosylamine-glycine ligase [Sphingobium japonicum UT26S]
          Length = 430

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 280/427 (65%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+G GGREHALAWK+AQSP L+ L++ PGNPGIAQHA  V +D  +H A++ FC  
Sbjct: 4   MNILLLGGGGREHALAWKLAQSPALATLYAAPGNPGIAQHATLVDLDATDHRAVVDFCLR 63

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVV+GPE PLV+G++D L   G+ VFGP ++AA+LE SK F K  C +  IPTA Y
Sbjct: 64  HSIGLVVIGPEAPLVDGLADNLRVKGYPVFGPGKKAAQLEGSKGFTKDLCKRANIPTAAY 123

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
           +  +    A   + + ++P+V+KADGL AGKGV++A T ++A  AI+  F        + 
Sbjct: 124 ERVASKDGAIAALDDFALPVVIKADGLAAGKGVIIAETREQAVEAIEDMFSGAFGSAGAE 183

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFFAL DG   +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL
Sbjct: 184 VVLEEFMIGEEASFFALTDGSAILPFGSAQDHKRVGDGDTGPNTGGMGAYSPARVLTPEL 243

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + VI+KI+ PT++ +  E  P+ GVL+AGLM+T++GP LIEYN RFGDPECQ +MMR +
Sbjct: 244 EAEVIEKIVRPTVDTLAAEGTPYSGVLYAGLMLTDEGPKLIEYNARFGDPECQVLMMRFD 303

Query: 297 SDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKI-PQNTGTTQ 354
            D++E+L +   G L     +      ALTVV+A  GYP     G  I+ I        +
Sbjct: 304 GDLVELLLAVAEGRLAGQGPVRLAERAALTVVMAANGYPGVPDKGGAITGIDAAEAAGAR 363

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  +  + ANGGRVL+ TA G T+  +++ AY  V+ I +  G+ R DIG ++ 
Sbjct: 364 VFHAGTADKDGAIVANGGRVLNVTATGDTVKAAQQAAYKAVDAIGFPTGFCRRDIGWREV 423

Query: 415 ERNVKYR 421
            R  + R
Sbjct: 424 AREEEAR 430


>gi|317052608|ref|YP_004113724.1| phosphoribosylamine/glycine ligase [Desulfurispirillum indicum S5]
 gi|316947692|gb|ADU67168.1| phosphoribosylamine/glycine ligase [Desulfurispirillum indicum S5]
          Length = 423

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 273/417 (65%), Gaps = 7/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHAL WKI+QSP +  ++  PGNPGIA  AQCV I + +  ++  F ++
Sbjct: 1   MNILVVGGGGREHALVWKISQSPRVENIYCAPGNPGIATIAQCVDIAVDDLHSLASFARD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            HIDL VVGPELPL  GI D   + G K FGPSQ AA+LE SK++ K    KYG+PTA +
Sbjct: 61  THIDLTVVGPELPLTLGIVDFFESCGLKAFGPSQGAAELEGSKAYCKMIMDKYGVPTAQH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
           + F+D   A+ YVQ K  PIVVKA GL AGKGV VA TV+EA  AI     D+ F     
Sbjct: 121 RTFTDAASARAYVQEKGAPIVVKASGLAAGKGVTVAFTVEEALEAIAHIMEDKVFGTSGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L G E S  A CDGKTA+    A+DHK++++GD GPNTGGMGA SPA  ++ E
Sbjct: 181 EVVIEDFLAGEEASLLAFCDGKTAVAMVPAQDHKQVYEGDRGPNTGGMGAYSPAPILTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ ++ P I+GM +E  PF+G+L+ GLMI +    ++E+NVRFGDPE Q ++MRL
Sbjct: 241 LQQEAMRTVMQPMIDGMAREGRPFKGILYGGLMIDQGRIQVLEFNVRFGDPEAQPVLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           +SDI+EI+ +CV G LH T I W  +  + VV+A+ GYP EY  G  IS + +       
Sbjct: 301 KSDIVEIMLACVEGRLHETTIEWHDDPTICVVMASGGYPAEYTRGFPISGLDRAAAVEDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGTA  +  +  +GGRVL  TA G T+ ++ + AY   + I W+  Y+R DIG
Sbjct: 361 MVFHAGTAEKDGQIVNSGGRVLGVTAKGNTLQQAIDRAYAATDCIHWEGAYFRRDIG 417


>gi|262172620|ref|ZP_06040298.1| phosphoribosylamine--glycine ligase [Vibrio mimicus MB-451]
 gi|261893696|gb|EEY39682.1| phosphoribosylamine--glycine ligase [Vibrio mimicus MB-451]
          Length = 429

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 202/425 (47%), Positives = 280/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAVEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L+     W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLNQVESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   ++ +  NGGRVL ATALG T+ E+++ AY + + I+W   + R DIG 
Sbjct: 361 GQKVFHAGTETKDSQVVTNGGRVLCATALGNTVLEAQQRAYQLADQINWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|254488045|ref|ZP_05101250.1| phosphoribosylamine--glycine ligase [Roseobacter sp. GAI101]
 gi|214044914|gb|EEB85552.1| phosphoribosylamine--glycine ligase [Roseobacter sp. GAI101]
          Length = 421

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/417 (47%), Positives = 277/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P   +L   PGN GIA  A C   DI N +A++ F  E
Sbjct: 1   MNILILGSGGREHSLAWAVLQNPKCDKLIVAPGNAGIAAIADCATFDINNGAAVVEFVAE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +ID V++GPE PL  G++D L AAG   FGPS+ AA LE+SK+F K+ C     PTA Y
Sbjct: 61  NNIDFVIIGPEAPLAAGVADDLRAAGVLTFGPSKAAAALEASKAFTKEICDAANAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
            HF+D   A+ Y+ +   PIV+KADGL AGKGV++A T  EA +A+D  F        + 
Sbjct: 121 GHFTDAASARAYLADHPAPIVIKADGLAAGKGVIIAETDAEALAAVDTMFDGTFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF LCDG T +P  TA+DHKR+ DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEEFMDGEEASFFVLCDGDTVLPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLTDAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT+  M +   P+QGVL+AGLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 241 AERALDEIIRPTMAEMAERGMPYQGVLYAGLMIKDGAPRLVEYNARFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           + + ++L++   G L    +NW  ++A+TVV+A  GYP +Y  G++I     +P+++   
Sbjct: 301 AQLFDLLHATAEGRLSEMRVNWAEDHAVTVVMAALGYPGDYAKGSVIGGLDDLPEDS-RN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGTA  +  + ANGGRVL+ TA G+++ E++  AY MV+ IDW  G++R DIG
Sbjct: 360 MVFHAGTAQQDGQIVANGGRVLNVTARGESLAEAQARAYRMVDAIDWPGGFFRRDIG 416


>gi|15218286|ref|NP_172454.1| phosphoribosylamine--glycine ligase (PUR2) [Arabidopsis thaliana]
 gi|12644306|sp|P52420|PUR2_ARATH RecName: Full=Phosphoribosylamine--glycine ligase, chloroplastic;
           AltName: Full=Glycinamide ribonucleotide synthetase;
           Short=GARS; AltName: Full=Phosphoribosylglycinamide
           synthetase; Flags: Precursor
 gi|2160174|gb|AAB60737.1| Identical to A. thaliana PUR2 (gb|X74766). ESTs
           gb|ATTS3927,gb|N96446 come from this gene [Arabidopsis
           thaliana]
 gi|15292773|gb|AAK92755.1| putative phosphoribosylglycinamide synthetase [Arabidopsis
           thaliana]
 gi|20259251|gb|AAM14361.1| putative phosphoribosylglycinamide synthetase [Arabidopsis
           thaliana]
 gi|332190379|gb|AEE28500.1| phosphoribosylamine--glycine ligase [Arabidopsis thaliana]
          Length = 532

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/424 (49%), Positives = 279/424 (65%), Gaps = 14/424 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHF 57
           + VL+IG GGREHAL   + +SP    +   PGN GI+    A CV  +DI +  A+I F
Sbjct: 95  VNVLVIGGGGREHALCHALKRSPSCDSVLCAPGNAGISSSGDATCVPDLDISDSLAVISF 154

Query: 58  CQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT 117
           CQ+ ++ LVVVGPE+PLV G+++ L  AG   FGPS +AA LE SK+F K  C KY IPT
Sbjct: 155 CQKWNVGLVVVGPEVPLVAGLANDLVKAGILTFGPSSQAAALEGSKNFMKNLCHKYNIPT 214

Query: 118 ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQ 172
           A Y+ FSD   AK+Y+Q +  PIV+KADGL AGKGV VA  ++EA  A+D       F  
Sbjct: 215 AKYKTFSDASAAKEYIQEQGAPIVIKADGLAAGKGVTVAMELEEAFEAVDSMLVKGVFGS 274

Query: 173 INSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM 232
               V++EE+LEG E SFFAL DG+ AIP  +A+DHKR+ DGD GPNTGGMGA SPA  +
Sbjct: 275 AGCQVVVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPVL 334

Query: 233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQA 290
           ++EL   V++ II PT++GM +E   F GVLFAGLMI ++   P LIE+NVRFGDPECQ 
Sbjct: 335 TKELQDFVMESIIHPTVKGMAEEGCKFVGVLFAGLMIEKKSGLPKLIEFNVRFGDPECQV 394

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           +MMRLESD+ ++L +   G L    ++W  + A+ VV+A+ GYP  Y  G+II  + +  
Sbjct: 395 LMMRLESDLAKVLLAACKGELSGVSLDWSKDSAMVVVMASNGYPGSYEKGSIIKNLEEAE 454

Query: 351 GT---TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
                 ++FHAGT +    N+ A GGRVL  TA GK + E+RE AY  V+ I+W  G++R
Sbjct: 455 RVAPGVKVFHAGTGLDSEGNVVATGGRVLGVTAKGKDLEEARERAYSAVQQINWPGGFFR 514

Query: 407 EDIG 410
            DIG
Sbjct: 515 HDIG 518


>gi|86136620|ref|ZP_01055199.1| phosphoribosylamine--glycine ligase [Roseobacter sp. MED193]
 gi|85827494|gb|EAQ47690.1| phosphoribosylamine--glycine ligase [Roseobacter sp. MED193]
          Length = 425

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 271/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           + +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A+C  +DI + +A+  F +E
Sbjct: 5   LNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIAECADLDIMDGAAVTIFVEE 64

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I  V++GPE PL  G++D L  AG  VFGPS+ AA+LE+SKSF K+ C     PTA Y
Sbjct: 65  NAIGFVIIGPEAPLAAGVADRLREAGVLVFGPSEAAARLEASKSFTKEVCDAAQAPTAGY 124

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +++    P VVKADGL AGKGV++A T +EA +AID  F          
Sbjct: 125 GHFTDAEAAKAHIRQHGAPTVVKADGLAAGKGVIIAMTEEEALAAIDDMFGGAFGGAGAE 184

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   +A+DHKR+ +GD GPNTGGMGA SPA  ++ E+
Sbjct: 185 VVIEEFMEGEEASLFVLVDGEDVLSIGSAQDHKRVGEGDTGPNTGGMGAYSPAPVLTAEI 244

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT++ M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 245 EAKAMEEIVKPTMKVMVERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 304

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           +  L+++ +   G L     NW  ++A+TVV+A KGYP  Y  GT+I  +   Q   +  
Sbjct: 305 AQALDLMQASAEGRLAEAQANWGDDHAITVVMAAKGYPGSYEKGTVIRGLDALQEDSSNM 364

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA  +    A GGRVL+ TA G  + E+R+ AY M E IDW  G+ R DIG
Sbjct: 365 VFHAGTATKDGKTLATGGRVLNVTARGSNLKEARDRAYSMAEQIDWPQGFLRHDIG 420


>gi|332560277|ref|ZP_08414599.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides WS8N]
 gi|332277989|gb|EGJ23304.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides WS8N]
          Length = 426

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/416 (49%), Positives = 270/416 (64%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW I Q+P    L   PGN GIAQ A+C  +DI + +A++ FC+ 
Sbjct: 7   MNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIAQIAECADLDILDGAAVVAFCEA 66

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  G++DA  AAG   FGPSQ AA+LE+SK F K+ C   G PTA Y
Sbjct: 67  NSVDFVVVGPEAPLAAGVADATRAAGLLTFGPSQAAARLEASKGFTKEVCDACGAPTAGY 126

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
             F++   A+ +V+    PIV+KADGL AGKGVVVA T  EA +AID      F    + 
Sbjct: 127 ARFTEAEAARAHVRAAGAPIVIKADGLAAGKGVVVAMTEAEALAAIDDMFGGSFGAAGAE 186

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+T +P  TA+DHKR  DGD GPNTGGMGA SPA  ++  +
Sbjct: 187 VVIEEFMTGEEASFFVLTDGRTVLPIGTAQDHKRAFDGDEGPNTGGMGAYSPAPVLTTAV 246

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PTI  M +   P+ GVL+AGLMI E    L+EYNVRFGDPECQ +M+RL 
Sbjct: 247 QRQALDEIVKPTIAEMGRRGAPYSGVLYAGLMIEEGRARLVEYNVRFGDPECQVLMLRLG 306

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-- 354
           +  L++L +C  G L    +NW  ++ALTVV+A +GYP  Y  GT I  +     T++  
Sbjct: 307 AQALDLLLACAEGRLDQVQVNWAEDHALTVVMAAQGYPGSYRKGTEIRGLEALPETSRQV 366

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA     + A GGRVL+ATA G T+ E++  AY MV+ IDW  G+ R DIG
Sbjct: 367 VFHAGTAAEEGRILATGGRVLAATARGATLAEAQAAAYAMVDAIDWPEGFCRRDIG 422


>gi|332185504|ref|ZP_08387252.1| phosphoribosylamine--glycine ligase [Sphingomonas sp. S17]
 gi|332014482|gb|EGI56539.1| phosphoribosylamine--glycine ligase [Sphingomonas sp. S17]
          Length = 428

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/420 (49%), Positives = 273/420 (65%), Gaps = 3/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWK+AQS  L  L++ PGNPGIA HA CVA+D  +H+A++ F QE
Sbjct: 1   MNVLLLGSGGREHALAWKLAQSNGLDTLYAAPGNPGIAAHATCVALDATDHAAVVAFVQE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             + LVVVGPE PLV+G++D+L AAG  VFGPS+ AA+LE SK F K  C +  IPTA Y
Sbjct: 61  HGVGLVVVGPEAPLVDGLADSLRAAGVPVFGPSKAAAQLEGSKGFTKDLCRRADIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNK-SMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII 179
              S   +A+  +     +P+V+KADGL AGKGV VA T  EA +AI   F    + V+I
Sbjct: 121 VRVSTLEEAQAALATTFGLPVVIKADGLAAGKGVTVAFTKAEAEAAITDLFSVAGAEVVI 180

Query: 180 EEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYST 239
           EE+LEG E S F L DG+  +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL   
Sbjct: 181 EEFLEGEEASLFVLTDGEALLPFGSAQDHKRVGDGDTGPNTGGMGAYSPARVLTPELEQQ 240

Query: 240 VIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDI 299
            I +I+ PT++ ++ E   F GVL+AGLM+TEQGP LIEYN RFGDPECQ +M+R + D+
Sbjct: 241 AIDRIVRPTVDTLRAEGTHFSGVLYAGLMLTEQGPKLIEYNARFGDPECQVLMLRFQGDL 300

Query: 300 LEILNSCVHGNLHNTHI-NWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-LFH 357
           L ++ +   G L       +  + ALTVV+A  GYP     G  I  I     T   +F 
Sbjct: 301 LAVMLAVAEGRLAALPAPTFSDDPALTVVMAASGYPGTPKAGGTIDAIDAAEATGAVVFQ 360

Query: 358 AGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           AGT    ++L A+GGRVL+ TA   T+ +++  AY  V+ I +  G+ R DIG ++  R 
Sbjct: 361 AGTRQDGDHLVASGGRVLAVTASAATVGQAQAAAYRAVDAIRFPDGFCRRDIGWREVARE 420


>gi|37992755|gb|AAR06584.1| glycinamide ribonucleotide synthetase [Nicotiana tabacum]
          Length = 515

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 276/416 (66%), Gaps = 14/416 (3%)

Query: 11  REHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHFCQEKHIDLVV 67
           REHAL   + +SP    ++  PGN GI+    A C+A +D+ + SA+I FC++  + LVV
Sbjct: 92  REHALCHALRRSPSCDAIFCAPGNAGISSSGDATCIADLDVLDSSAVIVFCRKWGVGLVV 151

Query: 68  VGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPM 127
           VGPE PLV G+++ L   G   FGPS  AA LE SK+F K  C KYGIPTA YQ F+DP 
Sbjct: 152 VGPEAPLVAGLANDLVKEGIPTFGPSSEAAALEGSKNFMKSLCDKYGIPTAKYQAFTDPS 211

Query: 128 KAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINSTVIIEEY 182
            A +Y++ +  PIVVKADGL AGKGV+VA T+++A  A+D       F    S VI+EEY
Sbjct: 212 AANEYIKQEGAPIVVKADGLAAGKGVIVAMTLEQAYEAVDSMLVENAFGSAGSRVIVEEY 271

Query: 183 LEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQ 242
           LEG E SFFAL DG+ AIP  +A+DHKR+ DGD GPNTGGMGA SPA  +++EL S V++
Sbjct: 272 LEGEEASFFALVDGEHAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPVLTKELQSVVME 331

Query: 243 KIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMMMRLESDIL 300
            II PT++GM +E   F GVL+AGLMI ++   P LIEYNVRFGDPECQ +M+RLESD+ 
Sbjct: 332 SIIFPTVKGMAEEGCKFVGVLYAGLMIEKKTGFPKLIEYNVRFGDPECQVLMVRLESDLA 391

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI---PQNTGTTQLFH 357
            +L +   G L    ++W    A+ VV+A+KGYP  Y  GT+I K+    Q   + ++FH
Sbjct: 392 AVLLAACRGKLRGVSLDWSHGSAMVVVMASKGYPGSYQKGTVIHKLEEAEQVAPSVKVFH 451

Query: 358 AGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           AGTA   + N  A GGRVL  TA G+ + E+R+ AY  VE I W  G++R DIG +
Sbjct: 452 AGTAFDADGNFIATGGRVLGVTAKGEDLEEARDRAYQAVEQISWPGGFYRRDIGWR 507


>gi|261210435|ref|ZP_05924729.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC341]
 gi|260840493|gb|EEX67059.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC341]
          Length = 429

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V+I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVSIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|126461270|ref|YP_001042384.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides ATCC
           17029]
 gi|126102934|gb|ABN75612.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides ATCC
           17029]
          Length = 420

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/416 (49%), Positives = 270/416 (64%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW I Q+P    L   PGN GIAQ A+C  +DI + +A++ FC+ 
Sbjct: 1   MNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIAQIAECADLDILDGAAVVAFCEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  G++DA  AAG   FGPSQ AA+LE+SK F K+ C   G PTA Y
Sbjct: 61  NSVDFVVVGPEAPLAAGVADATRAAGLLTFGPSQAAARLEASKGFTKEVCDACGAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
             F++   A+ +V+    PIV+KADGL AGKGVVVA T  EA +AID      F    + 
Sbjct: 121 ARFTEAEAARAHVRAAGAPIVIKADGLAAGKGVVVAMTEAEALAAIDDMFGGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+T +P  TA+DHKR  DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEEFMTGEEASFFVLTDGRTVLPIGTAQDHKRAFDGDEGPNTGGMGAYSPAPVLTTAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PTI  M +   P+ GVL+AGLMI E    L+EYNVRFGDPECQ +M+RL 
Sbjct: 241 QRQALDEIVKPTIAEMGRRGAPYSGVLYAGLMIEEGRARLVEYNVRFGDPECQVLMLRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-- 354
           +  L++L +C  G L    +NW  ++ALTVV+A +GYP  Y  GT I  +     T++  
Sbjct: 301 AQALDLLLACAEGRLDQVQVNWAEDHALTVVMAAQGYPGSYRKGTEIRGLEALPETSRQV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA     + A GGRVL+ATA G T+ E++  AY MV+ IDW  G+ R DIG
Sbjct: 361 VFHAGTAAEEGRILATGGRVLTATARGATLAEAQAAAYAMVDAIDWPEGFCRRDIG 416


>gi|283856228|ref|YP_162034.2| phosphoribosylamine/glycine ligase [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|283775223|gb|AAV88923.2| phosphoribosylamine/glycine ligase [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 403

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/403 (48%), Positives = 266/403 (66%), Gaps = 6/403 (1%)

Query: 15  LAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPL 74
           +AWKIAQSP L   ++  GNPGIA+ A+   I + +H+A++ FCQ+  IDLVV+GPE PL
Sbjct: 1   MAWKIAQSPSLDTFYATTGNPGIAKLAKPADITVTDHAAVVRFCQDNAIDLVVIGPEAPL 60

Query: 75  VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQ 134
           V+G+ ++L AA   VFGP + AA+LE SK F K  C +Y IPTA YQ      +AK  + 
Sbjct: 61  VDGLGNSLRAASIAVFGPDKAAAQLEGSKGFTKDLCARYNIPTARYQRCRSAEEAKAALD 120

Query: 135 NKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINSTVIIEEYLEGFEVSF 190
           N S P+V+KADGL  GKGV++A +  EA  AI       F +    +++EE+++G E SF
Sbjct: 121 NFSTPVVIKADGLAGGKGVIIAESRLEAEQAIQDMTAGAFGKAGLEIVVEEFMQGEEASF 180

Query: 191 FALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIE 250
           FA+ DG+T  PF TARDHKR+ DGD GPNTGGMGA SPA  ++ +L   V+Q+I+ PT++
Sbjct: 181 FAISDGETVRPFGTARDHKRVGDGDTGPNTGGMGAYSPATRLTADLEKRVMQEIVTPTVQ 240

Query: 251 GMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGN 310
            M+++  PF G+L+AGLM+T +GP LIEYN R GDPECQ +MMRLESDIL +L +   G 
Sbjct: 241 AMKEQGMPFVGILYAGLMLTSEGPKLIEYNARLGDPECQVLMMRLESDILPLLYAAATGK 300

Query: 311 LH-NTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTGTTQLFHAGTAIVNNNLT 368
           L       +  +YA+TVV+A +GYP     G II+++ +       +F AGT + N  L 
Sbjct: 301 LQAQPEPTFSKDYAVTVVIAAQGYPASPKKGGIITRLNEAEANGAVVFQAGTTLDNQTLK 360

Query: 369 ANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           ANGGRVL+ TA       +R+LAY  V  ID+  G+WR DIGL
Sbjct: 361 ANGGRVLNVTAKAADFNAARDLAYQAVNVIDYPDGFWRGDIGL 403


>gi|77462393|ref|YP_351897.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides 2.4.1]
 gi|77386811|gb|ABA77996.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides 2.4.1]
          Length = 420

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/416 (49%), Positives = 270/416 (64%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW I Q+P    L   PGN GIAQ A+C  +DI + +A++ FC+ 
Sbjct: 1   MNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIAQIAECADLDILDGAAVVAFCEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  G++DA  AAG   FGPSQ AA+LE+SK F K+ C   G PTA Y
Sbjct: 61  NSVDFVVVGPEAPLAAGVADATRAAGLLTFGPSQAAARLEASKGFTKEVCDACGAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
             F++   A+ +V+    PIV+KADGL AGKGVVVA T  EA +AID      F    + 
Sbjct: 121 ARFTEAEAARAHVRATGAPIVIKADGLAAGKGVVVAMTEAEALAAIDDMFGGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+T +P  TA+DHKR  DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEEFMTGEEASFFVLTDGRTVLPIGTAQDHKRAFDGDEGPNTGGMGAYSPAPVLTTAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PTI  M +   P+ GVL+AGLMI E    L+EYNVRFGDPECQ +M+RL 
Sbjct: 241 QRQALDEIVKPTIAEMGRRGAPYSGVLYAGLMIEEGRARLVEYNVRFGDPECQVLMLRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-- 354
           +  L++L +C  G L    +NW  ++ALTVV+A +GYP  Y  GT I  +     T++  
Sbjct: 301 AQALDLLLACAEGRLDQVQVNWAEDHALTVVMAAQGYPGSYRKGTEIRGLEALPETSRQV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA     + A GGRVL+ATA G T+ E++  AY MV+ IDW  G+ R DIG
Sbjct: 361 VFHAGTAAEEGRILATGGRVLAATARGATLAEAQAAAYAMVDAIDWPEGFCRRDIG 416


>gi|262163816|ref|ZP_06031556.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM223]
 gi|262027796|gb|EEY46461.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM223]
          Length = 429

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 202/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRTAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q T 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQETA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|241760866|ref|ZP_04758955.1| phosphoribosylamine/glycine ligase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241374485|gb|EER63946.1| phosphoribosylamine/glycine ligase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 403

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/403 (48%), Positives = 266/403 (66%), Gaps = 6/403 (1%)

Query: 15  LAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKHIDLVVVGPELPL 74
           +AWKIAQSP L   ++  GNPGIA+ A+   I + +H+A++ FCQ+  IDLVV+GPE PL
Sbjct: 1   MAWKIAQSPSLDTFYATTGNPGIAKLAKPADITVTDHAAVVRFCQDNAIDLVVIGPEAPL 60

Query: 75  VNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQ 134
           V+G+ ++L AA   VFGP + AA+LE SK F K  C +Y IPTA YQ      +AK  + 
Sbjct: 61  VDGLGNSLRAASIAVFGPDKAAAQLEGSKGFTKDLCARYNIPTARYQRCRSAEEAKAALD 120

Query: 135 NKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINSTVIIEEYLEGFEVSF 190
           N S P+V+KADGL  GKGV++A +  EA  AI       F +    +++EE+++G E SF
Sbjct: 121 NFSTPVVIKADGLAGGKGVIIAESQLEAEQAIQDMTAGAFGKAGLEIVVEEFMQGEEASF 180

Query: 191 FALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTVIQKIILPTIE 250
           FA+ DG+T  PF TARDHKR+ DGD GPNTGGMGA SPA  ++ +L   V+Q+I+ PT++
Sbjct: 181 FAISDGETVRPFGTARDHKRVGDGDTGPNTGGMGAYSPATRLTADLEKRVMQEIVTPTVQ 240

Query: 251 GMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDILEILNSCVHGN 310
            M+++  PF G+L+AGLM+T +GP LIEYN R GDPECQ +MMRLESDIL +L +   G 
Sbjct: 241 AMKEQGMPFVGILYAGLMLTSEGPKLIEYNARLGDPECQVLMMRLESDILPLLYAAATGK 300

Query: 311 LH-NTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTGTTQLFHAGTAIVNNNLT 368
           L       +  +YA+TVV+A +GYP     G II+++ +       +F AGT + N  L 
Sbjct: 301 LQAQPEPTFSKDYAVTVVIAAQGYPASPKKGGIITRLNEAEANGAVVFQAGTTLDNQTLK 360

Query: 369 ANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           ANGGRVL+ TA       +R+LAY  V  ID+  G+WR DIGL
Sbjct: 361 ANGGRVLNVTAKAADFNAARDLAYQAVNVIDYPDGFWRGDIGL 403


>gi|332970027|gb|EGK09025.1| phosphoribosylamine-glycine ligase [Desmospora sp. 8437]
          Length = 449

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/427 (46%), Positives = 274/427 (64%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           +R+L+IG GGREHAL WK+ QSP +++++  PGN G+  HA    I   +  +++ F + 
Sbjct: 26  VRILVIGGGGREHALLWKLMQSPRVTKVYCTPGNGGMGAHAVTPPISPTDVESLVRFARG 85

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE  L+ G+ DA    G  VFGP + AA++E SK FAK+   KYG+PT  Y
Sbjct: 86  NQIDLTVVGPEASLMAGVVDAFEREGLVVFGPRKSAARVEGSKRFAKELMEKYGVPTGRY 145

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F+DP  A +Y++ +  PIVVKADGL AGKGV+VA T+DEA  A++     R F +   
Sbjct: 146 RAFTDPEAAIRYIREQGAPIVVKADGLAAGKGVIVARTLDEAEKAVEDLMRSRTFGKAGE 205

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EEYLEG E+S  A  DG+T  P   A+DHK + DGD GPNTGGMGA SP   +S+E
Sbjct: 206 EIVVEEYLEGEEISLMAFVDGETVRPMVPAQDHKPVFDGDRGPNTGGMGAYSPVPQISEE 265

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               ++Q+I+ P   GM++E   ++GVL+AGLM+T+ GP +IE+N RFGDPE Q ++ RL
Sbjct: 266 RIRQIVQEILEPMARGMEQEGLRYRGVLYAGLMMTDAGPKVIEFNARFGDPETQVVLPRL 325

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+ EIL++   G L    I WK E +L VV+A++GYP +   G  I  +P  TG T +
Sbjct: 326 DSDLAEILSAVAEGRLQEISIRWKPEASLCVVMASEGYPGDVVKGKKIRGVPAATGETMV 385

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT+     L   GGRVL  TALG  +  +RE AY  VE I ++  ++R+DIG     
Sbjct: 386 FHAGTSREEGALITAGGRVLGVTALGADLQSAREAAYRSVEAIGFEGAHYRKDIGA---- 441

Query: 416 RNVKYRN 422
           R VK R 
Sbjct: 442 RGVKARQ 448


>gi|297849296|ref|XP_002892529.1| phosphoribosylamine--glycine ligase [Arabidopsis lyrata subsp.
           lyrata]
 gi|297338371|gb|EFH68788.1| phosphoribosylamine--glycine ligase [Arabidopsis lyrata subsp.
           lyrata]
          Length = 530

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 208/424 (49%), Positives = 279/424 (65%), Gaps = 14/424 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVA-IDIQNHSAIIHF 57
           + VL+IG GGREHAL + + +SP    +   PGN GI+    A CV  +DI +  A+I F
Sbjct: 93  VNVLVIGGGGREHALCYALKRSPSCDSVLCAPGNAGISSSGDATCVPDLDISDSLAVISF 152

Query: 58  CQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT 117
           CQ+ ++ LVV+GPE+PLV G+++ L  AG   FGP+ +AA LE SK+F K  C KY IPT
Sbjct: 153 CQKWNVGLVVIGPEVPLVAGLANDLVKAGILTFGPTSQAAALEGSKNFMKNLCLKYNIPT 212

Query: 118 ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQ 172
           A Y+ FSD   AK+Y+Q +  PIV+KADGL AGKGV VA  ++EA  A+D       F  
Sbjct: 213 AKYKTFSDASAAKEYIQEQGAPIVIKADGLAAGKGVTVAMELEEAFEAVDSMLVKGVFGS 272

Query: 173 INSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM 232
               V++EE+LEG E SFFAL DG+ AIP  +A+DHKR+ DGD GPNTGGMGA SPA  +
Sbjct: 273 AGCQVVVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPVL 332

Query: 233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQA 290
           ++EL   V++ II PT++GM +E   F GVLFAGLMI ++   P LIE+NVRFGDPECQ 
Sbjct: 333 TRELQDFVMESIIHPTVKGMAEEGCKFVGVLFAGLMIEKKSGLPKLIEFNVRFGDPECQV 392

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           +MMRLESD+ ++L +   G L    ++W  + A+ VV+A+ GYP  Y  G+II  + +  
Sbjct: 393 LMMRLESDLAKVLLAACKGELSGVSLDWSKDSAMVVVMASNGYPGAYEKGSIIRNLEEAE 452

Query: 351 GT---TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
                 ++FHAGT +    N+ A GGRVL  TA G  + E+RE AY  V+ I+W  G++R
Sbjct: 453 TVAPGVKVFHAGTDLDSEGNVIATGGRVLGVTAKGNDLEEARERAYSAVQQINWPGGFFR 512

Query: 407 EDIG 410
            DIG
Sbjct: 513 HDIG 516


>gi|269103655|ref|ZP_06156352.1| phosphoribosylamine--glycine ligase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163553|gb|EEZ42049.1| phosphoribosylamine--glycine ligase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 428

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 198/425 (46%), Positives = 284/425 (66%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK+AQ+P +S+++  PGN G A   +   VAI +++ +A++ F 
Sbjct: 1   MQVLIIGNGGREHALAWKVAQNPEVSQIFVAPGNAGTALEPKVTNVAIAVEDIAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE  I+L +VGPE PLV G+ DA  AAG  +FGPSQ A++LE SK+F K F  ++ IPTA
Sbjct: 61  QELQIELTIVGPEAPLVLGVVDAFQAAGLAIFGPSQAASQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ +  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 QYQNFTEIEPALAYLRQQGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E NP+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIYPTVRGMAAEGNPYTGFLYAGLMIMNDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E+  + + G L++    W    A+ VV+A  GYP  Y  G +I  +PQ    
Sbjct: 301 LRLQSDLVELCQAAIDGKLNHCQSQWDPRAAIGVVLAAGGYPGHYHKGDVICGLPQQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT  ++  +  NGGRVL ATA+G T+ ++++ AY + + IDW   ++REDIG 
Sbjct: 361 GEKVFHAGTCELDGQVVTNGGRVLCATAMGDTVQQAQQRAYQLAQQIDWDGMFYREDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|221638254|ref|YP_002524516.1| phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides KD131]
 gi|221159035|gb|ACM00015.1| Phosphoribosylamine--glycine ligase [Rhodobacter sphaeroides KD131]
          Length = 426

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/416 (49%), Positives = 270/416 (64%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW I Q+P    L   PGN GIAQ A+C  +DI + +A++ FC+ 
Sbjct: 7   MNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIAQIAECADLDILDGAAVVAFCEA 66

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  G++DA  AAG   FGPSQ AA+LE+SK F K+ C   G PTA Y
Sbjct: 67  NSVDFVVVGPEAPLAAGVADATRAAGLLTFGPSQAAARLEASKGFTKEVCDACGAPTAGY 126

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
             F++   A+ +V+    PIV+KADGL AGKGVVVA T  EA +AID      F    + 
Sbjct: 127 ARFTEAEAARAHVRATGAPIVIKADGLAAGKGVVVAMTEAEALAAIDDMFGGSFGAAGAE 186

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG+T +P  TA+DHKR  DGD GPNTGGMGA SPA  ++  +
Sbjct: 187 VVIEEFMTGEEASFFVLTDGRTVLPIGTAQDHKRAFDGDEGPNTGGMGAYSPAPVLTTAV 246

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +I+ PTI  M +   P+ GVL+AGLMI +    L+EYNVRFGDPECQ +M+RL 
Sbjct: 247 QRQALDEIVKPTIAEMGRRGAPYSGVLYAGLMIEKGRARLVEYNVRFGDPECQVLMLRLG 306

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-- 354
           +  L++L +C  G L    +NW  ++ALTVV+A +GYP  Y  GT I  +     T++  
Sbjct: 307 AQALDLLLACAEGRLDQVQVNWAEDHALTVVMAAQGYPGSYRKGTEIRGLESLPETSRQV 366

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA     + A GGRVL+ATA G T+ E++  AY MV+ IDW  G+ R DIG
Sbjct: 367 VFHAGTAAEEGRILATGGRVLAATARGATLAEAQAAAYAMVDAIDWPEGFCRRDIG 422


>gi|260433214|ref|ZP_05787185.1| phosphoribosylamine--glycine ligase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417042|gb|EEX10301.1| phosphoribosylamine--glycine ligase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 420

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 280/419 (66%), Gaps = 12/419 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P    L   PGN GIAQ A C A+DI+N SA++ F +E
Sbjct: 1   MNILILGSGGREHSLAWAVMQNPKCDRLIVAPGNAGIAQIADCAALDIENGSAVVSFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG  VFGPS  AA+LE+SKSF K+ C   G PTA Y
Sbjct: 61  NAIDFVIIGPEAPLAAGVADRLREAGILVFGPSAEAARLEASKSFTKEICDAAGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS--AIDRCFQQINST-- 176
             F++   AK Y++ +  PIVVKADGL AGKGV+VA  +DEAT+  A+D  F        
Sbjct: 121 ARFTEAEPAKAYIRQQGAPIVVKADGLAAGKGVIVA--MDEATALEAVDDMFGGAFGGAG 178

Query: 177 --VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
             V+IEE+++G E S F LCDG+  +   TA+DHKR+ +GD G NTGGMGA SPA  +S 
Sbjct: 179 AEVVIEEFMDGEEASLFVLCDGENILSAGTAQDHKRVGEGDTGLNTGGMGAYSPAPVLSS 238

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
           E+    +++I+ PT+  M++   PFQGVL+AGLMI +  P L+EYNVRFGDPECQ +MMR
Sbjct: 239 EIEERAMEQIVRPTMAEMKRRGTPFQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMR 298

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTG 351
           L +  L+++++   G L    +NW  ++A+TVV+A KGYP  Y  G+ I    K+P+++ 
Sbjct: 299 LGAQALDLMHAAAEGRLDEARVNWADDHAMTVVMAAKGYPGAYEKGSEIKGLDKLPEDS- 357

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
              +FHAGT      + A GGRVL+ TA G T+ E+R+ AY MVE IDW  G++R DIG
Sbjct: 358 RNMVFHAGTKEEGGAILAVGGRVLNVTARGATLREARDNAYAMVEAIDWPGGFYRRDIG 416


>gi|229512727|ref|ZP_04402195.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TMA 21]
 gi|229350237|gb|EEO15189.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TMA 21]
          Length = 442

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQSAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKER 416
           +   R
Sbjct: 434 RAIAR 438


>gi|158424010|ref|YP_001525302.1| phosphoribosylamine--glycine ligase [Azorhizobium caulinodans ORS
           571]
 gi|158330899|dbj|BAF88384.1| phosphoribosylglycinamide synthetase [Azorhizobium caulinodans ORS
           571]
          Length = 444

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/415 (49%), Positives = 272/415 (65%), Gaps = 3/415 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCV-AIDIQNHSAIIHFCQ 59
           M VLL+GSGGREHALAWK+AQSP + + +++PGNPGI+  A+ +  I +  H  ++ +C+
Sbjct: 27  MNVLLLGSGGREHALAWKLAQSPDMGQFYALPGNPGISDFAEAIEGIALSAHDTLVRWCK 86

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  I+LV+VGPE PLV G+ D L  AG   FGP+  AA+LE SK F K+ C   GIPTA 
Sbjct: 87  DHAIELVIVGPEAPLVAGLVDRLAEAGIAAFGPTAAAARLEGSKLFTKELCRANGIPTAA 146

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII 179
           +  F+    A  YV  +  PIV+KADGL AGKGVVVA TV+EA SAID+ F      V+I
Sbjct: 147 FARFTKAEAAWAYVTAEGAPIVIKADGLMAGKGVVVAQTVEEAISAIDQVFAAGGQEVLI 206

Query: 180 EEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYST 239
           EE++EG E S F L DG+T +PF +A+DHKR  DGD+GPNTGGMGA SPA  ++ EL   
Sbjct: 207 EEFMEGEEASLFCLVDGETVVPFGSAQDHKRAFDGDLGPNTGGMGAYSPAPVLTPELEKR 266

Query: 240 VIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDI 299
            I +I++PT + M     P++GVL+AGLM+T  GP L+EYN RFGDPECQ +M R   D+
Sbjct: 267 AIDEIVIPTAKAMAAAGTPYRGVLYAGLMLTSTGPKLVEYNCRFGDPECQVLMPRYTGDL 326

Query: 300 LEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ--LFH 357
           LE LN+  HG L    ++W  + A+TVV A++GYP  +  G+ I  I          +F 
Sbjct: 327 LETLNAVAHGRLSQVKVSWSDDAAITVVYASRGYPGAHQTGSEIKGIEAAAALPDVLVFQ 386

Query: 358 AGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           AGT      L +NGGRVL+ TA GKT+ ++R+ AY     IDW  G+ R DIG +
Sbjct: 387 AGTKKNGARLLSNGGRVLNVTATGKTLKDARDRAYEAAGLIDWPDGFHRNDIGWR 441


>gi|121727035|ref|ZP_01680226.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V52]
 gi|254225656|ref|ZP_04919263.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V51]
 gi|121630546|gb|EAX62936.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V52]
 gi|125621776|gb|EAZ50103.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V51]
 gi|327483147|gb|AEA77554.1| Phosphoribosylamine--glycine ligase [Vibrio cholerae LMA3894-4]
          Length = 429

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|153830384|ref|ZP_01983051.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 623-39]
 gi|148874118|gb|EDL72253.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 623-39]
          Length = 429

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVRKKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 EQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|262192522|ref|ZP_06050672.1| phosphoribosylamine--glycine ligase [Vibrio cholerae CT 5369-93]
 gi|262031567|gb|EEY50155.1| phosphoribosylamine--glycine ligase [Vibrio cholerae CT 5369-93]
          Length = 429

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTKTQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|153826744|ref|ZP_01979411.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MZO-2]
 gi|297581739|ref|ZP_06943661.1| phosphoribosylamine-glycine ligase [Vibrio cholerae RC385]
 gi|149739459|gb|EDM53697.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MZO-2]
 gi|297534146|gb|EFH72985.1| phosphoribosylamine-glycine ligase [Vibrio cholerae RC385]
          Length = 429

 Score =  408 bits (1048), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|229521008|ref|ZP_04410429.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TM 11079-80]
 gi|229527229|ref|ZP_04416622.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 12129(1)]
 gi|229335237|gb|EEO00721.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 12129(1)]
 gi|229341893|gb|EEO06894.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TM 11079-80]
          Length = 442

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKER 416
           +   R
Sbjct: 434 RAIAR 438


>gi|237807315|ref|YP_002891755.1| phosphoribosylamine/glycine ligase [Tolumonas auensis DSM 9187]
 gi|237499576|gb|ACQ92169.1| phosphoribosylamine/glycine ligase [Tolumonas auensis DSM 9187]
          Length = 428

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/428 (47%), Positives = 283/428 (66%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK AQSPL  +++  PGN G A+ A+   V I   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKAAQSPLADKVFVAPGNTGSAREAKVENVNISATDVPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++++I L +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KQQNIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F   
Sbjct: 121 DYQNFTEIEPALAYLKEKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKRI DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRIGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V+Q +I PT++GM  E NP+ G L+AGLMI  QG P +IE+N RFGDPE Q +M
Sbjct: 241 QEVHDKVMQLVIWPTVQGMAAEGNPYTGFLYAGLMIDPQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L     ++    A+ +V+A  GYP E   G +IS +P +   
Sbjct: 301 LRMRSDLVELCLAACAGELDQKTADYDPRPAVGIVLAAAGYPAEVQKGDVISGLPTSEPD 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           T ++FHAGTA  + N+   GGRVL ATALG T+ E+++ AY + E I W   Y+R+DI  
Sbjct: 361 TAKVFHAGTAEQDGNIITAGGRVLCATALGATVAEAQKNAYALAETISWNGIYYRKDIAW 420

Query: 412 QKKERNVK 419
           +   R  K
Sbjct: 421 RAIAREQK 428


>gi|229524778|ref|ZP_04414183.1| phosphoribosylamine--glycine ligase [Vibrio cholerae bv. albensis
           VL426]
 gi|229338359|gb|EEO03376.1| phosphoribosylamine--glycine ligase [Vibrio cholerae bv. albensis
           VL426]
          Length = 442

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPAQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKER 416
           +   R
Sbjct: 434 RAIAR 438


>gi|188583523|ref|YP_001926968.1| phosphoribosylamine--glycine ligase [Methylobacterium populi BJ001]
 gi|179347021|gb|ACB82433.1| phosphoribosylamine--glycine ligase [Methylobacterium populi BJ001]
          Length = 431

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/420 (48%), Positives = 272/420 (64%), Gaps = 6/420 (1%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQEK 61
           +LLIGSGGREHALAW IA+SPL + L+  PGNPG AQH +    + + +H+A++ FC+ +
Sbjct: 7   ILLIGSGGREHALAWAIAKSPLCARLFIAPGNPGTAQHGENRPDLPVSDHAAVVAFCKAE 66

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            + LVVVGPE PLV G+ D L AAG   FGP++ AA+LE SK F K  C + GIPTA + 
Sbjct: 67  GVGLVVVGPEAPLVAGLVDDLQAAGIPAFGPTKAAAQLEGSKGFTKDLCAERGIPTAAFA 126

Query: 122 HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ-QINSTVIIE 180
            F++   A  Y+  +  PIVVKADGL AGKGV VA T+ EA +A+           ++IE
Sbjct: 127 RFTELAPALAYLSARGAPIVVKADGLAAGKGVTVAETLPEAEAAVRAILDGSEGGALVIE 186

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E L G E SFFALCDG  A+P  TA+DHKR+HDGD GPNTGGMGA SPA  ++  +   V
Sbjct: 187 ECLFGEEASFFALCDGTRAVPIGTAQDHKRVHDGDRGPNTGGMGAYSPASIVTPAIAEAV 246

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+EGM  +  PF G+L+AGLM+T +GP LIEYN RFGDPE Q +M RL  D++
Sbjct: 247 MTRIIAPTLEGMAAKGTPFSGILYAGLMLTSEGPKLIEYNTRFGDPEAQVLMPRLTGDLV 306

Query: 301 EILNSCVHGNLHNTHINWKA-EYALTVVVATKGYPEEYPHGTII--SKIPQNTGTTQLFH 357
             L +   G+L    I +     ALTVV+A +GYP     GT I  ++   + G   +F 
Sbjct: 307 PALLAAAKGDLSGVDIGFDPHRAALTVVMAAQGYPGAVRRGTEIRGAEAAGDAGIV-VFQ 365

Query: 358 AGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           AGT      L A+GGRVL+ TALG ++ E+++ AY  V  I+W  G++R DIG ++  R 
Sbjct: 366 AGTRRDGERLLADGGRVLAVTALGASVREAKDRAYAAVRRINWPDGFFRTDIGGREVARE 425


>gi|258620639|ref|ZP_05715676.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM573]
 gi|258587154|gb|EEW11866.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM573]
          Length = 429

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTKGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+    + G L      W    ++ VV+A  GYP +Y  G +IS +P Q   
Sbjct: 301 MRLQSDLVELCQVAIAGKLDQMESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I+W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQINWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|15640304|ref|NP_229931.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586357|ref|ZP_01676146.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 2740-80]
 gi|153818472|ref|ZP_01971139.1| phosphoribosylamine--glycine ligase [Vibrio cholerae NCTC 8457]
 gi|227080489|ref|YP_002809040.1| phosphoribosylamine-glycine ligase [Vibrio cholerae M66-2]
 gi|262161967|ref|ZP_06030984.1| phosphoribosylamine--glycine ligase [Vibrio cholerae INDRE 91/1]
 gi|298500910|ref|ZP_07010712.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MAK 757]
 gi|20139786|sp|Q9KV81|PUR2_VIBCH RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|9654685|gb|AAF93450.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121549477|gb|EAX59505.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 2740-80]
 gi|126510948|gb|EAZ73542.1| phosphoribosylamine--glycine ligase [Vibrio cholerae NCTC 8457]
 gi|227008377|gb|ACP04589.1| phosphoribosylamine-glycine ligase [Vibrio cholerae M66-2]
 gi|262028345|gb|EEY47001.1| phosphoribosylamine--glycine ligase [Vibrio cholerae INDRE 91/1]
 gi|297540414|gb|EFH76473.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MAK 757]
          Length = 429

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|253686630|ref|YP_003015820.1| phosphoribosylamine/glycine ligase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753208|gb|ACT11284.1| phosphoribosylamine/glycine ligase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 428

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL   ++  PGN G A  A    +DI   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKAAQSPLAKRVYVAPGNAGTALEAALTNVDIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGPSQ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI+       F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIEDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ    
Sbjct: 301 LRLRSDLVELCLAACDGTLDQKDSVWDERPSLGVVLAAGGYPADYNTGDVISGLPQQDAE 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAIER 425


>gi|254286253|ref|ZP_04961212.1| phosphoribosylamine--glycine ligase [Vibrio cholerae AM-19226]
 gi|150423668|gb|EDN15610.1| phosphoribosylamine--glycine ligase [Vibrio cholerae AM-19226]
          Length = 429

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 200/425 (47%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ D   AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDTFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|147673352|ref|YP_001218530.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O395]
 gi|262168019|ref|ZP_06035718.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC27]
 gi|146315235|gb|ABQ19774.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O395]
 gi|227012117|gb|ACP08327.1| phosphoribosylamine-glycine ligase [Vibrio cholerae O395]
 gi|262023552|gb|EEY42254.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC27]
          Length = 429

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 AYANFTEIEPALAYVRKKGAPIVVKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|90413393|ref|ZP_01221386.1| phosphoribosylamine--glycine ligase [Photobacterium profundum 3TCK]
 gi|90325635|gb|EAS42104.1| phosphoribosylamine--glycine ligase [Photobacterium profundum 3TCK]
          Length = 429

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/428 (46%), Positives = 282/428 (65%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQS  ++ ++  PGNPG A   +   VAI +++  A++ F 
Sbjct: 1   MKVLIIGNGGREHALAWKTAQSADVNTIFVAPGNPGTALEPKVENVAIGVEDIEALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  IDL +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENAIDLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y+Q K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEIDPALAYLQEKGAPIVVKADGLAAGKGVIVAMTLQEAENAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q ++  V++++I PT+ GM  E  P+ G L+AGLM+   G P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMEEVIYPTVRGMAAENTPYTGFLYAGLMVMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++E+  + +   L      W    A+ +V+A  GYP +Y  G IIS +P Q+  
Sbjct: 301 LRLQSDLVELCLAAIDQKLDTVESKWDPRAAMGIVLAAGGYPADYAKGAIISGLPQQDVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AGTA  N  +  NGGRVL ATA+G +++++++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFQAGTASNNGAIVTNGGRVLCATAMGDSVSDAQKRAYALTKQISWDGMFHRDDIGY 420

Query: 412 QKKERNVK 419
           +   R ++
Sbjct: 421 RAIARELE 428


>gi|229506928|ref|ZP_04396436.1| phosphoribosylamine--glycine ligase [Vibrio cholerae BX 330286]
 gi|229516245|ref|ZP_04405693.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC9]
 gi|229346671|gb|EEO11641.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC9]
 gi|229356033|gb|EEO20952.1| phosphoribosylamine--glycine ligase [Vibrio cholerae BX 330286]
          Length = 442

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKER 416
           +   R
Sbjct: 434 RAIAR 438


>gi|77919825|ref|YP_357640.1| phosphoribosylamine--glycine ligase [Pelobacter carbinolicus DSM
           2380]
 gi|77545908|gb|ABA89470.1| phosphoribosylamine--glycine ligase [Pelobacter carbinolicus DSM
           2380]
          Length = 423

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/423 (45%), Positives = 278/423 (65%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHA+ WKIAQSPL+ E++  PGN GIA  A CV++ + +   ++ F Q+
Sbjct: 1   MKVLVIGSGGREHAMVWKIAQSPLVEEVFCAPGNAGIAGQATCVSLKVDDIDGLLAFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL VVGPELPL  G+ D   AAG  +FG ++ AA++E SKSF K    KYG+PTA+Y
Sbjct: 61  KQIDLTVVGPELPLTLGVVDRFRAAGLTIFGATRDAAQIEGSKSFCKDLMAKYGVPTASY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQINS 175
             F+D  +A  +++ +  PIVVKADGL AGKGV++A TV++A +A++       F    +
Sbjct: 121 GTFTDCDEAVAFIKQQGAPIVVKADGLAAGKGVILADTVEQAVAAVESILCEGAFGSAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E SF A  DG+  +P  +++DHK  +DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 RVVIEEFLEGEEASFLAFTDGERIVPLASSQDHKAAYDGDTGPNTGGMGAYSPAPVVTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++  +I++++ PTI GM  E   +  +L+AGLMI +    ++E+N RFGDPE Q ++ RL
Sbjct: 241 IHDKIIEQVLKPTIAGMAAEGCAYSSILYAGLMIKDGELKVLEFNARFGDPETQPLLARL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SDI+ +L +C  G+L    + W  + A+ VV+A+ GYP +Y  G  I  +    G   L
Sbjct: 301 KSDIVPVLLACARGDLSGVELEWHDKAAVCVVMASGGYPGDYAKGHAIDGLDAAAGIEDL 360

Query: 356 --FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
             FHAGT + ++++   GGRVL  T LG T+ E+ E AY  V+ I+WK  ++R DIG + 
Sbjct: 361 VVFHAGTTLQDDSIVTAGGRVLGVTGLGTTVAEAIERAYQGVKTINWKDVHYRSDIGRKA 420

Query: 414 KER 416
             R
Sbjct: 421 LNR 423


>gi|54310486|ref|YP_131506.1| phosphoribosylamine--glycine ligase [Photobacterium profundum SS9]
 gi|46914929|emb|CAG21704.1| putative phosphoribosylamine-glycine ligase [Photobacterium
           profundum SS9]
          Length = 429

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/428 (46%), Positives = 282/428 (65%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQS  ++ ++  PGNPG A   +   VAI +++  A++ F 
Sbjct: 1   MKVLIIGNGGREHALAWKTAQSADVNTIFVAPGNPGTALEPKVENVAIGVEDIEALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  IDL +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENTIDLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y+Q K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLQEKGAPIVVKADGLAAGKGVIVAMTLQEAENAVRDMLAGNAFGKA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q ++  V++++I PT+ GM  E  P+ G L+AGLM+   G P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMKEVIYPTVRGMAAENTPYTGFLYAGLMVMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++E+  + +   L      W    A+ +V+A  GYP +Y  G IIS +P Q+  
Sbjct: 301 LRLQSDLVELCLAAIEQKLDTVESKWDPRAAMGIVLAAGGYPADYEKGAIISGLPQQDVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AGTA  N  +  NGGRVL ATA+G +++++++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFQAGTASNNGAIVTNGGRVLCATAMGDSVSDAQKRAYALTKQISWDGMFHRDDIGY 420

Query: 412 QKKERNVK 419
           +   R ++
Sbjct: 421 RAIARELE 428


>gi|238020042|ref|ZP_04600468.1| hypothetical protein VEIDISOL_01919 [Veillonella dispar ATCC 17748]
 gi|237863566|gb|EEP64856.1| hypothetical protein VEIDISOL_01919 [Veillonella dispar ATCC 17748]
          Length = 420

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 198/417 (47%), Positives = 275/417 (65%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IGSGGREHALAW+++ SP ++++++IPG+  ++  A+ V ID Q  + +I F ++
Sbjct: 1   MKVCVIGSGGREHALAWRLSISPSVTKVYAIPGSAAMSDCAELVGIDWQQSNHLIRFLKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            HIDLVVVGPE PLV G++DALNAAG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NHIDLVVVGPEAPLVAGLADALNAAGIPVFGPSKAAAQLEGSKVFAKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F    +AK+++     PIVVKADGL AGKGVVVA T+DEA +A++       F +  S
Sbjct: 121 GVFHKVDEAKEFISQTGAPIVVKADGLAAGKGVVVAMTIDEANAAVEDMLSGNRFGEAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++EG E S  A  DGKT +P   ++DHKRI DGD GPNTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMEGEEASLLAFVDGKTVVPMIASQDHKRIFDGDKGPNTGGMGTYAPAPVLTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M+KE  P+ G L+AGLMIT QGP ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDEAMKTILEPMVAAMEKEGMPYVGCLYAGLMITPQGPKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+ +++ +C  G L    + WK   A  V++A+KGYPE    G +I    +   TT +
Sbjct: 301 DSDLGQVMMACATGTLTADMVKWKDSSAACVILASKGYPETSSKGDVIHGDIKQHDTTIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +V      NGGRVL    LGK +  + + AY  +E+ID++   +R DIG +
Sbjct: 361 FHSGTKLVGEEYVTNGGRVLGVVGLGKDLRTALDRAYGRIEHIDFEGMQYRTDIGAK 417


>gi|260774393|ref|ZP_05883307.1| phosphoribosylamine--glycine ligase [Vibrio metschnikovii CIP
           69.14]
 gi|260610520|gb|EEX35725.1| phosphoribosylamine--glycine ligase [Vibrio metschnikovii CIP
           69.14]
          Length = 429

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 283/426 (66%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHAL WK+AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MQVLVIGSGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQKQIALTIVGPEIPLVLGVVDAFRDAGLPIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T+ EA  AI     D  F + 
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLADNSFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E NP+ G L+AGLMI  QG P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNPYTGFLYAGLMIDAQGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ +V+A  GYP +Y  G +IS +P +   
Sbjct: 301 MRLQSDLVELCLAALDGKLDQVESKWDPRASIGIVLAAGGYPADYRKGDVISGLPTEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT+  +  +  NGGRVL ATALG+++ ++++ AY + + I+W+  ++R DIG 
Sbjct: 361 GEKVFHAGTSDQSGAVVTNGGRVLCATALGESVFQAQQRAYQLAKQIEWQGMFYRHDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|153823370|ref|ZP_01976037.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|254851409|ref|ZP_05240759.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MO10]
 gi|255744078|ref|ZP_05418032.1| phosphoribosylamine--glycine ligase [Vibrio cholera CIRS 101]
 gi|126519111|gb|EAZ76334.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|254847114|gb|EET25528.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MO10]
 gi|255738343|gb|EET93734.1| phosphoribosylamine--glycine ligase [Vibrio cholera CIRS 101]
          Length = 429

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKVFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|229509299|ref|ZP_04398782.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|229606439|ref|YP_002877087.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MJ-1236]
 gi|229353614|gb|EEO18551.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|229369094|gb|ACQ59517.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MJ-1236]
          Length = 442

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A     Q V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKVFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKER 416
           +   R
Sbjct: 434 RAIAR 438


>gi|262273287|ref|ZP_06051102.1| phosphoribosylamine--glycine ligase [Grimontia hollisae CIP 101886]
 gi|262222660|gb|EEY73970.1| phosphoribosylamine--glycine ligase [Grimontia hollisae CIP 101886]
          Length = 429

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 280/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+AQS  ++ ++  PGN G A   +   VAI +++ +A++ F 
Sbjct: 1   MDVLVIGNGGREHALAWKVAQSEKVNTVYVAPGNAGTALEPKLENVAIGVEDITALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK IDL +VGPE PLV G+ DA   AG  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKSIDLTIVGPEAPLVIGVVDAFQEAGLPIFGPTAAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+ K  PIVVKADGL AGKGV+VA T++EA +AI        F + 
Sbjct: 121 EYQNFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAENAIRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E +P+ G L+AGLM+   G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHDRVMNEVIFPTVRGMAAEGHPYTGFLYAGLMVMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+  + + G L      W    ++ VV+A  GYP  Y  G +IS +P     
Sbjct: 301 LRLQSDLVELCEAAIAGRLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPMAELN 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  + N+   GGRVL ATA+G+T++E+++ AY +   I W   ++R DIG 
Sbjct: 361 AAKVFHAGTAERDGNVVTAGGRVLCATAMGETVSEAQKRAYELASQISWDGMFYRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|317494898|ref|ZP_07953308.1| phosphoribosylamine-glycine ligase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917086|gb|EFV38435.1| phosphoribosylamine-glycine ligase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 427

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 198/426 (46%), Positives = 280/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A       +DI   + S ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENVDISATDISGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +   I L +VGPE PLV G+ DA  A G K+FGPSQ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KSHDIGLTIVGPEAPLVIGVVDAFQAEGLKIFGPSQAAAQLEGSKAFTKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y++F+D   A  Y++++  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYRNFTDIEPAISYIRSQGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+LEG E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLEGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM KE NP+ G L+AGLMI+ QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVHGMAKEGNPYSGFLYAGLMISAQGHPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +R+ SD++E+  +   G L+     W    AL VV+A  GYPE Y  G +I  +P N+  
Sbjct: 301 LRMRSDLVELCLAGAEGKLNEKESLWDERDALGVVLAAGGYPESYRTGDVIHGLPINSPE 360

Query: 353 TQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            + +FHAGT +V +++   GGRVL ATALG  I ++++ AY + E I W+  ++R+DIG 
Sbjct: 361 GEKVFHAGTQLVGSDVVTQGGRVLCATALGHGIKQAQQNAYQLAEQISWEGSFYRKDIGY 420

Query: 412 QKKERN 417
           +  +R 
Sbjct: 421 RAIQRT 426


>gi|170744118|ref|YP_001772773.1| phosphoribosylamine--glycine ligase [Methylobacterium sp. 4-46]
 gi|168198392|gb|ACA20339.1| phosphoribosylamine--glycine ligase [Methylobacterium sp. 4-46]
          Length = 442

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 210/417 (50%), Positives = 269/417 (64%), Gaps = 2/417 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQ 59
           + +LLIGSGGREHALAWK+AQSP    L   PGNPG A H      +D+ + +A++ FC+
Sbjct: 6   LTILLIGSGGREHALAWKLAQSPACRRLLVAPGNPGTAAHGTNRPDLDVMDGAAVVAFCR 65

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
            + +DLVVVGPE PLV G+ DAL AAG   FGP   AA+LE SK F K+ C   GIPTA 
Sbjct: 66  REGVDLVVVGPEAPLVAGLVDALEAAGLAAFGPRAAAARLEGSKGFTKELCAACGIPTAA 125

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII 179
           +  FS P  A  Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+ R   +  + V+I
Sbjct: 126 FARFSAPEPALAYLRARGAPIVVKADGLAAGKGVVVAETLPEAEEAVARLLAEPGAEVVI 185

Query: 180 EEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYST 239
           EE L G E SFFALCDG  A+ F TA+DHKR+HDGD GPNTGGMGA SPA  ++  + + 
Sbjct: 186 EECLVGEEASFFALCDGTRAVAFGTAQDHKRVHDGDRGPNTGGMGAYSPAPVLTPAIEAE 245

Query: 240 VIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDI 299
           V+ +II PT++GM+    PF+G+L+AGLM+T +GP LIEYNVRFGDPECQ +M RL  D+
Sbjct: 246 VMDRIIRPTLDGMRARGTPFRGILYAGLMLTAEGPKLIEYNVRFGDPECQVLMPRLAGDL 305

Query: 300 LEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGT-IISKIPQNTGTTQLFHA 358
           +  L +   G+L      W  + ALTVV+A  GYP     G+ I            +F A
Sbjct: 306 VPALLAAAAGDLAGIAPAWSPQAALTVVMAAPGYPGPVTRGSEIRGLAEAEAAGALVFQA 365

Query: 359 GTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           GT    + L A+GGRVL+ TA G  I E++  AY  +  IDW  G++R DIG +  E
Sbjct: 366 GTRREGDRLLADGGRVLAVTATGAGIAEAQGRAYAALARIDWPEGFYRRDIGWRALE 422


>gi|315178406|gb|ADT85320.1| phosphoribosylamine--glycine ligase [Vibrio furnissii NCTC 11218]
          Length = 430

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/425 (46%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK+AQ+P +  ++  PGN G A  A  Q V I +++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKVAQNPAVETVFIAPGNAGTALEAKLQNVDIAVEDVAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVRKQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q ++  V+Q++I PT+ GM  E NP+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR++SD++E+  + + G L      W    ++ +V+A  GYP +Y  G IIS +P     
Sbjct: 301 MRMQSDLVELCLAAIDGKLDQVESKWDPRASIGIVLAAGGYPGDYAKGDIISGLPTTEVE 360

Query: 353 TQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            Q +FHAGT   + ++  NGGRVL ATALG T++E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTTDKDGHVVTNGGRVLCATALGNTVSEAQQRAYELAKQISWHGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|260770648|ref|ZP_05879579.1| phosphoribosylamine--glycine ligase [Vibrio furnissii CIP 102972]
 gi|260614374|gb|EEX39562.1| phosphoribosylamine--glycine ligase [Vibrio furnissii CIP 102972]
          Length = 430

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/425 (46%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK+AQ+P +  ++  PGN G A  A  Q V I +++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKVAQNPAVETVFIAPGNAGTALEAKLQNVDIAVEDVAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q ++  V+Q++I PT+ GM  E NP+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR++SD++E+  + + G L      W    ++ +V+A  GYP +Y  G IIS +P     
Sbjct: 301 MRMQSDLVELCLAAIDGKLDQVESKWDPRASIGIVLAAGGYPGDYAKGDIISGLPTTEVE 360

Query: 353 TQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            Q +FHAGT   + ++  NGGRVL ATALG T++E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTTDKDGHVVTNGGRVLCATALGNTVSEAQQRAYELAKQISWHGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|71279844|ref|YP_267313.1| phosphoribosylamine--glycine ligase [Colwellia psychrerythraea 34H]
 gi|71145584|gb|AAZ26057.1| phosphoribosylamine--glycine ligase [Colwellia psychrerythraea 34H]
          Length = 431

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 199/426 (46%), Positives = 278/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IG GGREHALAWK AQS  +++++  PGN G A  A+   VAID+ +++A++ F 
Sbjct: 1   MKILVIGGGGREHALAWKAAQSSQVTKVFVAPGNAGTATEAKLENVAIDVSDNAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L +VGPE PLV+G+ DA  A G  +FGPS +AA+LE SKSF K F  +  IP+ 
Sbjct: 61  QSEDVALTIVGPEQPLVDGVVDAFQAQGLAIFGPSAKAAQLEGSKSFTKDFLARNKIPSG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
           +Y  F++   A  YV+ +  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 SYAKFTEVEPALAYVREQGAPIVVKADGLAAGKGVIVALTLTEAEDAITDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+LEG E SF  + DGK  +P  T++DHKR  +GD+GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLEGEEASFIVMVDGKNVLPMATSQDHKRALNGDLGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I+PT+EGM  E  P+ G L+AGLMI E G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHDRIMAEVIMPTVEGMANEDAPYSGFLYAGLMIAEDGTPNVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+SD++E+  +   G L    I + +  A+ VV+A + YP +YP G +IS +  N   
Sbjct: 301 MRLQSDLVELCLAATRGELDKVTIEFDSRAAVGVVLAAQSYPADYPKGDVISGLDTNNNV 360

Query: 353 -TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             + FHAGT +     +  NGGRVL ATALG T+TE+++ AY ++  I W+   +R DI 
Sbjct: 361 LAKTFHAGTKLNEQGEVVTNGGRVLCATALGNTVTEAQQTAYELLHQISWQGVEFRTDIA 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 YRAIER 426


>gi|254465281|ref|ZP_05078692.1| phosphoribosylamine--glycine ligase [Rhodobacterales bacterium Y4I]
 gi|206686189|gb|EDZ46671.1| phosphoribosylamine--glycine ligase [Rhodobacterales bacterium Y4I]
          Length = 421

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/417 (47%), Positives = 274/417 (65%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P   +L   PGN GIAQ A C   DI++   +  F +E
Sbjct: 1   MNILILGSGGREHSLAWAVMQNPKCDKLIVAPGNAGIAQIADCATFDIEDGGTVAAFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G+ D L  AG  VFGPS  AA+LE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIVGPEAPLAAGVGDRLREAGILVFGPSGAAARLEASKSFTKEICDAANAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+   +P VVKADGL AGKGV++A T DEA +AID  F  +       
Sbjct: 121 GHFTDAEAAKAHVRKHGVPTVVKADGLAAGKGVIIAMTEDEAMAAIDDMFGGVFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   +A+DHKR+ +GD G NTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLVDGEDVLAIGSAQDHKRVGEGDTGLNTGGMGAYSPAPVLSAEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT++ M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EAKAMEEIVKPTMKVMAERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L+++++   G L    +NW  ++A+TVV+A +GYP  Y   + I     +P+++ + 
Sbjct: 301 AQALDLMHAAAEGRLGEAQVNWADDHAITVVMAAEGYPGSYEKFSEIKGLDALPEDS-SN 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT   +  + A GGRVL+ TA G+++ E+R+ AY M + IDW  G++R DIG
Sbjct: 360 MVFHAGTQAQDGKVLAVGGRVLNVTARGESLQEARDRAYAMADGIDWPQGFFRRDIG 416


>gi|50119200|ref|YP_048367.1| phosphoribosylamine--glycine ligase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49609726|emb|CAG73160.1| phosphoribosylamine--glycine ligase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 428

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/425 (47%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A       +DI   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKAAQSPLAKQVYVAPGNAGTALEPALTNVDISATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV +K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALTYVHSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL SD++E+  +   G L      W    +L VV+A  GYP++Y  G +IS +PQ    
Sbjct: 301 LRLRSDLVELCLAGCDGTLDQKDSVWDERPSLGVVLAAGGYPDDYNTGDVISGLPQQDAE 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVVEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAIER 425


>gi|319786016|ref|YP_004145491.1| phosphoribosylamine/glycine ligase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464528|gb|ADV26260.1| phosphoribosylamine/glycine ligase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 430

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 281/425 (66%), Gaps = 9/425 (2%)

Query: 2   RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFCQ 59
           +VL+IGSGGREHALAWK+AQS  +SE+   PGN G A  A+C   A+ + +   ++   +
Sbjct: 3   KVLVIGSGGREHALAWKLAQSARVSEVIVAPGNAGTATEAKCRNAAVKVTDLDGLLQLAR 62

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           ++ + + VVGPE+PLV G+ D    AG ++FGP+  AA+LE SK+FAK F  ++GIPTA 
Sbjct: 63  DEGVAVTVVGPEVPLVAGVVDRFRGAGLRIFGPTAAAAQLEGSKAFAKDFLARHGIPTAF 122

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQIN 174
           Y   +    A  Y++ K  PIVVKADGL AGKGV+VA T++EA +A+        F    
Sbjct: 123 YAVHTQVDAALAYIREKGAPIVVKADGLAAGKGVIVAMTLEEAEAAVRDMLSGNAFGDAG 182

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           + V+IEE+LEG E SF ++ DGKTA+P  T++DHKR+ DGD GPNTGGMGA SPA  ++ 
Sbjct: 183 ARVVIEEFLEGEEASFISMVDGKTALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTP 242

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMM 293
           E+++ ++++++ PT+ GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M+
Sbjct: 243 EVHARIMREVVEPTVAGMAADGTPFTGFLYAGLMIDASGAPKVIEFNVRFGDPETQPVML 302

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT 353
           RL+SD+L+++ + + G LH     W    +L VV+A + YP+    G +IS +       
Sbjct: 303 RLQSDLLDLVEAAIDGRLHEVQAQWDPRPSLGVVIAARPYPDSPVTGEVISGLDAVPADV 362

Query: 354 QLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           ++FHAGTA+ ++ N+T+ GGRVL  TALG ++ +++  AY  V+ I W H + R DIG +
Sbjct: 363 KVFHAGTALDDDGNVTSAGGRVLCVTALGDSVADAQRRAYTGVDAISWAHAFCRRDIGWR 422

Query: 413 KKERN 417
              R 
Sbjct: 423 AIARE 427


>gi|294792983|ref|ZP_06758129.1| phosphoribosylamine--glycine ligase [Veillonella sp. 6_1_27]
 gi|294455928|gb|EFG24292.1| phosphoribosylamine--glycine ligase [Veillonella sp. 6_1_27]
          Length = 420

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/417 (47%), Positives = 271/417 (64%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IGSGGREHALAW+++ SP ++++++IPG+  ++  A+ V ID Q    +I F ++
Sbjct: 1   MKVCVIGSGGREHALAWRLSISPSVTKVYAIPGSAAMSDCAELVGIDWQQSDHLISFLKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DL VVGPE PLV G++D LN AG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NQVDLGVVGPEAPLVAGLADVLNKAGIPVFGPSKAAAQLEGSKVFAKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F    +AK ++     PIVVKADGL AGKGVVVA T+DEA  A++       F    S
Sbjct: 121 GVFHKVDEAKAFIAQTGAPIVVKADGLAAGKGVVVAMTIDEANVAVEDMLSGNRFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++EG E S  A  DGKT +P   ++DHKRI DGD GPNTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMEGEEASLLAFVDGKTVVPMIASQDHKRIFDGDKGPNTGGMGTYAPAPVLTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M+KE  P+ G L+AGLMIT++GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDAAMKTILEPMVAAMEKEGMPYVGCLYAGLMITDEGPKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+ EI+ +C  G L +  + WK   A  V++A+KGYPE    G +IS   +   TT +
Sbjct: 301 DSDLGEIMMACAKGTLTSNMVKWKDSSAACVILASKGYPETSSKGDVISGDIKQYDTTIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +V  N   NGGRVL    LGK +  + + AY  +E+ID++   +R DIG +
Sbjct: 361 FHSGTKLVGENYVTNGGRVLGVVGLGKDLRTALDRAYERIEHIDFEGMQYRTDIGAK 417


>gi|84500005|ref|ZP_00998271.1| Phosphoribosylamine--glycine ligase [Oceanicola batsensis HTCC2597]
 gi|84391939|gb|EAQ04207.1| Phosphoribosylamine--glycine ligase [Oceanicola batsensis HTCC2597]
          Length = 422

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/424 (49%), Positives = 276/424 (65%), Gaps = 10/424 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW + Q+P   +L   PGN GIA  A+C  +DI + SA+I FCQ+
Sbjct: 1   MNILILGGGGREHALAWAVLQNPKCDKLIVAPGNAGIANIAECADLDILDGSAVIQFCQD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ++ +++GPE PL  G++D L AAGF VFGPS+ AA+LE+SK F K+ C   G PTA Y
Sbjct: 61  NAVEFIIIGPEAPLAAGVADDLRAAGFLVFGPSKEAARLEASKGFTKEICDAAGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS--AIDRCFQ----QIN 174
             F D   AK +V+ +  PIVVKADGL AGKGV+VA  +DEAT+  AID  F        
Sbjct: 121 ARFDDAAAAKDHVRAQGAPIVVKADGLAAGKGVIVA--MDEATALAAIDDMFGGEFGAAG 178

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           + V+IEE++EG E SFF LCDG  A+P  TA+DHKR  DGD GPNTGGMGA SPA  ++ 
Sbjct: 179 AEVVIEEFMEGEEASFFVLCDGTNALPVGTAQDHKRAFDGDEGPNTGGMGAYSPAPVLTD 238

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
            L   V+++I+ PT+  M +   P+ GVL+ GLMI +    L+EYN RFGDPECQ +M+R
Sbjct: 239 ALQDQVMERIVRPTLTEMARRGTPYAGVLYVGLMIRDGTARLVEYNCRFGDPECQVLMLR 298

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGT 352
           L +  L++L +   G L    +NW  ++A+TVV+A KGYP +Y  GT I  + Q   T  
Sbjct: 299 LGAQALDLLLAAAEGGLDEARVNWAGDHAMTVVLAAKGYPGDYAKGTEIRGLDQLPETAW 358

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
              FHAGT      + ANGGRVL+ATA G T+ E+R+ AY M E +DW  G+ R DIG +
Sbjct: 359 EICFHAGTRAEGGRVLANGGRVLNATARGATLQEARDRAYAMAEAVDWDDGFHRGDIGWR 418

Query: 413 KKER 416
              R
Sbjct: 419 VLRR 422


>gi|261819584|ref|YP_003257690.1| phosphoribosylamine--glycine ligase [Pectobacterium wasabiae
           WPP163]
 gi|261603597|gb|ACX86083.1| phosphoribosylamine/glycine ligase [Pectobacterium wasabiae WPP163]
          Length = 428

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/425 (47%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A       +DI   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKAAQSPLAKQVYVAPGNAGTALEPALTNVDIAATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ    
Sbjct: 301 LRLRSDLVELCLAGCDGTLDQKDSVWDERPSLGVVLAAGGYPSDYNTGDVISGLPQQDAE 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAIER 425


>gi|294794974|ref|ZP_06760109.1| phosphoribosylamine--glycine ligase [Veillonella sp. 3_1_44]
 gi|294454336|gb|EFG22710.1| phosphoribosylamine--glycine ligase [Veillonella sp. 3_1_44]
          Length = 420

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 272/417 (65%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IGSGGREHALAW+++ SP ++++++I G+  ++  A+ V ID Q    +I F ++
Sbjct: 1   MKVCVIGSGGREHALAWRLSISPSVTKVYAITGSAAMSDCAELVGIDWQQSDHLISFLKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G++D +N AG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NQVDLVVVGPEAPLVAGLADVINKAGIPVFGPSKAAAQLEGSKVFAKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F    +AK ++     PIVVKADGL AGKGVVVA T+DEA +A++       F    S
Sbjct: 121 GVFHKVDEAKAFIAQTGAPIVVKADGLAAGKGVVVAMTIDEANAAVEDMLSGNRFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++EG E S  A  DGKT +P   ++DHKRI DGD GPNTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMEGEEASLLAFVDGKTVVPMIASQDHKRIFDGDKGPNTGGMGTYAPAPVLTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M+KE  P+ G L+AGLMIT++GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDAAMKTILEPMVAAMEKEGMPYVGCLYAGLMITDEGPKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+ EI+ +C  G L +  + WK   A  V++A+KGYPE    G +IS   +   TT +
Sbjct: 301 DSDLGEIMMACAKGTLTSNMVKWKDSSAACVILASKGYPETSSKGDVISGDIKQYDTTIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +V  N   NGGRVL    LGK +  + + AY  +E+ID++   +R DIG +
Sbjct: 361 FHSGTKLVGENYVTNGGRVLGVVGLGKDLRTALDRAYERIEHIDFEGMQYRTDIGAK 417


>gi|269797436|ref|YP_003311336.1| phosphoribosylamine/glycine ligase [Veillonella parvula DSM 2008]
 gi|269094065|gb|ACZ24056.1| phosphoribosylamine/glycine ligase [Veillonella parvula DSM 2008]
          Length = 420

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 198/417 (47%), Positives = 271/417 (64%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IGSGGREHALAW+++ SP ++++++IPG+  ++  A+ V ID Q    +I F +E
Sbjct: 1   MKVCVIGSGGREHALAWRLSISPSVTKVYAIPGSAAMSDCAELVGIDWQQSDHLISFLKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G++D LN AG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NEVDLVVVGPEAPLVAGLADVLNKAGIPVFGPSKAAAQLEGSKVFAKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F    +AK ++     PIVVKADGL AGKGVVVA TVDEA +A++       F    S
Sbjct: 121 GVFHKIDEAKAFIAQTEAPIVVKADGLAAGKGVVVAMTVDEANAAVEDMLSGNRFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++EG E S  A  DGKT +P   ++DHKRI DGD G NTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMEGEEASLLAFVDGKTVVPMIASQDHKRIFDGDKGANTGGMGTYAPAPVLTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M+KE  P+ G L+AGLMIT++GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDEAMKTILEPMVAAMEKEGMPYVGCLYAGLMITDEGPKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+ EI+ +C  G L    + WK   A  V++A+KGYPE    G +IS   +   TT +
Sbjct: 301 DSDLGEIMMACATGTLTADMVKWKDSSAACVILASKGYPETSSKGDVISGDIKQYDTTIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +V  N   NGGRVL    LGK +  + + AY  +E+ID++   +R DIG +
Sbjct: 361 FHSGTKLVGENYVTNGGRVLGVVGLGKDLRTALDRAYGRIEHIDFEGMQYRTDIGAK 417


>gi|312884770|ref|ZP_07744471.1| phosphoribosylamine--glycine ligase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367683|gb|EFP95234.1| phosphoribosylamine--glycine ligase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 427

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/426 (47%), Positives = 281/426 (65%), Gaps = 11/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A  ++   V ID++N S +++F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETVFIAPGNAGTALESKLENVNIDVENISDLVNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QEK + L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QEKQVALTIVGPEAPLVLGVVDAFREAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
           +Y++F++   A  YV+    PIVVKADGL AGKGV+VA T+DEA +AI        F + 
Sbjct: 121 SYENFTEIEPAIDYVRKHGAPIVVKADGLAAGKGVIVAMTLDEAETAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+LEG E SF  + DG++ +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLEGEEASFIVMVDGQSVLPMATSQDHKRVGDNDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHQKILEEVIYPTVRGMDAEGYPYTGFLYAGLMIDASGQPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    V   L      W  E A+ VV+A  GYP +Y  G +I  +P++   
Sbjct: 301 MRMESDLVELCLMAVDQKLDQAESKWSNEAAVGVVLAAGGYPGQYQKGAVI-HLPESQDV 359

Query: 353 -TQLFHAGT-AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  NGGRVL ATALG T+ E+++ AY +++ I W   ++R DIG
Sbjct: 360 WAKVFHAGTRSDSNQQVLTNGGRVLCATALGNTVLEAQQRAYELIKEISWDGMFYRGDIG 419

Query: 411 LQKKER 416
            +  +R
Sbjct: 420 YRAIQR 425


>gi|260577258|ref|ZP_05845232.1| phosphoribosylamine/glycine ligase [Rhodobacter sp. SW2]
 gi|259020502|gb|EEW23824.1| phosphoribosylamine/glycine ligase [Rhodobacter sp. SW2]
          Length = 420

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/417 (49%), Positives = 277/417 (66%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHALAW I Q+P    L   PGN GIA  A+C  IDI + + ++ FC+E
Sbjct: 1   MNILILGGGGREHALAWAIKQNPKCDRLIVAPGNAGIALLAECAGIDILDGAEVVTFCEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VV+GPE PL  G++DA  AAG   FGPS  AA+LE+SK+F K+ C     PTA Y
Sbjct: 61  NAIDFVVIGPEAPLAAGVADACRAAGLLTFGPSAAAARLEASKAFTKEICDACAAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
             F+ P  AK Y++ +  PIVVKADGL AGKGV+VAAT+ +A +AID  F        + 
Sbjct: 121 ARFTTPEPAKAYIRTQGAPIVVKADGLAAGKGVIVAATIAQALAAIDDMFGGEYGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG TA+P  TA+DHKR  DGD+GPNTGGMGA SPA  +++ +
Sbjct: 181 VVIEEFMAGEEASFFILTDGTTALPIGTAQDHKRAFDGDLGPNTGGMGAYSPAPCLTEAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++I+LPTI  M +   P+QGVL+AGLMI +    L+EYN RFGDPE Q +M+RL 
Sbjct: 241 AEQAMRQIVLPTIAEMARRGTPYQGVLYAGLMIEDGRARLVEYNARFGDPETQVLMLRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTT 353
           +  L++L +   G L +  +NW  ++ALTVV+A KGYP  Y  G+ I   + +P+++   
Sbjct: 301 AQTLDLLLATAEGRLADMRVNWAEDHALTVVMAAKGYPGAYAKGSAIHGLNTLPEDS-FH 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             FHAGTA  +  +TANGGRVL+ TA G ++ E++  AY MV+ IDW  G+ R DIG
Sbjct: 360 MTFHAGTASHDGQITANGGRVLNVTARGASLAEAQSSAYAMVDAIDWPEGFCRRDIG 416


>gi|149190647|ref|ZP_01868915.1| phosphoribosylamine--glycine ligase [Vibrio shilonii AK1]
 gi|148835530|gb|EDL52499.1| phosphoribosylamine--glycine ligase [Vibrio shilonii AK1]
          Length = 429

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A   +   VAID+++   ++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKVAQNPNVETVFVAPGNAGSALEPKLENVAIDVEDIQGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++K+I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KDKNIELTIVGPEAPLVIGVVDAFQEAGLAIFGPTQAAAQLEGSKAFTKDFLARHAIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MR++SD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +P     
Sbjct: 301 MRMQSDMVELCQAAIDKKLDQVESKWDPRASIGIVLAAGGYPASYNKGDVISGLPTTEVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  + N+  NGGRVL ATALG T++E++  AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTADKDGNVVTNGGRVLCATALGNTVSEAQARAYELTKKISWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|126725607|ref|ZP_01741449.1| phosphoribosylamine--glycine ligase [Rhodobacterales bacterium
           HTCC2150]
 gi|126704811|gb|EBA03902.1| phosphoribosylamine--glycine ligase [Rhodobacterales bacterium
           HTCC2150]
          Length = 420

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/419 (46%), Positives = 277/419 (66%), Gaps = 8/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P    L   PGN GIAQ A C+  DI + +A++   + 
Sbjct: 1   MNILILGSGGREHALAWAVKQNPKCDRLLVAPGNAGIAQIATCLPCDIDDGAAVLALAEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++ID V++GPE PL NG++D L AA    FGPS  AA+LE+SKSF K+ C     PTA +
Sbjct: 61  ENIDFVIIGPEAPLANGVADDLRAARISCFGPSAAAAQLEASKSFTKEVCDAANAPTAAW 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
             F+ P  AK+Y++ K  PIV+KADGL AGKGV+VA  ++ A  AID  F        + 
Sbjct: 121 ARFTQPGPAKEYIREKGAPIVIKADGLAAGKGVIVAMDLEAALGAIDDMFGGEFGAAGTE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+++G E S+F LCDGK  +P  TA+DHKR+ DGD+GPNTGGMGA SPA  ++ E+
Sbjct: 181 VVVEEFMDGAEASYFILCDGKNTLPIGTAQDHKRVFDGDLGPNTGGMGAYSPAPVLTDEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +II P ++ M +   P+QGVL+AG MI +    L+EYN RFGDPE Q +MMRL 
Sbjct: 241 AARAMAEIIQPCVDEMARRGTPYQGVLYAGFMIKDGQARLVEYNARFGDPETQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIIS---KIPQNTGTT 353
           +  L+++ +C  G L    +NW  ++A+TVV A  GYP  Y  G++I+    +P+++   
Sbjct: 301 AQALDLMLACAEGRLDKAQVNWADDHAITVVYAANGYPGSYTKGSVINGLDALPEDS-HH 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAGT  V + +TA GGRVL+ TA G T+ ++ + AY M+ +IDW  G++R DIG Q
Sbjct: 360 MVFHAGTTAVGDTITATGGRVLNVTARGDTLQQAHDRAYAMIHDIDWPEGFYRRDIGYQ 418


>gi|182677999|ref|YP_001832145.1| phosphoribosylamine--glycine ligase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633882|gb|ACB94656.1| phosphoribosylamine--glycine ligase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 421

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 227/421 (53%), Positives = 291/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHA+A  +A+SPLLS L+  PGNPG+ + A+ V + I+NH A+I FC+ 
Sbjct: 1   MNVLLIGSGGREHAIAKTLAKSPLLSTLFVAPGNPGMMEIAEPVVLKIENHQAVIDFCRL 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I LVV+GPE+PLV G++D L AAG KVFGPSQ AA+LE SK+F K+FC ++GIPTA  
Sbjct: 61  QAIGLVVIGPEVPLVAGLTDPLVAAGIKVFGPSQAAAQLEGSKNFTKQFCLEHGIPTAQA 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF--QQINSTVI 178
           Q F +   AK Y   + +PIVVKADGL AGKGVVVAAT  EA +AID+ F      + ++
Sbjct: 121 QSFDEAAPAKAYAATRPLPIVVKADGLAAGKGVVVAATHAEAEAAIDQIFAGGIGGNGLL 180

Query: 179 IEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYS 238
           IE++LEG E SFFALCDG +A+PF +A+DHKR+ +GD G NTGGMGA SPA  M   +  
Sbjct: 181 IEDFLEGEEASFFALCDGTSALPFASAQDHKRVGEGDTGANTGGMGAYSPAPVMDAAMTE 240

Query: 239 TVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESD 298
            VI +II PT++GM     PF+G+LFAGLMI   GP LIEYNVRFGDPE Q M+ RL+ D
Sbjct: 241 RVIDEIITPTVKGMAARGTPFKGMLFAGLMIGPAGPKLIEYNVRFGDPETQVMLPRLQDD 300

Query: 299 ILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--TQLF 356
           +L +L +C  G+L    +++  E ALTVV+A KGYPE    G+ I  + +        L 
Sbjct: 301 LLALLLACAEGHLPQKPLHFADEVALTVVLAAKGYPEAPQKGSEIRGVEKAASLPGVSLT 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT      L A+GGRVL+ T LGK + E+RE AY  V+ IDW  G+ R DIG +  +R
Sbjct: 361 HAGTRREGTKLLADGGRVLNVTGLGKDVAEARERAYAAVDLIDWPEGFCRHDIGWRALQR 420

Query: 417 N 417
           N
Sbjct: 421 N 421


>gi|117926739|ref|YP_867356.1| phosphoribosylamine--glycine ligase [Magnetococcus sp. MC-1]
 gi|117610495|gb|ABK45950.1| phosphoribosylamine--glycine ligase [Magnetococcus sp. MC-1]
          Length = 456

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/425 (46%), Positives = 268/425 (63%), Gaps = 8/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL++G GGREHAL WKI QSPL+  ++  PGN GIAQ A CV I + +  A+  F  E
Sbjct: 23  MNVLVVGGGGREHALVWKITQSPLVGTVYCAPGNAGIAQLATCVEISVDDLRAMKQFAIE 82

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I+LVV+GPE+PLV G++D +  AG KVFGP++ AA +E SK+  K+ C +Y +PTA Y
Sbjct: 83  KKIELVVIGPEVPLVMGMADEMQEAGMKVFGPNKAAAAIEGSKTLMKELCQRYKVPTAEY 142

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F+D   AK YV  +  PIVVK  GL AGKG +V  TV +A  AIDR      F     
Sbjct: 143 RTFTDAEAAKAYVAGEGAPIVVKTSGLAAGKGAIVCLTVPQAIEAIDRIMVKREFGHAGD 202

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSP-ALGMSQ 234
            V+IEE+LEG E SF AL DGKT +P   ++DHK + +GD GPNTGGMGA SP AL    
Sbjct: 203 EVVIEEFLEGEEASFLALVDGKTILPLAGSQDHKAVGEGDTGPNTGGMGAYSPAALLDDD 262

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
           E+   V+ ++++P ++GM  +  P++GVL+AGLMI       +E+N RFGDPECQ ++MR
Sbjct: 263 EMVRRVMDQVMIPIVQGMAADGMPYKGVLYAGLMIHNGRIKTLEFNARFGDPECQPLLMR 322

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           ++SDI+ +L +C  G LH   I W +  A+ VV+A  GYP  Y  G  I+ + +    T 
Sbjct: 323 MKSDIMPLLLACADGTLHEHEIEWDSRTAMCVVMAAGGYPNMYEKGLPITGLEEAAELTD 382

Query: 355 --LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
             +FHAGT   N ++  +GGR+L  T LG+    +R  AY  V  I WK  Y+R DIG +
Sbjct: 383 CMVFHAGTRRHNGHVLTDGGRILGVTGLGEGAIGARINAYEAVRKIHWKDAYYRRDIGYR 442

Query: 413 KKERN 417
             ER 
Sbjct: 443 AVERE 447


>gi|302785984|ref|XP_002974764.1| hypothetical protein SELMODRAFT_102290 [Selaginella moellendorffii]
 gi|300157659|gb|EFJ24284.1| hypothetical protein SELMODRAFT_102290 [Selaginella moellendorffii]
          Length = 437

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/435 (47%), Positives = 279/435 (64%), Gaps = 15/435 (3%)

Query: 4   LLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI--AQHAQCVA-IDIQNHSAIIHFCQE 60
           L+IG GGREHAL + + ++     ++  PGN GI  A  A C+A +D+ +  A+I FC+ 
Sbjct: 1   LVIGGGGREHALCYGLQRAASCDGVFCAPGNIGISIAGDATCIADLDVSDSVAVISFCKR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             + LVVVGPE PLV G+ D L  AG   FGPS  AA LE SKSF K FC KY IPTA Y
Sbjct: 61  WEVGLVVVGPEAPLVAGLVDDLVEAGIPAFGPSASAAALEGSKSFMKDFCDKYKIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ-----INS 175
           + F+DP  AK Y+  + +PIVVKADGL AGKGV VA +++EA  A+D    Q        
Sbjct: 121 RSFTDPSAAKHYISEEGVPIVVKADGLAAGKGVTVAMSLEEAYEAVDTMLVQGALGSAGG 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE+L+G E SFFA+ DG TA+P  +A+DHKR+ DGDIGPNTGGMGA SPA  +   
Sbjct: 181 KIVVEEFLDGEEASFFAIVDGHTALPLASAQDHKRVGDGDIGPNTGGMGAYSPAPMVDSR 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMMM 293
           L S V+  IILPT++GM +E   + G+L+AGLMI ++   P L+EYNVRFGDPECQ +MM
Sbjct: 241 LESLVMDTIILPTVKGMAEEGCKYVGILYAGLMIDKKTGIPKLLEYNVRFGDPECQVLMM 300

Query: 294 RLESDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           R ESD+ ++L +   G L +   + W  + AL VV+A+ GYP  Y  GT+I  + +    
Sbjct: 301 RFESDLAKLLLAACKGELKDIEGLKWTKDPALVVVLASSGYPGNYKKGTLIKNLDEAEAA 360

Query: 353 ---TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
               ++FHAGT +  + ++ A GGRVL  TALGK I E++  AY  V+ + W  G+ R D
Sbjct: 361 VRGVKVFHAGTDVDSDGHIVAVGGRVLGVTALGKDIAEAQNRAYQAVDVVSWPDGFCRRD 420

Query: 409 IGLQKKERNVKYRNK 423
           IG +   R  + R++
Sbjct: 421 IGWRAVARLAEARHR 435


>gi|313893821|ref|ZP_07827387.1| phosphoribosylamine--glycine ligase [Veillonella sp. oral taxon 158
           str. F0412]
 gi|313441385|gb|EFR59811.1| phosphoribosylamine--glycine ligase [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 420

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/417 (46%), Positives = 274/417 (65%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IG+GGREHALAW+++ SP ++++++IPG+  ++  A+ V ID Q    +I F ++
Sbjct: 1   MKVCVIGNGGREHALAWRLSISPSVTKVYAIPGSAAMSDCAELVGIDWQQSDHLIRFLKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            H+DLVVVGPE PLV G++D LN AG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NHVDLVVVGPEAPLVAGLADVLNKAGIPVFGPSKAAAQLEGSKVFAKDVMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F +  +AK+++     PIVVKADGL AGKGVVVA T++EA +A++       F    S
Sbjct: 121 GVFHNVDEAKEFIAQTGAPIVVKADGLAAGKGVVVAMTIEEANAAVEDMLRGNRFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++EG E S  A  DGKT +P   ++DHKRI DGD GPNTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMEGEEASLLAFVDGKTVVPMIASQDHKRIFDGDKGPNTGGMGTYTPAPVLTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M+KE  P+ G L+AGLMIT QGP ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDEAMKTILAPVVAAMEKEGMPYVGCLYAGLMITPQGPKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+ +I+ +CV G L    + WK   A  V++A+KGYPE    G +I    +   TT +
Sbjct: 301 DSDLGQIMMACVTGTLTADMVKWKDSSAACVILASKGYPETSSKGDVIHGDIKQHDTTIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT ++ +    NGGRVL    LGK +  + + AY  +E+ID++   +R DIG +
Sbjct: 361 FHSGTKLIGDEYVTNGGRVLGVVGLGKDLRTALDRAYGRIEHIDFEGMQYRTDIGAK 417


>gi|302760507|ref|XP_002963676.1| hypothetical protein SELMODRAFT_80448 [Selaginella moellendorffii]
 gi|300168944|gb|EFJ35547.1| hypothetical protein SELMODRAFT_80448 [Selaginella moellendorffii]
          Length = 437

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/435 (47%), Positives = 279/435 (64%), Gaps = 15/435 (3%)

Query: 4   LLIGSGGREHALAWKIAQSPLLSELWSIPGNPGI--AQHAQCVA-IDIQNHSAIIHFCQE 60
           L+IG GGREHAL + + ++     ++  PGN GI  A  A C+A +D+ +  A+I FC+ 
Sbjct: 1   LVIGGGGREHALCYGLQRAASCDGVFCAPGNIGISIAGDATCIADLDVSDSVAVISFCKR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             + LVVVGPE PLV G+ D L  AG   FGPS  AA LE SKSF K FC KY IPTA Y
Sbjct: 61  WEVGLVVVGPEAPLVAGLVDDLVEAGIPAFGPSASAAALEGSKSFMKDFCDKYKIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ-----INS 175
           + F+DP  AK Y+  + +PIVVKADGL AGKGV VA +++EA  A+D    Q        
Sbjct: 121 RSFTDPSAAKHYISEQGVPIVVKADGLAAGKGVTVAMSLEEAYEAVDTMLVQGALGSAGG 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE+L+G E SFFA+ DG TA+P  +A+DHKR+ DGDIGPNTGGMGA SPA  +   
Sbjct: 181 KIVVEEFLDGEEASFFAIVDGHTALPLASAQDHKRVGDGDIGPNTGGMGAYSPAPMVDSR 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMMM 293
           L S V+  IILPT++GM +E   + G+L+AGLMI ++   P L+EYNVRFGDPECQ +MM
Sbjct: 241 LESLVMDTIILPTVKGMAEEGCKYVGILYAGLMIDKKTGIPKLLEYNVRFGDPECQVLMM 300

Query: 294 RLESDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           R ESD+ ++L +   G L +   + W  + AL VV+A+ GYP  Y  GT+I  + +    
Sbjct: 301 RFESDLAKLLLAACKGELKDIEGLKWTKDPALVVVLASSGYPGNYKKGTLIKNLDEAEAA 360

Query: 353 ---TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
               ++FHAGT +  + ++ A GGRVL  TALGK I E++  AY  V+ + W  G+ R D
Sbjct: 361 VRGVKVFHAGTDVDSDGHIVAVGGRVLGVTALGKDIAEAQNRAYQAVDVVSWPDGFCRRD 420

Query: 409 IGLQKKERNVKYRNK 423
           IG +   R  + R++
Sbjct: 421 IGWRAVARLAEARHR 435


>gi|170747941|ref|YP_001754201.1| phosphoribosylamine--glycine ligase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654463|gb|ACB23518.1| phosphoribosylamine--glycine ligase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 424

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/420 (49%), Positives = 272/420 (64%), Gaps = 3/420 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQ 59
           M +LLIGSGGREHALAW++AQSPL + L++ PGNPG A+H      + + +H+A+  FC 
Sbjct: 1   MNILLIGSGGREHALAWRLAQSPLCTRLFTAPGNPGTARHGTNRPDLKVTDHAAVAAFCA 60

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
            + I LVVVGPE PLV G+ D L AAG + FGP++ AA+LE SK F K  C    IPTA 
Sbjct: 61  AESIGLVVVGPEAPLVAGLVDDLKAAGIRAFGPTRDAARLEGSKGFTKDLCAACNIPTAA 120

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII 179
           +  F++   A  YV+ +  PIVVKADGL AGKGV VA TVD+A  A+   F +  + V++
Sbjct: 121 FARFTELEPALAYVRQQGAPIVVKADGLAAGKGVTVAETVDQAEDALTALFAEPGAEVVV 180

Query: 180 EEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYST 239
           EE L G E SFFALCDG  AIP  TA+DHKR+ DGD GPNTGGMGA SPA  ++ E+ + 
Sbjct: 181 EECLFGEEASFFALCDGTRAIPLGTAQDHKRVFDGDRGPNTGGMGAYSPARVVTPEIEAR 240

Query: 240 VIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDI 299
           V+ +II PT+ GM+    PF G+L+AGLM+T  GP LIEYN RFGDPE Q +M RL SD+
Sbjct: 241 VMAEIIAPTLAGMRARGCPFTGILYAGLMLTADGPKLIEYNTRFGDPEAQVLMPRLASDL 300

Query: 300 LEILNSCVHGNLHNTHINWKA-EYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQLFH 357
           +  L S   G+L    + +     ALTVV+A  GYP     G++I  +    G    +F 
Sbjct: 301 VPALLSACDGDLSGVGLEFDPHRAALTVVMAAAGYPGAVVRGSVIRGVDAAEGDGVHVFQ 360

Query: 358 AGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           AGT   +  L A+GGRVL+ TALG ++T+++  AY  V  IDW  G+ R DIG +   R 
Sbjct: 361 AGTRAEDGQLLADGGRVLAVTALGDSVTDAKARAYAAVARIDWPEGFCRRDIGFRAVARE 420


>gi|255079148|ref|XP_002503154.1| predicted protein [Micromonas sp. RCC299]
 gi|226518420|gb|ACO64412.1| predicted protein [Micromonas sp. RCC299]
          Length = 429

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/433 (46%), Positives = 273/433 (63%), Gaps = 14/433 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           + VL+IGSGGREHAL W++ QSP   EL+  PGN GI        +D++  +H+A+I FC
Sbjct: 1   VNVLVIGSGGREHALCWRLKQSPTCGELFCTPGNAGIIVEDGVQVVDVKESDHAAVIKFC 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ ++ LVVVGPE PLV+GI+DAL AA    FGP++ AA+LE SK F K    KY IPTA
Sbjct: 61  KDNNVGLVVVGPEAPLVDGIADALIAADIPCFGPTKDAARLEGSKGFLKDLLKKYNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y+ F+DP  AK+Y+Q +  PIVVK DGL AGKGV+VA  V  A  A+D       F   
Sbjct: 121 KYERFTDPEAAKKYIQKEGAPIVVKTDGLAAGKGVIVAMDVQTALDAVDDMMVNSAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + +++E++L+G E SFFA+  G  AIP   A+DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GAEIVVEDFLDGEEASFFAVVGGGKAIPLVGAQDHKRVGEGDTGLNTGGMGAYSPAPVLT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
             + + V+  II PT++GM  E  PF GV+FAGLMI      L+E+NVRFGDPECQ +M 
Sbjct: 241 PAIEAKVMNDIIQPTVDGMAAEGCPFTGVIFAGLMIKGDDVKLLEHNVRFGDPECQCLMA 300

Query: 294 RLESDILEILNSCVHGNLHNT-HINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           R+ SD++++L     G L     + W  + A+ VVVA  GYP  Y  G +I  +      
Sbjct: 301 RMRSDLVDLLLKAAKGELDKVGELQWSEDMAINVVVAADGYPGSYAKGEMIGGLDAANAM 360

Query: 353 --TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
              ++FHAGTA+ +  +T+ GGRVL  TA GK ITE+ + +Y  V+ I+W  G+ R DIG
Sbjct: 361 DGVKVFHAGTAMKDGKVTSAGGRVLGVTATGKNITEAAKKSYAAVDVIEWPGGFVRRDIG 420

Query: 411 LQKKERNVKYRNK 423
                R +   NK
Sbjct: 421 ----HRAIARENK 429


>gi|227115026|ref|ZP_03828682.1| phosphoribosylamine--glycine ligase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 428

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/425 (46%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHALAWK +QSPL   ++  PGN G A       +DI   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKASQSPLAKRVYVAPGNAGTALEPALTNVDIAATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPTQGAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ    
Sbjct: 301 LRLRSDLVELCLAACDGTLDQKDSVWDERPSLGVVLAAGGYPADYNTGDVISGLPQQDAE 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAIER 425


>gi|290476982|ref|YP_003469893.1| phosphoribosylglycinamide synthetase [Xenorhabdus bovienii SS-2004]
 gi|289176326|emb|CBJ83131.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Xenorhabdus
           bovienii SS-2004]
          Length = 427

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  A    IDI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEANLENIDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q +HI L +VGPE PLV GI DA   AG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSQHIGLTIVGPETPLVIGIVDAFQQAGLTIFGPTKAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++    PIV+KADGL AGKGVVVA T++EA +A+        F   
Sbjct: 121 AYQNFTEIEPALTYLKKMGAPIVIKADGLAAGKGVVVAMTMEEAQNAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGKNVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V++K+I PT+EGM  E + + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMEKVIYPTVEGMAAEGHTYTGFLYAGLMIDKQGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL SD++E+  +   G L      W    AL VV++  GYP  Y  G +IS + Q T T
Sbjct: 301 MRLRSDLVELCLAGAQGQLSGKTSEWDTRPALGVVLSAGGYPANYVKGDVISGLNQETDT 360

Query: 353 TQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            + +FHAGTA  + ++   GGRVL  TALG  I E+++ AY   E I W+  ++R+DIG 
Sbjct: 361 DEKVFHAGTAFKDKDVVTAGGRVLCVTALGDDIAEAQKKAYLRAEKIGWQGCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|168002972|ref|XP_001754187.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162694741|gb|EDQ81088.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 459

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/428 (46%), Positives = 279/428 (65%), Gaps = 14/428 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAI---DIQNHSAIIHFCQ 59
           VL+IG GGREHAL   + +SP  +E++  PGN GI +    + +   DI++  A+I FC+
Sbjct: 25  VLVIGGGGREHALCHALQRSPTCNEVFCAPGNAGIGKSGDAICVRELDIKDSEAVIEFCK 84

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  + LVVVG E PLV G+ D L   G   FGPS  AA LE SK+F K+ C KY IPTA 
Sbjct: 85  KSGVGLVVVGLEAPLVAGLVDDLADVGILAFGPSAAAASLEGSKNFMKRLCDKYEIPTAK 144

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQIN 174
           YQ F+D  +AK+Y++ +  PIV+KADGL AGKGVVVA T++EA +A+D       F    
Sbjct: 145 YQSFTDAAEAKKYIKEQGAPIVIKADGLAAGKGVVVAMTLEEAYAAVDSMLVSSEFGSAG 204

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
             V++EE+L+G EVSFFAL DG+ A+P  +A+DHKR+ DGD GPNTGGMGA SPA  ++ 
Sbjct: 205 GLVLVEEFLDGEEVSFFALVDGENALPMASAQDHKRVGDGDTGPNTGGMGAYSPAPALTP 264

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVRFGDPECQAMM 292
           E+   V++ II PT++GM+ E   + GVL+AG++I ++   P L+EYNVRFGDPECQ ++
Sbjct: 265 EIEQKVMETIIYPTVKGMRAEGCKYLGVLYAGVIIEKKNGLPKLLEYNVRFGDPECQVLL 324

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--- 349
           +RL+SD++++L +   G L+   + W  E AL +V+A+ GYP +Y  GT I  +      
Sbjct: 325 IRLQSDLVQVLLAACKGGLNGVQLEWTEEPALVIVMASNGYPGKYVTGTRIKNLDVAEVI 384

Query: 350 TGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
               ++FHAGT +   + + A GGRVL   A+GK I E++  AY  V  IDW  G++R D
Sbjct: 385 APGVKIFHAGTTMNAEHEIVATGGRVLGVAAVGKDIAEAQSKAYKAVHQIDWPEGFFRND 444

Query: 409 IGLQKKER 416
           IG +   R
Sbjct: 445 IGWRAVSR 452


>gi|225176025|ref|ZP_03730017.1| phosphoribosylamine/glycine ligase [Dethiobacter alkaliphilus AHT
           1]
 gi|225168613|gb|EEG77415.1| phosphoribosylamine/glycine ligase [Dethiobacter alkaliphilus AHT
           1]
          Length = 424

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/424 (47%), Positives = 272/424 (64%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL++GSGGREH LAWK+ QSP + +++  PGN GIAQ A+CV I + N  A++ F  E
Sbjct: 1   MRVLIVGSGGREHVLAWKLLQSPQVQKVYCAPGNAGIAQIAECVPISVDNIEALVAFGLE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I L VVGPE PL  G+ DA  AAG + FGPS+ AA+LE SK FAK+   KY IPTA  
Sbjct: 61  HDIQLTVVGPEAPLTAGMVDAFTAAGLEAFGPSKEAAQLEGSKIFAKQIMEKYNIPTAES 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
           + F+   KA  Y+  K  PIVVKADGL AGKGVVVA TV+EA  A     +D+ F    +
Sbjct: 121 RTFTSADKALAYLAEKGAPIVVKADGLAAGKGVVVATTVEEAEDAVKRIMVDKEFGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VIIEE+L+G EVS  A  DG T +P  +++DHK  +DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVIIEEFLQGEEVSVLAFTDGNTVVPMVSSQDHKAAYDGDTGPNTGGMGAYSPAPILTDQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V + ++ PT++G+++E   F+G+L+AGLMIT QGP ++E+NVRFGDPECQ ++ RL
Sbjct: 241 LLAEVEETVLRPTVDGLRQEGITFKGILYAGLMITAQGPKVLEFNVRFGDPECQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTT 353
           +SD+  I+ S +H  LH   I W   +   VV+A+ GYP +Y  G  I  +         
Sbjct: 301 KSDLSAIMLSVIHRCLHEETIEWYDNHTACVVMASGGYPGKYTKGKEIKGLDDAATLDDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            ++HAGTA     +   GGRVL  TA G T+  + E AY  V+ I +   ++R+DIG + 
Sbjct: 361 YVYHAGTAEKGKKIVTAGGRVLGVTAWGDTLPAALEKAYAAVDKITFDGAHYRKDIGQKA 420

Query: 414 KERN 417
             R 
Sbjct: 421 LRRK 424


>gi|282849163|ref|ZP_06258548.1| phosphoribosylamine--glycine ligase [Veillonella parvula ATCC
           17745]
 gi|282580867|gb|EFB86265.1| phosphoribosylamine--glycine ligase [Veillonella parvula ATCC
           17745]
          Length = 420

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/417 (46%), Positives = 270/417 (64%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IGSGGREHALAW+++ SP ++++++IPG+  ++  A+ V ID Q    +I F ++
Sbjct: 1   MKVCVIGSGGREHALAWRLSISPSVTKVYAIPGSAAMSDCAELVGIDWQQSDHLISFLKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G++D LN AG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NQVDLVVVGPEAPLVAGLADVLNKAGIPVFGPSKAAAQLEGSKVFAKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F    +AK ++     PIVVKADGL AGKGVVVA T+DEA  A++       F    S
Sbjct: 121 GVFHKVDEAKAFIAQTGAPIVVKADGLAAGKGVVVAMTIDEANVAVEDMLSGNRFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++EG E S  A  DGKT +    ++DHKRI DGD GPNTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMEGEEASLLAFVDGKTVVSMIASQDHKRIFDGDKGPNTGGMGTYAPAPVLTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M+KE  P+ G L+AGLMIT++G  ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDAAMKTILEPMVAAMEKEGMPYVGCLYAGLMITDEGSKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+ EI+ +C  G L +  + WK   A  V++A+KGYPE    G +IS   +   TT +
Sbjct: 301 DSDLGEIMMACAKGTLTSNMVKWKDSSAACVILASKGYPETSSKGDVISGDIKQYDTTIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +V  N   NGGRVL    LGK +  + + AY  +E+ID++   +R DIG +
Sbjct: 361 FHSGTKLVGENYVTNGGRVLGVVGLGKDLRTALDRAYERIEHIDFEGMQYRTDIGAK 417


>gi|270265440|ref|ZP_06193699.1| phosphoribosylamine--glycine ligase [Serratia odorifera 4Rx13]
 gi|270040633|gb|EFA13738.1| phosphoribosylamine--glycine ligase [Serratia odorifera 4Rx13]
          Length = 431

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 271/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A       VAI   +  A++ F 
Sbjct: 5   MNILIIGNGGREHALAWKVAQSPLADKVYVAPGNAGTALEPNLANVAISATDIPALVAFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 65  QSHDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  YV++K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 125 EYQNFTDVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVVEEFLDGEEASFIVMVDGENVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   + ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 245 DEIHQRAMDQVIWPTVRGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL SD++E+  +   G L      W    AL VV+A  GYP +Y +G +I  +PQ    
Sbjct: 305 LRLRSDLVELCLAGAEGKLGEKTSEWDDRPALGVVLAAGGYPGDYSNGDVIQGLPQQESV 364

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   ++  NGGRVL  TALG T+ E+++ AY + + I W+  + R DIG 
Sbjct: 365 DGKVFHAGTRMQGEDVVTNGGRVLCVTALGATVAEAQQRAYQLAKGIQWQGSFCRNDIGY 424

Query: 412 QKKER 416
           +   R
Sbjct: 425 RAIAR 429


>gi|332304565|ref|YP_004432416.1| phosphoribosylamine/glycine ligase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332171894|gb|AEE21148.1| phosphoribosylamine/glycine ligase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 429

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/427 (45%), Positives = 279/427 (65%), Gaps = 11/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG GGREHAL +K AQS  +S ++  PGN G A   +   V ID++   A++ F 
Sbjct: 1   MKVLIIGGGGREHALGFKAAQSDSVSHVYVAPGNAGTALEPKLENVPIDVEEIEALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  ++L +VGPE+PLV G+ DA  A G  +FGPS+ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KQNAVELTIVGPEVPLVLGVVDAFQAEGLAIFGPSKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTEIEPAIAYLQEKGAPIVIKADGLAAGKGVIVAMTLAEAEEAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+EGM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 DEIHQRVMNEVIYPTVEGMASEGNDYHGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--- 349
           +RL+SD++E++   V G L      +    A+ VV+A  GYP+ Y  G +IS +  +   
Sbjct: 301 LRLQSDLVELIQLAVAGKLDQATAQFDPRAAVGVVLAAGGYPQAYNKGDVISGLSLSDSA 360

Query: 350 TGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
             + ++FHAGT  V+  +T NGGRVL ATALG+T+T++++ AY +   I W+  ++R+DI
Sbjct: 361 DASAKVFHAGTKEVDGQVTTNGGRVLCATALGETVTQAQQRAYELANTISWEGMFYRDDI 420

Query: 410 GLQKKER 416
             +   R
Sbjct: 421 AYRAIAR 427


>gi|320155023|ref|YP_004187402.1| phosphoribosylamine--glycine ligase [Vibrio vulnificus MO6-24/O]
 gi|319930335|gb|ADV85199.1| phosphoribosylamine-glycine ligase [Vibrio vulnificus MO6-24/O]
          Length = 429

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTENKGGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|91228712|ref|ZP_01262625.1| phosphoribosylamine--glycine ligase [Vibrio alginolyticus 12G01]
 gi|91187738|gb|EAS74057.1| phosphoribosylamine--glycine ligase [Vibrio alginolyticus 12G01]
          Length = 429

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V ID+++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFIAPGNAGTALEPKLENVNIDVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTGNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|300721654|ref|YP_003710929.1| phosphoribosylglycinamide synthetase [Xenorhabdus nematophila ATCC
           19061]
 gi|297628146|emb|CBJ88697.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 427

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/425 (46%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL S+++  PGN G A       +DI   +   ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLASKVFVAPGNAGTALETNLENVDIAATDIEGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE+PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEVPLVIGVVDAFQQAGLTIFGPTKAAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
           TYQ+F++   A  Y++   +PIV+KADGL AGKGVVVA T++EA  A+        F   
Sbjct: 121 TYQNFTEIDPALAYLEKTGVPIVIKADGLAAGKGVVVAMTMEEAQGAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLAGEEASFIVMVDGKNVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V++KII PT+EGM  E + + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMEKIIYPTVEGMAAEGHTYTGFLYAGLMIDQQGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL SD++E+  +   G L     +W +  AL +V+A  GYP  Y  G +IS + ++T  
Sbjct: 301 MRLRSDLVELCLAGAKGKLGGKTSSWDSRPALGIVLAAGGYPANYAKGDVISGLAEDTNI 360

Query: 353 TQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            + +FHAGTAI +  +   GGRVL  TALG  I E++  AY   E+I W+  ++R+DIG 
Sbjct: 361 DEKIFHAGTAIKDETVVTAGGRVLCVTALGNNIAEAQRKAYQRAEHISWEKCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|254427148|ref|ZP_05040855.1| phosphoribosylamine--glycine ligase [Alcanivorax sp. DG881]
 gi|196193317|gb|EDX88276.1| phosphoribosylamine--glycine ligase [Alcanivorax sp. DG881]
          Length = 432

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 271/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQ+  +  ++  PGN G A+ A+   VAID+ +  A++ F 
Sbjct: 5   MKVLIIGGGGREHALAWKVAQAEQVETVFVAPGNAGTAREAKLENVAIDVLDQPALLAFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  IDL +VGPE PLV G+ D     G K FGPS+ AA+LE SK+F K F  +  IPT 
Sbjct: 65  QDNSIDLTIVGPEAPLVEGLVDTFQENGLKCFGPSKAAAQLEGSKAFTKDFLARQNIPTG 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D  +A  YV+ +  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 125 AYGNFTDMDEALTYVREQGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLDGNKFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+LEG E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 185 GHRVVVEEFLEGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             +Y  ++ ++I PT+EGM  E  P+ G L+AGLMI+ QG P +IEYN RFGDPE Q ++
Sbjct: 245 DAVYQRIMDEVITPTVEGMAAEGMPYTGFLYAGLMISPQGAPKVIEYNCRFGDPETQPIL 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL+SD+  +  + + G L  T I W     L VV+A  GYP+ Y  G +I  + Q ++ 
Sbjct: 305 MRLQSDLAGLCLAALDGKLDQTDIQWDPRPTLGVVMAAGGYPDSYNKGDVIDGLDQADSD 364

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           T ++FHAGTA  +  +  +GGRVL  T +G T+ E++  AY  V+ I W+   +R DIG 
Sbjct: 365 TVKVFHAGTAEKDGQVVTSGGRVLCVTGVGDTVGEAQANAYEGVKQITWRDAQYRSDIGY 424

Query: 412 QKKER 416
           +   R
Sbjct: 425 RAVAR 429


>gi|295401721|ref|ZP_06811687.1| phosphoribosylamine/glycine ligase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|294976208|gb|EFG51820.1| phosphoribosylamine/glycine ligase [Geobacillus thermoglucosidasius
           C56-YS93]
          Length = 430

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/415 (46%), Positives = 269/415 (64%), Gaps = 7/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+AWK AQSPL+++L++ PGNPGIAQ A+ V+ID Q+  A++ F ++
Sbjct: 1   MKVLIIGRGGREHAIAWKAAQSPLVTKLYAAPGNPGIAQVAELVSIDEQDIEALVQFAKQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL+ G++D+    G +VFGP + AA +E SK+FAK+   KYGIPTA +
Sbjct: 61  EKIDLTIVGPEAPLLAGLADSFMEEGLRVFGPRREAALIEGSKAFAKEMMKKYGIPTAEH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
             F+   +AK YV+ K  PIV+KADGL AGKGV VAAT+ EA  A     +++ F     
Sbjct: 121 AAFTSYEEAKAYVEKKGAPIVIKADGLAAGKGVTVAATLPEAMEALRMMMVEKRFGAAGE 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EEYLEG E S  A   G+   P   A+DHKR +D D GPNTGGMGA SP   +S E
Sbjct: 181 RVVVEEYLEGEEFSLMAFVHGERVYPMVIAQDHKRAYDNDQGPNTGGMGAYSPVPQISAE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
                + +II P  + +  E  PF GVL+AGLM T+QGP +IE+N RFGDPE Q ++ RL
Sbjct: 241 TIDAALSQIIEPMAKALVAEGRPFTGVLYAGLMATKQGPKVIEFNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD+++++   + G   +  + W  E  + VV+A KGYP  Y  G +I    Q    T L
Sbjct: 301 ESDLIQVMVDLLDG--RDVKLTWSNEAVIGVVLAAKGYPGTYERGAVIRGWDQLGENTLL 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FHAGT + +  L  NGGRVL   A G+T+ ++++ AY  + +I     ++R DIG
Sbjct: 359 FHAGTMMKDGMLCTNGGRVLLVVAKGETLKQAQQTAYEQISHITCDQLFYRRDIG 413


>gi|239825835|ref|YP_002948459.1| phosphoribosylamine--glycine ligase [Geobacillus sp. WCH70]
 gi|239806128|gb|ACS23193.1| phosphoribosylamine/glycine ligase [Geobacillus sp. WCH70]
          Length = 430

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/428 (46%), Positives = 272/428 (63%), Gaps = 7/428 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+AWK AQSPL+S L++ PGNPGIAQ A+ V+ID Q+  A++ F ++
Sbjct: 1   MKVLIIGRGGREHAIAWKAAQSPLVSRLYAAPGNPGIAQVAELVSIDEQDVEALVQFAKQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL+ GI D     G ++FGP + AA +E SK+FAK+   KYGIPTA +
Sbjct: 61  EGIDLTIVGPEAPLLAGIVDRFVEEGLRIFGPRKEAALIEGSKAFAKEMMKKYGIPTAEH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
             F+   +AK YV+ K  PIV+KADGL AGKGV+VAAT+ EA  A     +++ F + + 
Sbjct: 121 ATFTSYEEAKAYVEKKGAPIVIKADGLAAGKGVIVAATLPEAMEALSAMMVEKRFGEASK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYLEG E SF A   G+   P   A+DHKR +D D GPNTGGMGA SP   +S +
Sbjct: 181 QVVIEEYLEGEEFSFMAFVHGERVYPMVIAQDHKRAYDNDQGPNTGGMGAYSPVPQISAQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
                + +II P  + M  E  PF GVL+AGLM T+QGP +IE+N RFGDPE Q ++ RL
Sbjct: 241 TIDAALSQIIKPMAKAMAAEGRPFTGVLYAGLMATKQGPKVIEFNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+++++   +        + W  E  + VV+A KGYP +Y  G +I    Q   +  L
Sbjct: 301 QNDLIQVILDLLAD--REIELTWSEEAVIGVVLAAKGYPGKYERGAVIKGWEQLGESALL 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT + N  L  NGGRVL   A G+T+ ++++  Y  +  I     ++R DIG +  E
Sbjct: 359 FHAGTMMENGALCTNGGRVLLVAAKGETLKQAQQTVYERISYITCDQLFYRRDIGNKAIE 418

Query: 416 RNVKYRNK 423
           R    R +
Sbjct: 419 RAFSARTQ 426


>gi|312112471|ref|YP_003990787.1| phosphoribosylamine/glycine ligase [Geobacillus sp. Y4.1MC1]
 gi|311217572|gb|ADP76176.1| phosphoribosylamine/glycine ligase [Geobacillus sp. Y4.1MC1]
          Length = 430

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/415 (46%), Positives = 269/415 (64%), Gaps = 7/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+AWK AQSPL+++L++ PGNPGIAQ A+ V+ID Q+  A++ F ++
Sbjct: 1   MKVLIIGRGGREHAIAWKAAQSPLVTKLYAAPGNPGIAQVAELVSIDEQDIEALVQFAKQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL+ G++D+    G +VFGP + AA +E SK+FAK+   KYGIPTA +
Sbjct: 61  EKIDLTIVGPEAPLLAGLADSFMEEGLRVFGPRREAALIEGSKAFAKEMMKKYGIPTAEH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
             F    +AK YV+ K +PIV+KADGL AGKGV VAAT+ EA  A     +++ F     
Sbjct: 121 AAFISYEEAKAYVEKKGVPIVIKADGLAAGKGVTVAATLPEAMEALRMMMVEKRFGAAGE 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EEYLEG E S  A   G+   P   A+DHKR +D D GPNTGGMGA SP   +S E
Sbjct: 181 RVVVEEYLEGEEFSLMAFVHGERVYPMVIAQDHKRAYDNDQGPNTGGMGAYSPVPQISAE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
                + +II P  + +  E  PF GVL+AGLM T+QGP +IE+N RFGDPE Q ++ RL
Sbjct: 241 TVDAALSQIIEPMAKALAAEGRPFTGVLYAGLMATKQGPKVIEFNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD+++++   + G   +  + W  E  + VV+A KGYP  Y  G +I    Q    T L
Sbjct: 301 ESDLIQVMVDLLDG--RDVKLTWSNEAVIGVVLAAKGYPGTYERGAVIRGWDQLGENTLL 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FHAGT + +  L  NGGRVL   A G+T+ ++++ AY  + +I     ++R DIG
Sbjct: 359 FHAGTMMKDGMLCTNGGRVLLVAAKGETLKQAQQTAYEQISHITCDQLFYRSDIG 413


>gi|300112977|ref|YP_003759552.1| phosphoribosylamine/glycine ligase [Nitrosococcus watsonii C-113]
 gi|299538914|gb|ADJ27231.1| phosphoribosylamine/glycine ligase [Nitrosococcus watsonii C-113]
          Length = 437

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/433 (46%), Positives = 276/433 (63%), Gaps = 9/433 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSPL+  ++  PGN G A+   A+ + I   N SA++ F 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPLVDRVYVAPGNAGTAREPKAENIPIKSDNISALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + I+L VVGPE PLV GI DA   AG   +GP + AA LE SKSFAK+F T++GIPTA
Sbjct: 61  LAEQIELTVVGPEAPLVLGIVDAFEEAGLPCWGPRRGAAHLEGSKSFAKEFLTRWGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ FS    A  Y++ +  PIVVKADGL AGKGVVVA T +EA +A+     D  F + 
Sbjct: 121 RYQTFSQVEPAIAYIKTEGAPIVVKADGLAAGKGVVVARTEEEAIAAVHSMLGDGVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G E SF  + DG+  +P  +++DHK + +GD G NTGGMGA SPA  ++
Sbjct: 181 GCQVVVEEFLRGEEASFIVMSDGEHVLPLASSQDHKALEEGDRGLNTGGMGAYSPAPVLA 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           + ++  V+Q++I+PT+ GM +E  P++G L+AGLMI E G P ++EYN RFGDPE Q ++
Sbjct: 241 EAVHERVMQEVIVPTVRGMAEEGYPYRGFLYAGLMIAENGSPKVLEYNCRFGDPEAQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL SD++ +  + + G LH   ++W    AL VV+A KGYP  Y  G  I  +P     
Sbjct: 301 MRLRSDLVALCQAALAGRLHEVSVDWDPRAALGVVMAAKGYPGSYSFGDPIYGLPAPERE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FH GTA     +   GGRVL A  LG ++TE++  AY +V+ I WK  Y+R DIG 
Sbjct: 361 DRKVFHGGTAEEQGRIVTAGGRVLCACGLGNSVTEAQATAYGLVQQITWKEAYYRSDIGY 420

Query: 412 QKKERNVKYRNKS 424
           +   R      +S
Sbjct: 421 RAIAREADSMAES 433


>gi|253987887|ref|YP_003039243.1| phosphoribosylamine--glycine ligase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253779337|emb|CAQ82498.1| phosphoribosylglycinamide synthetase [Photorhabdus asymbiotica]
          Length = 427

 Score =  398 bits (1023), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 198/425 (46%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG--IAQHAQCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSPL  +++  PGN G  +  H + + I   +   ++ F 
Sbjct: 1   MNILIIGSGGREHALAWKAAQSPLADKIYVAPGNAGTELENHLENIDISATDIDGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I+L +VGPE PLV GI D    AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIELTIVGPEAPLVMGIVDVFQNAGLTIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y+    +PIV+KADGL AGKGV+VA T +EA SAI        F   
Sbjct: 121 AYQNFTEIEPALTYLDKVGVPIVIKADGLAAGKGVIVAMTREEARSAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DGK  IP  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLTGEEASFIVMVDGKNVIPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E + + G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRIMEEVIYPTVNGMAAEGHVYTGFLYAGLMINQDGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MR+ SD++E+  +   G L     +W    AL VV+A  GYP +Y  G II  +PQ   G
Sbjct: 301 MRMHSDLIELCLAGAKGELAGKTSDWDKRPALGVVLAANGYPADYHKGDIIHGLPQQENG 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++FHAGTA+ +NN+  +GGRVL  TALG+TI  +++ AY   E I W   ++R+DIG 
Sbjct: 361 SNKVFHAGTALQDNNVITSGGRVLCVTALGETIANAQKNAYQQAEQITWNGCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|157368541|ref|YP_001476530.1| phosphoribosylamine--glycine ligase [Serratia proteamaculans 568]
 gi|157320305|gb|ABV39402.1| phosphoribosylamine--glycine ligase [Serratia proteamaculans 568]
          Length = 427

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A   + + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALESNLENVAISATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y+++K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTEVEPALAYLRSKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+LEG E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLEGEEASFIVMVDGENVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   + +II PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRAMDQIIWPTVRGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL SD++E+  +   G L      W    AL VV+A  GYP +Y +G +I  +PQ  + 
Sbjct: 301 LRLRSDLVELCLAGAEGKLGEKTSEWDERPALGVVLAAGGYPGDYNNGEVIQGLPQQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  N++  +GGRVL  TALG+++ ++++ AY + E I W   + R+DIG 
Sbjct: 361 DGKVFHAGTRMQGNDVVTSGGRVLCVTALGESVAQAQQRAYQLAEGIQWPGSFSRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|149376842|ref|ZP_01894598.1| phosphoribosylamine--glycine ligase [Marinobacter algicola DG893]
 gi|149358849|gb|EDM47317.1| phosphoribosylamine--glycine ligase [Marinobacter algicola DG893]
          Length = 428

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/425 (44%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSP    ++  PGN G A+    + + ID+ + + +  F 
Sbjct: 1   MNILVIGSGGREHALAWKAAQSPDADRVFVAPGNAGTAREPGLENINIDVMDLNGLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              H+ L +VGPE PLV+GI D     G +VFGPS  AA+LE SK+F K F  +  IPTA
Sbjct: 61  AANHVGLTIVGPEAPLVDGIVDLFEERGLRVFGPSAGAAQLEGSKAFTKDFLDRQDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y +F+D  +A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTDVDQALDYVRKQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  ++ ++I PT+ GM  E +P++G L+AGLMI  +G P +IE+N RFGDPE Q +M
Sbjct: 241 QDVHKRIMDEVIYPTVRGMAAEGHPYKGFLYAGLMIDGEGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+  + ++G L     +W    ++ +V+A  GYP  Y  G +IS +P++ T 
Sbjct: 301 LRMKSDLVELCGAAIYGKLDQCRSDWDERASVGIVLAAGGYPGSYNKGDVISGLPESETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +    +  NGGRVL ATALG T+TE+++ AY +   I W   ++R+DI  
Sbjct: 361 GEKVFHAGTRLNGEQVVTNGGRVLCATALGNTVTEAQKRAYEVAARISWDGAFYRKDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|27364629|ref|NP_760157.1| phosphoribosylamine--glycine ligase [Vibrio vulnificus CMCP6]
 gi|31076952|sp|Q8DD07|PUR2_VIBVU RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|27360774|gb|AAO09684.1| Phosphoribosylamine--glycine ligase [Vibrio vulnificus CMCP6]
          Length = 429

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIFPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W+  + R DIG 
Sbjct: 361 GEKVFHAGTENKEGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWEGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|197334390|ref|YP_002157187.1| phosphoribosylamine--glycine ligase [Vibrio fischeri MJ11]
 gi|197315880|gb|ACH65327.1| phosphoribosylamine--glycine ligase [Vibrio fischeri MJ11]
          Length = 430

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 281/432 (65%), Gaps = 13/432 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   VAID+++ +A++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFIAPGNAGTALEPKLENVAIDVEDIAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTKAAAQLEGSKAFTKDFLARHDIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
           +Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 SYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGASVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI  +G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDAEGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS   + T  
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRASIGVVLAAGGYPGDYAKGDVISLPSEETED 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGT   NN   ++  NGGRVL ATALG T++E++E AY + + + W   + R DI
Sbjct: 361 QKIFHAGT--TNNDAGDVVTNGGRVLCATALGNTVSEAQERAYQLAKQVSWNGMFHRNDI 418

Query: 410 GLQKKERNVKYR 421
           G +   R ++ +
Sbjct: 419 GYRAIARELETK 430


>gi|262392958|ref|YP_003284812.1| phosphoribosylamine--glycine ligase [Vibrio sp. Ex25]
 gi|262336552|gb|ACY50347.1| phosphoribosylamine--glycine ligase [Vibrio sp. Ex25]
          Length = 429

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V ID+++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFIAPGNAGTALEPKLENVNIDVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDQKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + N+  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTENKDGNIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRSDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|289669469|ref|ZP_06490544.1| phosphoribosylamine--glycine ligase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 431

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/430 (46%), Positives = 283/430 (65%), Gaps = 11/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  V I + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSAHVSEVLVAPGNAGTATEAKCRNVVIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   +D   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTDVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGKHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++LN+ + G L  T   W A  +L VV+A K YPE    G +I+ +      
Sbjct: 301 LRLQSDLVDLLNAAIDGRLDRTQAQWDARPSLGVVIAAKPYPETPVTGEVITGLDAVPAN 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVHDAQRTAYAGLQPIHWASAFQRSDIGW 420

Query: 412 QK--KERNVK 419
           +   +E+N +
Sbjct: 421 RAIVREQNAQ 430


>gi|289663883|ref|ZP_06485464.1| phosphoribosylamine--glycine ligase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 431

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/430 (46%), Positives = 283/430 (65%), Gaps = 11/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  V I + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSAHVSEVLVAPGNAGTATEAKCRNVVIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   +D   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTDVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGKHAMPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++LN+ + G L  T   W A  +L VV+A K YPE    G +I+ +      
Sbjct: 301 LRLQSDLVDLLNAAIDGRLDRTQAQWDARPSLGVVIAAKPYPETPVTGEVITGLDAVPAN 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVHDAQRTAYAGLQPIHWASAFQRSDIGW 420

Query: 412 QK--KERNVK 419
           +   +E+N +
Sbjct: 421 RAIVREQNAQ 430


>gi|227328383|ref|ZP_03832407.1| phosphoribosylamine--glycine ligase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 428

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHALAWK +QSPL   ++  PGN G A       +DI   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKASQSPLAKRVYVAPGNAGTALEPALTNVDIAATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HI L +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QENHIGLTIVGPETPLVIGVVDAFQSAGLKIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ    
Sbjct: 301 LRLRSDLVELCLAACDGTLDQKDSVWDERPSLGVVLAAGGYPADYNTGDVISGLPQQDAE 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   ++  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGIDVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAIER 425


>gi|37681327|ref|NP_935936.1| phosphoribosylamine--glycine ligase [Vibrio vulnificus YJ016]
 gi|37200078|dbj|BAC95907.1| phosphoribosylamine-glycine ligase [Vibrio vulnificus YJ016]
          Length = 444

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 16  MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 75

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 76  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 135

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 136 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 195

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 196 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 255

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 256 PEIHNRVMQEVIFPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 315

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 316 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 375

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 376 GEKVFHAGTENKGGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWDGMFHRNDIGY 435

Query: 412 QKKER 416
           +   R
Sbjct: 436 RAIAR 440


>gi|56749649|sp|Q7MGT4|PUR2_VIBVY RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
          Length = 429

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIFPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTENKGGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|37524503|ref|NP_927847.1| phosphoribosylamine--glycine ligase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36783927|emb|CAE12789.1| phosphoribosylglycinamide synthetase [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 427

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/425 (47%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           M +L++GSGGREHALAWK AQSPL  +++  PGN G A  +    IDI   + + ++ F 
Sbjct: 1   MNILIVGSGGREHALAWKAAQSPLADKIYVAPGNAGTALESNLENIDISATDINGLLVFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE+PLV GI DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEVPLVLGIVDAFQTAGLTIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+    A  Y+    +PIV+KADGL AGKGV+VA T +EA SAI        F   
Sbjct: 121 AYQNFTAIEPALAYLDKVGVPIVIKADGLAAGKGVIVAITREEAQSAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DGK  IP  T++DHKRI DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLTGEEASFIVMVDGKNVIPMATSQDHKRIGDGDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  ++++II PT+ GM  E + + G L+AGLMI++ G P +IE+N RFGDPE Q +M
Sbjct: 241 NEIHQRIMEEIIYPTVNGMAAEGHVYTGFLYAGLMISQNGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           MR+ SD++E+  +   G L     +W    AL VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 MRMRSDLVELCLAGAKGELAGKTSDWDERPALGVVLAAGGYPADYHKGDIIHGLPQQENE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           ++++FHAGTA+ +N++   GGRVL  TALG+TI ++++ AY   E I+W + ++R+DIG 
Sbjct: 361 SSKVFHAGTAMKDNDVITAGGRVLCVTALGETIIDAQKNAYQQAEEIEWNNCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|307110291|gb|EFN58527.1| hypothetical protein CHLNCDRAFT_34136 [Chlorella variabilis]
          Length = 454

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/422 (47%), Positives = 270/422 (63%), Gaps = 11/422 (2%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAI---DIQNHSAIIHFCQ 59
           VL++GSGGREHALAWK+AQSP    L+  PGN G       V +   +  NH  +I FC+
Sbjct: 29  VLVVGSGGREHALAWKMAQSPTCGTLYVAPGNAGTQLEPSMVTLPQLNTSNHQQVIDFCR 88

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           EK +D V+VGPE PLV G+ DAL AAG   FGP+  AA+LE SK+F K  C KY IPTA 
Sbjct: 89  EKGVDFVMVGPEQPLVEGMVDALTAAGITAFGPTAAAAQLEGSKAFMKNICRKYNIPTAQ 148

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQIN 174
           Y+ F++P  AK ++     PIVVK  GL AGKGV+VA T++EA  A+D       F    
Sbjct: 149 YETFTNPADAKAFITQCGAPIVVKTSGLAAGKGVIVAQTLEEAYQAVDDMMVNNAFGSAG 208

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           +TV++EE+L G E SFFA  DG+  IP   A+DHK + +GD G NTGGMG+ SPA  ++ 
Sbjct: 209 ATVVVEEFLSGEEASFFAFIDGENCIPLVGAQDHKAVGEGDTGLNTGGMGSYSPAPVLTP 268

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
           ++    +++++ PT  GM  E  PF+GVLFAGLMI E    L+E+NVRFGDPECQ++M+R
Sbjct: 269 QIERQAMEQLVYPTARGMCAEGTPFRGVLFAGLMIKEGQAKLLEHNVRFGDPECQSLMVR 328

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD+LE + +   G      + W A+ +LTVV+A KGYP  Y  G  I  +   TG  +
Sbjct: 329 LQSDLLESMLAQCRG--EQVKLEWSADPSLTVVLAAKGYPGPYSKGGAIHNLEAVTG-AK 385

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT++ +  + + GGRVL  TA GK + E+++ AY  V+ I +  G+ R DIG +  
Sbjct: 386 VFHAGTSMKDGQVVSTGGRVLGVTATGKDVLEAQQKAYAAVDTIAFPDGFCRHDIGWRAV 445

Query: 415 ER 416
            R
Sbjct: 446 AR 447


>gi|332524159|ref|ZP_08400388.1| phosphoribosylamine--glycine ligase [Rubrivivax benzoatilyticus
           JA2]
 gi|332107497|gb|EGJ08721.1| phosphoribosylamine--glycine ligase [Rubrivivax benzoatilyticus
           JA2]
          Length = 417

 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/411 (47%), Positives = 266/411 (64%), Gaps = 1/411 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A  A+   + I + +A+  F   
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPRVQHVYVAPGNGGTAADARLRNVAITDPAALADFVVA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + + L VVGPE PL  G+ D   A G ++FGP++ AA+LESSK+FAK F  ++GIPTA Y
Sbjct: 61  EKVALTVVGPEAPLAAGVVDVFRARGLRIFGPTRAAAQLESSKAFAKDFMKRHGIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           + F++   A  YV  +  PIVVKADGL AGKGVVVA T+DEA +AID         V+IE
Sbjct: 121 ESFTEAAAAHAYVDAQGAPIVVKADGLAAGKGVVVAMTLDEAHAAIDTMLGIPGGRVVIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E++EG E SF  + DG T +P  T++DHKRI DGD GPNTGGMGA SPA  ++  +++ V
Sbjct: 181 EFMEGEEASFIVVADGTTVLPLATSQDHKRIFDGDRGPNTGGMGAYSPAPVVTPNVHAKV 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMRLESDI 299
           +Q+II PT+ GM K+ +PF G L+AGLMI  QG P  +E+N R GDPE + ++MRL++D+
Sbjct: 241 MQEIIQPTLAGMAKDGHPFTGFLYAGLMIDAQGQPRTVEFNCRLGDPEAEVILMRLKTDL 300

Query: 300 LEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAG 359
           +E+L +     L +  + W    AL VV+A  GYP E   G +IS +P       +FHAG
Sbjct: 301 VELLLAATEAKLADVALQWDRRVALGVVMAAAGYPAEPRAGDVISGLPAEREDLVVFHAG 360

Query: 360 TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           T +V+     +GGRVL  TALG ++  +++ A   V  I +    WR DIG
Sbjct: 361 TKVVDGQTVTSGGRVLCVTALGDSVRLAQQRALEGVHAIAFDGAQWRNDIG 411


>gi|303283754|ref|XP_003061168.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457519|gb|EEH54818.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 494

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 274/430 (63%), Gaps = 11/430 (2%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFCQE 60
           VL++G GGREH+L W++ QSP    L+  PGN GIA     + V ++  +H+A++ FC+E
Sbjct: 65  VLVVGGGGREHSLCWRLRQSPTCGNLFCTPGNAGIASEDGVEVVRVNESDHAAVVKFCEE 124

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K + LVVVGPE PLV+G++D+L AA    FGPS+ AA+LE SK F K    KY IPTA Y
Sbjct: 125 KGVGLVVVGPEAPLVDGLADSLAAAKIPCFGPSKSAARLEGSKGFLKDLLKKYDIPTAKY 184

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQINS 175
           + F+DP KAK Y++++  PIVVK DGL AGKGV+VA  +D A +A+D       F     
Sbjct: 185 ERFTDPEKAKAYIKSEGAPIVVKTDGLAAGKGVIVAMDLDTALAAVDDMMLNAAFGAAGD 244

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE+L G E SFFA+  G  A+P   A+DHKR+ +GD G NTGGMGA SPA  ++ E
Sbjct: 245 EIVVEEFLTGEEASFFAVVGGGVAVPLVGAQDHKRVGEGDTGLNTGGMGAYSPAPVLTPE 304

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + + V++ I+ PT++GM  E  PF GV+FAGLMI      L+E+NVRFGDPECQ +M+R+
Sbjct: 305 MEAKVMKTIVQPTVDGMAAEGCPFTGVIFAGLMIEGDDVKLLEHNVRFGDPECQCLMVRM 364

Query: 296 ESDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-- 352
           +SD++E+L+    G L  +  + W  + A+ VVVA  GYP  Y  G +I  +        
Sbjct: 365 KSDLVELLSRAATGALDGSEKLEWSDDVAMNVVVAANGYPGSYAKGEVIEGLDDADALPG 424

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA   +  + + GGRVL   A+G  I E+ + AY  V+ I W  G+ R DIG 
Sbjct: 425 VKVFHAGTASNADGEIVSAGGRVLGVVAVGDDIAEAAKRAYDGVDAIVWPGGFVRRDIGW 484

Query: 412 QKKERNVKYR 421
           +   R+ K +
Sbjct: 485 RAIARDEKKK 494


>gi|325921880|ref|ZP_08183691.1| phosphoribosylamine--glycine ligase [Xanthomonas gardneri ATCC
           19865]
 gi|325547582|gb|EGD18625.1| phosphoribosylamine--glycine ligase [Xanthomonas gardneri ATCC
           19865]
          Length = 431

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 195/430 (45%), Positives = 285/430 (66%), Gaps = 11/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A   +C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSAQVSEVLVAPGNAGTATEPKCRNVAIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREDVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T++EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLNEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGKHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI  QG P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAQGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++L + + G L +    W    +L VV+A K YPE    G +I+ +      
Sbjct: 301 LRLQSDLVDLLEAAIDGKLDSAQAQWDPRPSLGVVIAAKPYPESPITGEVITGLDAVPAN 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+  +  + + GGRVL   ALG ++ +++  AY  ++ I W + + R DIG 
Sbjct: 361 AKVFHAGTALNTDGQVISAGGRVLCVAALGDSVQDAQRAAYAGLQPIHWPNAFQRSDIGW 420

Query: 412 Q--KKERNVK 419
           +   +ER+ +
Sbjct: 421 RAIARERDAQ 430


>gi|83648652|ref|YP_437087.1| phosphoribosylamine--glycine ligase [Hahella chejuensis KCTC 2396]
 gi|83636695|gb|ABC32662.1| Phosphoribosylamine-glycine ligase [Hahella chejuensis KCTC 2396]
          Length = 432

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK AQ+  +  ++  PGN G A   +   VAID+ +  A+I F 
Sbjct: 1   MNVLVIGSGGREHALAWKAAQADYVKTVFVAPGNAGTALEPKLENVAIDVLDFDALIAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ H++L +VGPE PLV G+ +   A G ++FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KDNHVELTIVGPEAPLVEGVVNRFQAEGLRIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ F++   A  Y++ +  PIVVKADGL AGKGV+VA T+ EA  A+     D  F   
Sbjct: 121 AYQSFTEIEPALAYLREQGAPIVVKADGLAAGKGVIVAMTLGEAEDAVRDMLADAKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+LEG E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLEGEEASFIVMVDGKHMLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             ++  +++++I PT++GM +E N + G L+AGLMI+  G P +IEYN RFGDPE Q +M
Sbjct: 241 DSVHERIMREVIYPTVQGMAQEGNDYVGFLYAGLMISADGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR++SD++++  +   G L +   +W    A+ +V+A  GYP+ Y  G  IS +   +  
Sbjct: 301 MRMQSDLVDLCIAATQGALDSKTSDWDPRAAVGIVLAAGGYPDSYAKGAAISGLENADRA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + +  +  +GGRVL ATALG  +TE++  AY  V  IDW+  Y+R+DI  
Sbjct: 361 DAKVFHAGTLMRDGQVVTHGGRVLCATALGVDVTEAQRKAYEQVARIDWQDMYYRKDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|220933546|ref|YP_002512445.1| Phosphoribosylamine--glycine ligase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994856|gb|ACL71458.1| Phosphoribosylamine--glycine ligase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 430

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/426 (44%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A   +C  V +++ +  A++HF 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPRVQTVFVAPGNAGTALEPRCLNVEVNLSDIPALVHFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL VVGPE PLV G+ DA  AAG ++FGPS +AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  QSQGVDLTVVGPEAPLVAGVVDAFRAAGLRIFGPSSKAAQLEGSKAFSKDFLARHAIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y +F+D   A  Y++ +  PIVVKADGL AGKGV++A TV EA +A+        F + 
Sbjct: 121 AYANFTDLDAALAYIRERGAPIVVKADGLAAGKGVILAQTVAEAEAAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G E SF  + DG+  +P  +++DHK   DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVVEEFLTGEEASFICMVDGEHILPMASSQDHKARDDGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ ++++++ PT+ GM  E NP+ G L+AG+MI   G P ++E+N RFGDPE Q +M
Sbjct: 241 PEIHARIMREVMEPTVRGMAAEGNPYTGFLYAGVMIAPDGTPKVLEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL SD++++L + +   L     +W    +L VV+A  GYP +Y  G +I  +P Q+  
Sbjct: 301 MRLRSDLVDLLEAALDARLDQVEADWDPRASLGVVLAAGGYPNDYRKGDVIIGLPEQDAP 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   +  +  NGGRVL    LG+T+ E+++ AY + + I W   Y R DIG 
Sbjct: 361 DAKVFHAGTLQQDGAVVTNGGRVLCVVGLGETVAEAQKRAYALSDRIHWDGVYCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|83591985|ref|YP_425737.1| phosphoribosylamine--glycine ligase [Rhodospirillum rubrum ATCC
           11170]
 gi|83574899|gb|ABC21450.1| phosphoribosylamine--glycine ligase [Rhodospirillum rubrum ATCC
           11170]
          Length = 436

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 266/430 (61%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           ++VL++GSGGREHAL  K+  SPL ++L   PGN GIA  A+C+ + ++   A++   + 
Sbjct: 7   IKVLVVGSGGREHALCRKLVASPLCADLLCAPGNAGIADVARCLPVGVEEIDALVALAKA 66

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + + LVVVGPE PLV G++D L  AG  VFGPS+  A LE SK F K    + G+PTA Y
Sbjct: 67  EAVGLVVVGPEAPLVLGLADKLAEAGIAVFGPSRAGALLEGSKGFMKDVLARAGVPTAWY 126

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F+D   AK ++  K  PIVVK DGL AGKGV++  T++E  +AID     R F +   
Sbjct: 127 GRFTDAGAAKAFIGEKGAPIVVKTDGLAAGKGVILCQTLEEGGAAIDLLMGERAFGEAGD 186

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SFFALCDG  AI F  A+DHK + +GD GPNTGGMGA SPA    + 
Sbjct: 187 EVVIEEFLVGEEASFFALCDGTRAIAFGAAQDHKAVGEGDTGPNTGGMGAYSPAPVFDKA 246

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + + V+ ++I PT+  M     PF GVLFAG+M+T  GP ++E+NVRFGDPECQ ++ RL
Sbjct: 247 MEAQVMAEVIAPTLRVMADMGRPFTGVLFAGIMVTPSGPKVLEFNVRFGDPECQVLLARL 306

Query: 296 ESDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGT 352
           ESD+L +L +   G L     + W  E ALTVV+A KGYP EY  G +I  +        
Sbjct: 307 ESDLLPVLLAAAEGRLDRVAPLVWSPETALTVVMAAKGYPGEYAKGDVIGGLAAAGEVRG 366

Query: 353 TQLFHAGT-AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             +FHAGT A     + A GGRVL  T  G ++ E+R+ AY  V+ +DW  G+ R DIG 
Sbjct: 367 AVVFHAGTRADGEGRVVAAGGRVLGVTGTGGSVREARDRAYQAVDALDWPGGFCRRDIGW 426

Query: 412 QKKERNVKYR 421
           +   R    R
Sbjct: 427 RALAREEGGR 436


>gi|311281440|ref|YP_003943671.1| phosphoribosylamine/glycine ligase [Enterobacter cloacae SCF1]
 gi|308750635|gb|ADO50387.1| phosphoribosylamine/glycine ligase [Enterobacter cloacae SCF1]
          Length = 429

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 282/426 (66%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+S ++  PGN G A     Q VAI + +   +++F 
Sbjct: 1   MKVLIIGNGGREHALAWKAAQSPLVSTVFVAPGNAGTALEPALQNVAIGVTDIPELLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++   +++II PT+ GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVRGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++E+  +   G L +    W    +L VV+A  GYP  Y +G  I  +P +   
Sbjct: 301 LRLQSDLVELCLAACDGKLGDKTSRWDTRASLGVVMAAGGYPGSYRNGDEIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTRLSDDDRVLTNGGRVLCVTALGNTVAEAQQRAYQLMTDIHWDGSFSRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|222054522|ref|YP_002536884.1| phosphoribosylamine/glycine ligase [Geobacter sp. FRC-32]
 gi|221563811|gb|ACM19783.1| phosphoribosylamine/glycine ligase [Geobacter sp. FRC-32]
          Length = 422

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 273/422 (64%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHAL WKIAQSPL+ +++  PGNPGI   A+ V I + +   ++ F ++
Sbjct: 1   MKILVIGSGGREHALVWKIAQSPLVEKVYCAPGNPGIGTIAENVQIKVDDLPGLLAFARK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL  GI D     GFK+FG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  EAIDLTVVGPELPLSLGIVDLFEEYGFKIFGARKNAAIIEASKAFSKDLMKKYHVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F++   A  ++    +PIVVKADGL AGKGV++A T DEA +A+        F    S
Sbjct: 121 EVFTEVGPAITFIDKVGIPIVVKADGLAAGKGVIIAQTRDEAVAAVTDMLSGNAFGTAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF A  DGK  IP  +A+DHK ++DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLKGEEASFLAFTDGKNIIPLASAQDHKAVYDGDTGPNTGGMGAYSPAPVVTPS 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   +++++  T++GM  E  P++GVL+AGLMI       +E+N RFGDPECQ ++MR+
Sbjct: 241 IHEKAMEEVMRRTVDGMAAEGRPYRGVLYAGLMIDGDSVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTGTTQ 354
           +SDI+ +L +    ++ N  I W  + A+ VV+A + YP +Y  G +I  +   N     
Sbjct: 301 KSDIVPVLMAVAEKDISNVQIEWHDKAAVCVVMAAQDYPGDYAKGDVIRGLDVANADDLF 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA+ N  L  NGGRVL  TALG T+ E+ + AY  V  I W+  ++R+DIG +  
Sbjct: 361 VFHAGTALDNGRLITNGGRVLGVTALGPTVKEAIDRAYSGVSAISWRGVHYRKDIGRKAL 420

Query: 415 ER 416
            R
Sbjct: 421 SR 422


>gi|169831780|ref|YP_001717762.1| phosphoribosylamine--glycine ligase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638624|gb|ACA60130.1| phosphoribosylamine--glycine ligase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 425

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/425 (44%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L+IG GGREHAL WK+++SP + E+ + PGNPG+A+ A+CV +   +   ++   ++
Sbjct: 1   MRILVIGGGGREHALVWKLSKSPRVGEIIAAPGNPGMARLAECVPVSAGDIPGLLDLARK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +DL   GPE PLV+G++D    AG +VFGP ++ A LE SK+FAK     YGIPTA +
Sbjct: 61  RGVDLTFAGPEAPLVDGLADVFEEAGLRVFGPRRQGAALEGSKAFAKDLMAAYGIPTAAH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F+DP  A++YV++   P VVKADGL AGKGV+V   V+EA +A+D     R F    +
Sbjct: 121 RTFADPAAAREYVRHLDGPCVVKADGLAAGKGVIVCDGVEEALAAVDEVMVARAFGAAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE L G EVS  A  DG+T  P   A+DHK + +GD+GPNTGGMGA +PA   + E
Sbjct: 181 RVVVEERLSGEEVSILAFTDGRTIRPMLPAQDHKPVFEGDLGPNTGGMGAYAPAPVCTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +Y+ + ++I+ PT+  +++   P++GVL+AGLM+T +GP ++E+NVRFGDPE Q ++  L
Sbjct: 241 IYTRIAEEILAPTVRALRESGTPYRGVLYAGLMLTAEGPKVLEFNVRFGDPEAQPLLALL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+++I  + + G LH   ++W+   A+ VV+A+ GYP +Y  G +I  +     T  L
Sbjct: 301 ETDLVDIAEAVIEGRLHEVDLSWRPGAAVCVVLASGGYPGDYRKGCVIGGLEAAELTGAL 360

Query: 356 -FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG---L 411
            FHAGTA  +  L   GGRVL  TA+   + E+  LAY   E I ++  Y+R DIG   L
Sbjct: 361 VFHAGTAERDGRLVTAGGRVLGVTAVAGELPEAIRLAYAAAELISFEGMYFRRDIGRKAL 420

Query: 412 QKKER 416
            K +R
Sbjct: 421 PKSQR 425


>gi|320353910|ref|YP_004195249.1| phosphoribosylamine/glycine ligase [Desulfobulbus propionicus DSM
           2032]
 gi|320122412|gb|ADW17958.1| phosphoribosylamine/glycine ligase [Desulfobulbus propionicus DSM
           2032]
          Length = 588

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 267/417 (64%), Gaps = 7/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHAL WK+ QS  +  +   PGN GI   A+CV I   + + ++ F  +
Sbjct: 1   MKVLVIGSGGREHALVWKLKQSKTVKAVVCAPGNAGIKAIAECVDIAAGDLAGLLDFAVK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL  GI D     G ++FGP+ + A LE SK F K FC KY IPTA Y
Sbjct: 61  ERIDLTIVGPEEPLAKGIVDLFEENGLRIFGPNSKGAILEGSKVFTKDFCAKYRIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F+    AK++++   MP V+KADGL AGKGV++  T+ EA  AID     + F    +
Sbjct: 121 GAFTKRGAAKKFLKTMDMPCVIKADGLAAGKGVIIVQTIAEAEQAIDLIMKDKAFGAAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE+L+G E SF A  DG T +P  +++DHK I +GD+GPNTGGMGA SPA  M+  
Sbjct: 181 QVVVEEFLQGEEASFIAFTDGTTVLPLPSSQDHKAIFEGDLGPNTGGMGAYSPAPVMTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V+++I+LPTI GM  E  P++G+L+AGLMI      ++E+N RFGDPECQ ++MRL
Sbjct: 241 LTTRVMEEIMLPTIRGMASEGRPYKGMLYAGLMIDGDRINVLEFNCRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTT 353
            +D++EI+N C+ G L    ++      + VV+A++GYP +Y  G  I+ + Q    G  
Sbjct: 301 NNDLVEIINGCIDGTLDRIQLDIDPRPTVCVVMASEGYPGKYVTGKTIAGLAQAAKVGGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           ++FHAGTA     +  +GGRVL  TA+G TI E+ + AY  V+ I W+  Y+R DIG
Sbjct: 361 EVFHAGTATKGRQVITSGGRVLGVTAIGATIKEALDRAYQAVDLIKWEGCYFRRDIG 417


>gi|293394038|ref|ZP_06638342.1| phosphoribosylamine-glycine ligase [Serratia odorifera DSM 4582]
 gi|291423478|gb|EFE96703.1| phosphoribosylamine-glycine ligase [Serratia odorifera DSM 4582]
          Length = 427

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  A  + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLAEKVYVAPGNAGTALEANLENVAISATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QDNDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPTQAAAQLEGSKAFTKDFLARHRIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAEAAVQDMLAGNAFGNA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVVPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V++++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DQIHQRVMEQVIWPTVRGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL SD++E+  +   G L      W    AL VV+A  GYP +Y  G +I  +PQ  + 
Sbjct: 301 LRLRSDLVELCLAGAEGKLDQKTSEWDDRPALGVVLAAGGYPADYRTGDVIQGLPQQASA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  +GGRVL  TALG T+ ++++ AY + E I W   + R+DIG 
Sbjct: 361 DGKVFHAGTQMAGDEVVTSGGRVLCVTALGATVAQAQQRAYQLAEGIQWPGSFCRKDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARG 426


>gi|294677915|ref|YP_003578530.1| phosphoribosylamine--glycine ligase [Rhodobacter capsulatus SB
           1003]
 gi|294476735|gb|ADE86123.1| phosphoribosylamine--glycine ligase [Rhodobacter capsulatus SB
           1003]
          Length = 420

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/416 (47%), Positives = 259/416 (62%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P    L   PGN GI Q A+  AID  + +A++    E
Sbjct: 1   MNILILGSGGREHALAWAVKQNPKCDRLIVAPGNAGIGQLAELAAIDPCDATAVLACVAE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D V+VGPE PL  G++DAL AAG   FGPS +AA+LE+SK+F K+ C   G PTA +
Sbjct: 61  NAVDFVIVGPEAPLAAGVADALRAAGVLTFGPSAQAAQLEASKAFTKEICDACGAPTAAW 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
             F+D   A  +V+ +  PIVVKADGL AGKGV+VA T+ EA + +   F          
Sbjct: 121 ARFADLEAALAHVRAQGAPIVVKADGLAAGKGVIVAMTLAEAEAGLREIFGGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF L DG    P  TA+DHKR+ DGD GPNTGGMGA SPA  +S  +
Sbjct: 181 VVIEEFMAGEEASFFILSDGVNVAPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLSAAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+ +II PT+  M +   PFQGVL+AGLMI      L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 QEQVLAEIIRPTVAQMARRGMPFQGVLYAGLMIENGRARLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
              L++L +C  G L      W  + ALTVV+A +GYP  Y  G+ I  +     T    
Sbjct: 301 GQALDLLQACAEGRLDQITAQWAEDCALTVVMAARGYPGTYEKGSEIKGLDSLPETSAQM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT   +  + A GGRVL+ TA   T+ E+++ AY MV+ IDW  G+ R DIG
Sbjct: 361 VFHAGTTAQDGRILATGGRVLNVTARAATLAEAQQRAYAMVDAIDWPEGFCRRDIG 416


>gi|330444953|ref|ZP_08308607.1| phosphoribosylamine--glycine ligase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328493071|dbj|GAA03104.1| phosphoribosylamine--glycine ligase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 428

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A   +   VAI +++ + ++ F 
Sbjct: 1   MKVLIIGNGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVAIGVEDIAGLVEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q  HI L +VGPE PLV G+ DA  AA   +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNHIALTIVGPEAPLVIGVVDAFRAAKLPIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T  EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVVKADGLAAGKGVIVAMTEQEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+EGM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMKEVIYPTVEGMAAEGAPYTGFLYAGLMIMSDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++++  + + G L      W    ++ VV+A  GYP  Y  G +IS +PQ    
Sbjct: 301 LRMQSDLVKLCLAAIDGKLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATA+G ++ E+++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFHAGTTNNQGDIVTNGGRVLCATAMGDSVLEAQQRAYALAKQISWDGMFHRDDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|153835063|ref|ZP_01987730.1| phosphoribosylamine--glycine ligase [Vibrio harveyi HY01]
 gi|148868459|gb|EDL67565.1| phosphoribosylamine--glycine ligase [Vibrio harveyi HY01]
          Length = 429

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MNILIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK IDL +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIDLTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTDNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|89069371|ref|ZP_01156730.1| phosphoribosylamine--glycine ligase [Oceanicola granulosus
           HTCC2516]
 gi|89045138|gb|EAR51209.1| phosphoribosylamine--glycine ligase [Oceanicola granulosus
           HTCC2516]
          Length = 418

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/415 (47%), Positives = 263/415 (63%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHA+AW +AQ+P    L   PGN GIAQ  +C ++DI +  A+  F  E
Sbjct: 1   MNILILGSGGREHAIAWAVAQNPKCDRLIVAPGNAGIAQLCECASLDILDGDAVAEFAGE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL +VGPE PL  G++D L AAGF V GPS  AA+LE+SK+F K+ C     PTA +
Sbjct: 61  NAIDLTIVGPEAPLAAGVADRLRAAGFTVLGPSAEAARLEASKAFTKEICDAAHAPTAAW 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQI--NSTVI 178
             F++   A+ Y+  +  PIV+KADGL AGKGV VA  V EA +A+D  F     +  V+
Sbjct: 121 ARFTEHAPARAYLAERGAPIVIKADGLAAGKGVTVAMDVAEAEAALDDIFAGAFGSPEVV 180

Query: 179 IEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYS 238
           IEEY+ G E S+F L DG   +P  TA+DHKR HDGD GPNTGGMGA SPA  ++ E+  
Sbjct: 181 IEEYMPGEEASYFFLVDGTDILPIGTAQDHKRAHDGDTGPNTGGMGAYSPAPVLTDEIAR 240

Query: 239 TVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESD 298
               +II PT+E M +   PF G+L+AGLMI    P L+EYNVR GDPE Q +MMRL   
Sbjct: 241 RARDEIIRPTMEEMARRGTPFSGILYAGLMIDSGAPRLVEYNVRLGDPEAQVLMMRLGGQ 300

Query: 299 ILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTII---SKIPQNTGTTQL 355
            L++  +C  G L++    W  ++ALTVV+A +GYP  Y  G+ I     +P+++     
Sbjct: 301 ALDLFQACAEGRLNDVAPTWADDHALTVVLAAEGYPGPYTKGSEIRGLDALPEDS-HRMT 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FHAGT   +  + A GGRVL+ TA G ++ E+R+ AY + + IDW  G+ R DIG
Sbjct: 360 FHAGTEARDGRIVATGGRVLAVTARGASLKEARDGAYALADAIDWPEGFHRTDIG 414


>gi|28899672|ref|NP_799277.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838912|ref|ZP_01991579.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ3810]
 gi|260363988|ref|ZP_05776722.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus K5030]
 gi|260878141|ref|ZP_05890496.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AN-5034]
 gi|260897896|ref|ZP_05906392.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           Peru-466]
 gi|260902151|ref|ZP_05910546.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ4037]
 gi|31076888|sp|Q87KS8|PUR2_VIBPA RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|28807924|dbj|BAC61161.1| phosphoribosylamine-glycine ligase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747620|gb|EDM58544.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ3810]
 gi|308085551|gb|EFO35246.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           Peru-466]
 gi|308090224|gb|EFO39919.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AN-5034]
 gi|308110162|gb|EFO47702.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ4037]
 gi|308115546|gb|EFO53086.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus K5030]
 gi|328471096|gb|EGF42002.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus 10329]
          Length = 429

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V ID+++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFIAPGNAGTALEPKLENVNIDVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTDNQDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|256821473|ref|YP_003145436.1| phosphoribosylamine/glycine ligase [Kangiella koreensis DSM 16069]
 gi|256795012|gb|ACV25668.1| phosphoribosylamine/glycine ligase [Kangiella koreensis DSM 16069]
          Length = 427

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 277/418 (66%), Gaps = 9/418 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQS  +  ++  PGN GIA+    Q VA+  ++   +I F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQSANVETVFVAPGNAGIAREDKVQTVAVGAEDIDGLIAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ +++L +VGPE PLV G+ DA   AG K FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KDNNVELTIVGPEAPLVIGVVDAFTEAGLKCFGPTKGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   AK YV+    PIV+KADGL AGKGV++A T+++A  AID       F   
Sbjct: 121 AYQNFTEIEPAKAYVREMGTPIVIKADGLAAGKGVIIAETIEQADEAIDDMLAGNKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L+G E SF  + DGK  +P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVVEEFLKGEEASFIVMVDGKNILPLATSQDHKARDNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  ++Q++I+PT+EGM  E +P+ G L+AG+MI   G P ++EYN RFGDPE Q +M
Sbjct: 241 PKMHDRIMQQVIIPTVEGMAAEGHPYTGFLYAGVMIDADGVPKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
            RL+SD+ E+  + + G L +T   W +  A+ VV+A  GYPE Y  G +I  +   +G 
Sbjct: 301 SRLQSDLAELCLAALDGKLDSTTAEWDSRAAVGVVLAAGGYPESYNKGDVIHGLDSISG- 359

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            ++FHAGTA  +  +  NGGRVL   ALG ++TE++  AY  V+ I+W + Y+R DIG
Sbjct: 360 AKVFHAGTAEKDGQIVTNGGRVLCVVALGDSVTEAQAKAYEGVKQINWDNVYYRTDIG 417


>gi|209696247|ref|YP_002264177.1| phosphoribosylamine--glycine ligase [Aliivibrio salmonicida
           LFI1238]
 gi|208010200|emb|CAQ80527.1| phosphoribosylamine--glycine ligase [Aliivibrio salmonicida
           LFI1238]
          Length = 430

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/432 (45%), Positives = 279/432 (64%), Gaps = 13/432 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   VAI++++ ++++ F 
Sbjct: 1   MRVLIIGAGGREHALGWKAAQNPNVETVFIAPGNAGTALEPKLENVAINVEDIASLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEGPLVIGVVDAFREAGLPIFGPTKAAAQLEGSKAFTKDFLARHDIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T+ EA  AI     D  F + 
Sbjct: 121 YYSNFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLKEAEDAIKDMLSDNVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGASVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    A+ VV+A  GYP +Y  G +IS        
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRAAIGVVLAAGGYPADYAKGDVISLPATELEG 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGT   NN   ++T NGGRVL ATALG T++E++E AY + + + W   + R DI
Sbjct: 361 QKIFHAGT--TNNAAGDVTTNGGRVLCATALGNTVSEAQERAYELTKQVSWNGMFHRNDI 418

Query: 410 GLQKKERNVKYR 421
           G +   R ++ +
Sbjct: 419 GYRAIARELESK 430


>gi|192359687|ref|YP_001983207.1| phosphoribosylamine--glycine ligase [Cellvibrio japonicus Ueda107]
 gi|190685852|gb|ACE83530.1| phosphoribosylamine--glycine ligase [Cellvibrio japonicus Ueda107]
          Length = 445

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 279/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQS  + +++  PGN G A   +   VAID+ + +A+ +F 
Sbjct: 18  MNILIIGSGGREHALAWKAAQSAQVDKVFVAPGNAGTALEPRLENVAIDVLDFAALANFA 77

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ H+ L +VGPE+PLV G+ D   A     FGPS+ AA+LE SK+F K F  ++ IPTA
Sbjct: 78  EQNHVGLTIVGPEVPLVAGVVDYFQARHLLCFGPSKGAAQLEGSKAFTKDFLARHKIPTA 137

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F +   A  Y++ K  PIVVKADGL AGKGV+VA T+++A +A+        F   
Sbjct: 138 DYQNFVEVEPALAYLREKGAPIVVKADGLAAGKGVIVAETLEQAEAAVRDMLSGNAFGDA 197

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 198 GCRVVIEEFLSGEEASFIVMVDGNNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 257

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             ++  +++++I PT++GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 258 AAVHERIMREVIYPTVQGMAAEGNTYVGFLYAGLMIDASGAPKVIEYNCRFGDPETQPIM 317

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++ +  + + G+L NT  +W +  ++ VV+A  GYP+ Y  G IIS +P  +  
Sbjct: 318 LRLQSDLVALCLAALKGDLGNTTADWDSRASVGVVLAAGGYPDAYAKGDIISGLPTVDLA 377

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +     NGGRVL ATALG T++E+++ AY + + I WK  ++R+DI  
Sbjct: 378 GEKVFHAGTALKDGQTVTNGGRVLCATALGNTVSEAQQRAYTLAQQISWKDMFYRKDIAY 437

Query: 412 QKKER 416
           +   R
Sbjct: 438 RAIAR 442


>gi|59713002|ref|YP_205778.1| phosphoribosylamine--glycine ligase [Vibrio fischeri ES114]
 gi|59481103|gb|AAW86890.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Vibrio fischeri ES114]
          Length = 430

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 280/432 (64%), Gaps = 13/432 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   VAID+++ +A++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFIAPGNAGTALEPKLENVAIDVEDIAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   A   +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREADLPIFGPTKAAAQLEGSKAFTKDFLARHDIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
           +Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 SYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGASVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI TE  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDTEGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS   + T  
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRASIGVVLAAGGYPADYAKGDVISLPSEETEG 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGT   NN   ++  NGGRVL ATALG T++E++E AY + + + W   + R DI
Sbjct: 361 QKIFHAGT--TNNDAGDVVTNGGRVLCATALGNTVSEAQERAYELAKQVSWNGMFHRNDI 418

Query: 410 GLQKKERNVKYR 421
           G +   R ++ +
Sbjct: 419 GYRAIARELETK 430


>gi|317486072|ref|ZP_07944924.1| phosphoribosylamine-glycine ligase [Bilophila wadsworthia 3_1_6]
 gi|316922668|gb|EFV43902.1| phosphoribosylamine-glycine ligase [Bilophila wadsworthia 3_1_6]
          Length = 423

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/422 (46%), Positives = 270/422 (63%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL+IGSGGREHAL+WK+A+S    +++  PGN G AQ  + + +   + + ++ F + 
Sbjct: 1   MRVLIIGSGGREHALSWKVARSGKAEKIYCAPGNGGTAQEGENIPLKDSDVAGLVSFAKG 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+ GPELPL  G+ DA+  AG + FGPSQ  A+LE SK+FAK    K G+PTA  
Sbjct: 61  NVIDFVIPGPELPLTLGVVDAMTQAGIRCFGPSQWCAQLEGSKAFAKDIMQKAGVPTAAC 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
             F++   AK +V+ K  PIV+KADGL AGKGVVVA T +EA  A+D+     F    S 
Sbjct: 121 GVFTELEAAKSFVEEKGAPIVIKADGLAAGKGVVVAQTKEEALEALDQIMGGVFGAAGSR 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+L G EVS  A CDGKTA+P  +A+DHK + DGD GPNTGGMGA SPA  +    
Sbjct: 181 VVIEEFLVGEEVSLLAFCDGKTALPLPSAQDHKAVFDGDTGPNTGGMGAYSPAPIVPDAE 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              +    I P +  M ++ +PF G+L+AGLM+T+ GP ++EYNVRFGDPEC+ ++MRLE
Sbjct: 241 LEKMADIAIRPILAEMARQGHPFTGILYAGLMMTKDGPKVLEYNVRFGDPECEPLLMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQ 354
           SD+LEI+++C+ G L    ++ + E AL VV+A +GYP  YP G  I  I        T+
Sbjct: 301 SDLLEIMDACIDGRLDEVKLSIRPESALGVVIAAEGYPGSYPKGMEIKGIDAVDALPDTK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT    +   ++GGRVL  TALGK + E+++ AY  V  ID +    R DIG +  
Sbjct: 361 VFQAGTKREGSRTLSSGGRVLCVTALGKGLAEAQKRAYEAVAKIDMEKSQHRSDIGAKGL 420

Query: 415 ER 416
            R
Sbjct: 421 RR 422


>gi|315634700|ref|ZP_07889984.1| phosphoribosylamine-glycine ligase [Aggregatibacter segnis ATCC
           33393]
 gi|315476648|gb|EFU67396.1| phosphoribosylamine-glycine ligase [Aggregatibacter segnis ATCC
           33393]
          Length = 429

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/428 (46%), Positives = 273/428 (63%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  Q  + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKIFVAPGNAGTALEQKVENVNISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ HI L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDNHIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALSYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEKDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V++++I PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHDRVMREVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RLESD++E+      GNL      W  + +L +V+A +GYP +Y  G  IS +PQN   
Sbjct: 301 LRLESDLVELCLKACDGNLDEVKSQWNPKASLGIVLAAEGYPGDYRKGAEISGLPQNAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL ATALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVEAKAGKLVTNGGRVLCATALGESVFEAQQKALKLAEQIQWNGRFYRRDIGY 420

Query: 412 QKKERNVK 419
           +   R  K
Sbjct: 421 RAVAREQK 428


>gi|148265862|ref|YP_001232568.1| phosphoribosylamine--glycine ligase [Geobacter uraniireducens Rf4]
 gi|146399362|gb|ABQ27995.1| phosphoribosylamine--glycine ligase [Geobacter uraniireducens Rf4]
          Length = 423

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/423 (45%), Positives = 271/423 (64%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHAL WKIAQSPL+ +++  PGNPGI   A+ V I + + S ++ F ++
Sbjct: 1   MKVLVIGSGGREHALVWKIAQSPLVEKVYCAPGNPGIGTIAENVDIKVDDLSGLLSFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPELPL  GI D     G KVFG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  EDIALTVVGPELPLSLGIVDLFEEYGLKVFGAQKNAAIIEASKAFSKDLMRKYNVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F++   A  ++    +PIV+KADGL AGKGV++A T DEA +A+        F    S
Sbjct: 121 EVFTEVEPAIAFIDRTGVPIVIKADGLAAGKGVIIAQTRDEAVAAVTDMLSGNSFGAAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF A  DGK  IP  +A+DHK ++DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLKGEEASFLAFTDGKNIIPLASAQDHKAVYDGDTGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   +Q+++  T++GM  E  P++GVL+AGLMI  +    +E+N RFGDPECQ ++MR+
Sbjct: 241 IHEKAMQEVMRRTVDGMAAEGRPYRGVLYAGLMIDGESVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SDI+ IL +    ++    I W  + A+ VV+A +GYP +YP G  I  +        L
Sbjct: 301 KSDIVPILLAVAEKDISRVQIEWHDKAAVCVVMAAEGYPGDYPRGDEIHGLDDAAKIQDL 360

Query: 356 --FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
             FHAGTA+  +    NGGRVL  TALG T+ E+ + AY  V  I W+  ++R+DIG + 
Sbjct: 361 FVFHAGTALDKDKFVTNGGRVLGVTALGPTVKEAIDRAYQGVSLISWRGAHYRKDIGKKA 420

Query: 414 KER 416
             R
Sbjct: 421 LAR 423


>gi|159045268|ref|YP_001534062.1| phosphoribosylamine--glycine ligase [Dinoroseobacter shibae DFL 12]
 gi|157913028|gb|ABV94461.1| phosphoribosylamine--glycine ligase [Dinoroseobacter shibae DFL 12]
          Length = 420

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/416 (47%), Positives = 265/416 (63%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW  AQ+P    L   PGN G+A+ A+C  +DI++  A+  F  +
Sbjct: 1   MNILILGSGGREHSLAWAAAQNPKCDRLIVAPGNAGMAEIAECAMLDIEDPGAVASFAAD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG   FGPS  AA+LE+SK+F K+ C   G PTA Y
Sbjct: 61  AAIDFVIIGPEAPLAAGVADRLREAGVLCFGPSAAAAQLEASKTFTKQICDATGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   A+ YVQ +  PIVVKADGL AGKGV+VA T  EA +A+D  F          
Sbjct: 121 AHFTDAAAARAYVQAQGAPIVVKADGLAAGKGVIVAMTEAEALAAVDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF LCDG+T +P  +A+D+KR  DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEEFMTGEEASFFVLCDGETVLPIGSAQDYKRAFDGDKGPNTGGMGAYSPAPVLTDAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +II P +  M +   P+QGVL+AGLMI +    L+EYN RFGDPECQ +MMRL 
Sbjct: 241 AAQALDEIIRPCMAEMTRRGMPYQGVLYAGLMIADGRARLVEYNARFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
           +  L+++ +C  G L    + W  ++ALTVV+A KGYP  Y  GT I  +          
Sbjct: 301 AQALDLMLACAEGRLDAAQVTWADDHALTVVMAAKGYPGGYEKGTEIRGLDDLVEDSFRM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT   +  L A+GGRVL+ TA   T+ E++  AY MV+ IDW  G+ R DIG
Sbjct: 361 VFHAGTKRASGRLEAHGGRVLNVTARADTLAEAQASAYAMVDAIDWPEGFCRRDIG 416


>gi|332995675|gb|AEF05730.1| phosphoribosylamine-glycine ligase [Alteromonas sp. SN2]
          Length = 437

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG GGREHALA+K AQS  +S ++  PGN G A   +   VAID+ +   ++ F 
Sbjct: 1   MNVLVIGGGGREHALAYKAAQSSDVSTVFVAPGNAGTAIEPKLENVAIDVNDILGLLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +   ++L +VGPE PLV G+ DA    G  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KGNDVELTIVGPEAPLVAGVVDAFTNEGLMIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T+ EA  AI        F + 
Sbjct: 121 EYQNFTEIDPAIAYVREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAIRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DGK+ +PF T++DHKR  +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGKSVLPFATSQDHKRAANGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V++++I+PT+EGM  E NP+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMKEVIMPTVEGMASEGNPYMGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SDI+ +  +   G L +  I +    A+ VV+A  GYP  Y  G  I+        
Sbjct: 301 LRLQSDIVALCQAACKGELDSQTIEFDERAAIGVVLAAGGYPGSYDKGDEITGFEHAAEL 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT++ +  +  NGGRVL ATA+G  +TE+++ AY +V  I +K  Y+R DIG 
Sbjct: 361 DGKVFHAGTSLEDGKVVTNGGRVLCATAMGNNVTEAQQKAYELVNAIQFKDAYFRTDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|325915238|ref|ZP_08177561.1| phosphoribosylamine--glycine ligase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538598|gb|EGD10271.1| phosphoribosylamine--glycine ligase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 431

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 280/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSARVSEVLVAPGNAGTATEAKCRNVAIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREDVALTVVGPEVPLVLGVVDRFHAAGVRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLGEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DG  A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGTHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++L++ + G L      W    +L VV+A K YPE    G +I+ + Q   +
Sbjct: 301 LRLQSDLVDLLDAAIDGTLDTAQAQWDPRPSLGVVIAAKPYPETPVTGEVITGLDQVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGT +  +  + + GGRVL   ALG ++ +++  AY  ++ I W + + R DIG 
Sbjct: 361 AKVFHAGTTLNADGQVVSAGGRVLCVAALGDSVQDAQRTAYAGLQPIHWPNAFQRSDIGW 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|218886815|ref|YP_002436136.1| phosphoribosylamine--glycine ligase [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757769|gb|ACL08668.1| phosphoribosylamine/glycine ligase [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 425

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 263/424 (62%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L++GSGGREHALAWK+ QSPL+ +++  PGN G A     V I   +  A++ F  +
Sbjct: 1   MRILIVGSGGREHALAWKLRQSPLVKDIFIAPGNGGTALEGTNVPISDGDLPALVRFALD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDLVV GPELPLV GI DA+ AAG   FGP    A+LE SK+FAK+     G+PTA +
Sbjct: 61  EKIDLVVPGPELPLVLGIKDAMVAAGVPCFGPDAYGAQLEGSKAFAKEVMRAAGVPTAAF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F     A+ Y++    P+VVKADGL AGKGVVVA TVDEA  A+D     R F     
Sbjct: 121 GVFDTADAARAYIRQNGAPVVVKADGLAAGKGVVVARTVDEALEAVDDMMVRRAFGDAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++E  L G E SF  LCDG+T +P  +A+DHK + D D GPNTGGMGA SPA  + + 
Sbjct: 181 RVVVESALAGEEASFLCLCDGETVLPLPSAQDHKAVFDNDEGPNTGGMGAYSPAPVLPET 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
            Y  +I  +I P +  + K  +PF GVL+AGLM+T  GP ++E+N RFGDPECQ ++MRL
Sbjct: 241 RYEEMIDLVIRPVLRELIKRGHPFTGVLYAGLMMTADGPMVLEFNTRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTT 353
           + D+  I+ +   G LH T +  K E AL VV+A KGYP  Y  G  IS I   +  G  
Sbjct: 301 DGDLAAIMVAGAQGRLHETTLPLKRETALGVVMAAKGYPGSYAKGMTISGIEDAEALGPV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++F AGT   +    + GGRVL  TALG T+ +++ LAY  V  +   + ++R DIG + 
Sbjct: 361 KVFQAGTEQRDGASVSRGGRVLCVTALGDTLADAQALAYKAVSRVRMDNAHYRSDIGAKG 420

Query: 414 KERN 417
            +R 
Sbjct: 421 LKRG 424


>gi|254491219|ref|ZP_05104400.1| phosphoribosylamine--glycine ligase [Methylophaga thiooxidans
           DMS010]
 gi|224463732|gb|EEF80000.1| phosphoribosylamine--glycine ligase [Methylophaga thiooxydans
           DMS010]
          Length = 431

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/431 (44%), Positives = 274/431 (63%), Gaps = 9/431 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSP  + ++  PGNPG         V I +++   ++ F 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPKSTAVFVAPGNPGTENETGISNVNIQVEDIEGLVSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  I L VVGPE+PLV G+ DA  AAG + FGPSQ AA+LE+SKSF K F  ++ IPTA
Sbjct: 61  KDNDIALTVVGPEVPLVMGVVDAFEAAGLRCFGPSQAAAELEASKSFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ F++   A  Y++ +  PIVVKADGL AGKGV+VA T  +A +A++       F + 
Sbjct: 121 DYQVFTEVAPATAYIKQQGAPIVVKADGLAAGKGVIVAETEQQAIAAVEDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE++ G E SF  + DG+  +P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFMVGEEASFIVMVDGENILPLATSQDHKARDNGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             +Y  ++Q++I PT++GM  +  P+ G L+AG+MI + G P ++EYN RFGDPE Q ++
Sbjct: 241 DSVYQRIMQQVIEPTVKGMAADGRPYTGFLYAGVMIDDTGAPKVVEYNCRFGDPETQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL+SD++E+  + +   L+    NW +  A+ VV+A  GYPE Y  G +IS I    + 
Sbjct: 301 MRLQSDLVELCEAALDKRLNEVDANWDSRAAIGVVMAAGGYPESYRKGDVISGIENAESN 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  + N+   GGRVL  TALG T+ E++  AY  +  I W   Y+R DI  
Sbjct: 361 GNKVFHAGTASQDGNVVTAGGRVLCVTALGHTVAEAQASAYQSLAKISWNDAYFRTDIAY 420

Query: 412 QKKERNVKYRN 422
           +   R    +N
Sbjct: 421 RAVAREQAVKN 431


>gi|307824228|ref|ZP_07654454.1| phosphoribosylamine/glycine ligase [Methylobacter tundripaludum
           SV96]
 gi|307734608|gb|EFO05459.1| phosphoribosylamine/glycine ligase [Methylobacter tundripaludum
           SV96]
          Length = 426

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 278/421 (66%), Gaps = 9/421 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M++L++GSGGREHALAWK  QS  + +++  PGN G A     + +AI + + +A++ F 
Sbjct: 1   MKILIVGSGGREHALAWKAKQSAKVEKVFVAPGNAGTALEPSVENIAIAVDDIAALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q++ IDL ++GPE+PLV GI D    AG K FGP+ +AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQQAIDLTIIGPEVPLVLGIVDRFQEAGLKCFGPTAKAAQLEGSKTFCKDFMIRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ F+D  +A  Y++ +  PIVVKADGL AGKGV+VA T  EA +A++       F + 
Sbjct: 121 KYQSFTDKQQAIDYIKQQGAPIVVKADGLAAGKGVIVAQTEQEAIAAVEDMLSGNVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V++EE+L G E SF  + DGK A+P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GNRVVVEEFLTGEEASFIVIADGKHALPMATSQDHKARDNGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPY-LIEYNVRFGDPECQAMM 292
            E++  V++ +I PT++GM ++  P+ G L+AGLMI+  G   ++EYN RFGDPE Q +M
Sbjct: 241 PEIHDKVMRDVIEPTLKGMAEDGLPYTGFLYAGLMISADGSVKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + GNL NT  +W    AL VV+A  GYP+ Y  G +IS +P +   
Sbjct: 301 MRLKSDLVELCEAALAGNLDNTTSDWDERAALGVVLAAGGYPDAYQSGAVISGLPAEEHE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            +++FHA T  V N+L   GGRVL A ALG  I E++  AY +   I W + Y+R DIG 
Sbjct: 361 DSKVFHAATKQVGNDLVTTGGRVLCACALGHDIKEAQSKAYKLANGIHWDNVYYRTDIGF 420

Query: 412 Q 412
           +
Sbjct: 421 K 421


>gi|188578856|ref|YP_001915785.1| phosphoribosylamine--glycine ligase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188523308|gb|ACD61253.1| phosphoribosylamine--glycine ligase [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 429

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/428 (45%), Positives = 282/428 (65%), Gaps = 11/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  VA+ + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSAHVSEVLVAPGNAGTATEAKCRNVAVKVNDLEGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   +D   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTDVDAALAYVREKGAPIVVKADGLAAGKGVIVATTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DG  A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGTHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++LN+ + G L +    W    +L VV+A K YPE    G +I+ +     +
Sbjct: 301 LRLQSDLVDLLNAAIDGKLDSAQAQWDPRPSLGVVIAAKPYPETPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVHDAQRTAYAGLQPIHWPSAFQRSDIGW 420

Query: 412 Q--KKERN 417
           +   +ER+
Sbjct: 421 RAIARERD 428


>gi|166713774|ref|ZP_02244981.1| phosphoribosylamine--glycine ligase [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 429

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/428 (45%), Positives = 281/428 (65%), Gaps = 11/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  VA+ + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSTQVSEVLVAPGNAGTATEAKCRNVAVKVNDLEGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   +D   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTDVDAALAYVREKGAPIVVKADGLAAGKGVIVATTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L G E SF ++ DG  A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLHGEEASFISMVDGTHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++LN+ + G L +    W    +L VV+A K YPE    G +I+ +     +
Sbjct: 301 LRLQSDLVDLLNAAIDGKLDSARAQWDPRPSLGVVIAAKPYPETPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVQDAQRTAYAGLQPIHWPSAFQRSDIGW 420

Query: 412 Q--KKERN 417
           +   +ER+
Sbjct: 421 RAIARERD 428


>gi|58580160|ref|YP_199176.1| phosphoribosylamine--glycine ligase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84622160|ref|YP_449532.1| phosphoribosylamine--glycine ligase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|58424754|gb|AAW73791.1| phosphoribosylamine-glycine ligase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84366100|dbj|BAE67258.1| phosphoribosylamine-glycine ligase [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
          Length = 429

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/428 (45%), Positives = 282/428 (65%), Gaps = 11/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  VA+ + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSAHVSEVLVAPGNAGTATEAKCHNVAVKVNDLEGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   +D   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTDVDAALAYVREKGAPIVVKADGLAAGKGVIVATTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DG  A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGTHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++LN+ + G L +    W    +L VV+A K YPE    G +I+ +     +
Sbjct: 301 LRLQSDLVDLLNAAIDGKLDSAQAQWDPRPSLGVVIAAKPYPETPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVHDAQRTAYAGLQPIHWPSAFQRSDIGW 420

Query: 412 Q--KKERN 417
           +   +ER+
Sbjct: 421 RAIARERD 428


>gi|21241282|ref|NP_640864.1| phosphoribosylamine--glycine ligase [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|25091072|sp|Q8PQ21|PUR2_XANAC RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|21106601|gb|AAM35400.1| phosphoribosylamine-glycine ligase [Xanthomonas axonopodis pv.
           citri str. 306]
          Length = 431

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 279/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSARVSEVLVAPGNAGTATEAKCRNVAIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGTPIVVKADGLAAGKGVIVALTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGKHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++L + + G L   H  W    +L VV+A + YP+    G +I+ +     +
Sbjct: 301 LRLQSDLVDLLEAAIDGKLDGAHAQWDPRPSLGVVIAARPYPDTPVTGEVIAGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVQDAQRTAYAGLKPIHWSSAFQRSDIGW 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|170718522|ref|YP_001783732.1| phosphoribosylamine--glycine ligase [Haemophilus somnus 2336]
 gi|168826651|gb|ACA32022.1| phosphoribosylamine--glycine ligase [Haemophilus somnus 2336]
          Length = 432

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/430 (46%), Positives = 275/430 (63%), Gaps = 15/430 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQC----VAIDIQNHSAI 54
           M +L+IG+GGREHAL WK+AQSPL S+++  PGN G A     +C    VAI   +  A+
Sbjct: 1   MNILIIGNGGREHALVWKVAQSPLASKIFVAPGNAGTAMETDGKCAVENVAISATDIDAL 60

Query: 55  IHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYG 114
           ++F QE  I L +VGPE PLV G+ DA  A+G K+FGP+Q AA+LE SK+F K F  ++ 
Sbjct: 61  VNFAQENQIGLTIVGPEAPLVLGVVDAFRASGLKIFGPTQAAAQLEGSKAFTKDFLARHH 120

Query: 115 IPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RC 169
           IPTA Y+ F+D  KA  YV+ K  PIVVKADGL  GKGV+VA T+ EA  AI        
Sbjct: 121 IPTAEYRSFTDAEKAIAYVREKDAPIVVKADGLATGKGVIVAMTLAEAEKAIQDMLSGNA 180

Query: 170 FQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA 229
           F +  S V+IEE+LEG E SF  + DGK   P  T++DHKR+ + D GPNTGGMGA SPA
Sbjct: 181 FGKAGSKVVIEEFLEGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGPNTGGMGAYSPA 240

Query: 230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPEC 288
             ++ E+++ ++Q+II PT+ GM KE N + G L+AGLMI + G P +IE+N RFGDPE 
Sbjct: 241 PVVTPEIHTRIMQQIIYPTVNGMAKEGNIYTGFLYAGLMIDKHGQPKVIEFNCRFGDPET 300

Query: 289 QAMMMRLESDILEI-LNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP 347
           Q +MMR+ SD++E+ LN+C  G L      W  + AL +V+A +GYP  Y  G  I  +P
Sbjct: 301 QPVMMRMRSDLVELCLNAC-EGKLDQVKSEWSEQAALGIVLAAEGYPNNYRKGDEIQGLP 359

Query: 348 QNTGTTQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
            + G  Q +F AG       L  NGGRVL  TA+G+ +  +++ A  + + I W   ++R
Sbjct: 360 ISAGENQKVFLAGVEQKGERLLTNGGRVLCVTAMGENVFAAQQQALKLAKQIQWSGRFYR 419

Query: 407 EDIGLQKKER 416
           +DIG +   R
Sbjct: 420 QDIGYRAVAR 429


>gi|51246040|ref|YP_065924.1| phosphoribosylamine--glycine ligase [Desulfotalea psychrophila
           LSv54]
 gi|50877077|emb|CAG36917.1| probable phosphoribosylamine--glycine ligase [Desulfotalea
           psychrophila LSv54]
          Length = 590

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/417 (46%), Positives = 268/417 (64%), Gaps = 7/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WKI QS  + E++  PGN GI + A CV I   +   ++HF Q+
Sbjct: 1   MKVLVVGSGGREHALVWKIKQSQKVEEVFCAPGNAGIEELATCVNISATDIKGLLHFAQK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE  LV GI D     G ++FGPSQ AA LE SK F K F  KY IPTA +
Sbjct: 61  EKIDLTVVGPESSLVAGIVDLFEENGLRIFGPSQAAAILEGSKVFTKNFLQKYSIPTAAF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
             F++   AK+Y++ +  PIVVKADGL AGKGVVVA T++EA  A+     D+ F +   
Sbjct: 121 GVFTEREAAKEYIEQQGAPIVVKADGLAAGKGVVVAKTIEEAKKAVDEIMLDKAFGEAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           ++++E  L G E SF A  DGKT +P  T++DHK  +DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 SIVVESCLLGEEASFIAFTDGKTILPLPTSQDHKAAYDGDKGPNTGGMGAYSPAPIVTDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V+ +++LPTI+G+  E  P++G+L+AGLMI      ++E+N RFGDPE Q ++MRL
Sbjct: 241 ITEYVMTEVMLPTIKGLAAEGRPYKGMLYAGLMIDGDDIKVLEFNCRFGDPEAQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTT 353
           +SDI++I  +C+ G L    +       + VV+++ GYP  Y  G II+   Q       
Sbjct: 301 KSDIIDIFEACIDGTLDRVEMKIDPRPTVCVVMSSGGYPGAYASGDIITGFEQADKVDGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           ++FHAGTA     + +NGGRVL  T++GKT+ ++ E AY   + I W   ++R+DIG
Sbjct: 361 EVFHAGTAKEGEAIVSNGGRVLGITSIGKTLEQALERAYKATDCITWNKCFYRKDIG 417


>gi|257465544|ref|ZP_05629915.1| phosphoribosylamine--glycine ligase [Actinobacillus minor 202]
 gi|257451204|gb|EEV25247.1| phosphoribosylamine--glycine ligase [Actinobacillus minor 202]
          Length = 430

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 275/430 (63%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+ QSPL S+++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVRQSPLASKVFVAPGNAGTALEEGIENVAISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQNAIGLTIVGPEAPLVVGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLRQKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+++II PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 ADIHQRVMEEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RLESD++E+      G L      W A+ AL +V+A +GYP +Y  G  I+ +P +N  
Sbjct: 301 LRLESDLVELCLKACDGKLDKIQSKWCAQAALGIVLAAEGYPADYRKGDEITGLPTENRA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL ATALG T+ E+++ A  + E I W+  ++R DIG 
Sbjct: 361 DEKVFLAGVEQKEGKLLTNGGRVLCATALGATVFEAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERNVKYR 421
           +   R    R
Sbjct: 421 RAVAREQSGR 430


>gi|56461392|ref|YP_156673.1| phosphoribosylamine-glycine ligase [Idiomarina loihiensis L2TR]
 gi|56180402|gb|AAV83124.1| Phosphoribosylamine-glycine ligase [Idiomarina loihiensis L2TR]
          Length = 427

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/418 (46%), Positives = 277/418 (66%), Gaps = 9/418 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL++G GGREHALAWK AQS  +  ++  PGN G  +      VAI  ++  ++++F 
Sbjct: 1   MKVLVVGGGGREHALAWKAAQSNQVDCVYVAPGNAGTEREPNLTNVAIGAEDIESLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           + + I+L +VGPE PLV GI D  N AG   FGP+ +AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  KSEDIELTIVGPEAPLVAGIVDRFNEAGLAAFGPTAKAAQLEGSKAFSKDFLQRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   AK YV  K +PIV+KADGL AGKGV++A + ++A +AID       F   
Sbjct: 121 DYQNFTEVEPAKAYVAEKGLPIVIKADGLAAGKGVIIAESQEQADAAIDDMLAGNRFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DGK AIPF +++DHK   +GD GPNTGGMGA SPA  +S
Sbjct: 181 GHRVVIEEFLRGEEASFIVMVDGKHAIPFASSQDHKARDNGDKGPNTGGMGAYSPAPVVS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             ++  V++ +I PT++GM  E  P++G L+AGLMI E G   ++EYN RFGDPE Q +M
Sbjct: 241 PAIHDWVMRHVIKPTVDGMAAEGAPYKGFLYAGLMIAEDGTSKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+SD++E+    + G L+   IN+    A+ VV+A  GYPE Y  G II  +P ++  
Sbjct: 301 MRLKSDLVELCLQAIDGKLNQAPINFDERAAVGVVMAAGGYPESYAKGDIIHGLPDHSPE 360

Query: 353 TQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            Q +FHAGT + N  +  +GGRVL  TALG T+TE+++LAY +V+ + W + Y+R DI
Sbjct: 361 NQKVFHAGTKMDNGKVVTSGGRVLCCTALGDTVTEAQKLAYQLVDQVSWNNVYYRTDI 418


>gi|152978819|ref|YP_001344448.1| phosphoribosylamine--glycine ligase [Actinobacillus succinogenes
           130Z]
 gi|150840542|gb|ABR74513.1| phosphoribosylamine--glycine ligase [Actinobacillus succinogenes
           130Z]
          Length = 429

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/425 (47%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  A  + V I + + +A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTASEANIENVNIGVTDVTALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE +I L +VGPE PLV G+ DA  AAG  +FGP Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QENNIGLTIVGPEAPLVVGVVDAFEAAGLTIFGPRQSAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D  +A  YV+ K  PIV+KADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 EYQNFTDVEQALAYVREKGAPIVIKADGLAAGKGVIVAMTLNEAEDAIKDMLSGNVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGEHVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V+ +II PT+ GM  E N ++G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 241 QEIHDRVMAQIIYPTVRGMAAENNVYKGFLYAGLMIDKNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+      G L      W  E AL +V+A +GYP +Y  G  I  IP Q   
Sbjct: 301 MRLKSDLVELCLKACQGELDQIKSEWAQEAALGIVLAAEGYPGDYRKGDEIYGIPTQPAQ 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A  +     NGGRVL  TALG ++ E+++ A  + E ++W   ++R DIG 
Sbjct: 361 DEKIFLAGVAEKDGKPVTNGGRVLCVTALGNSVFEAQQKALKLAEQVNWTGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|120556358|ref|YP_960709.1| phosphoribosylamine--glycine ligase [Marinobacter aquaeolei VT8]
 gi|120326207|gb|ABM20522.1| phosphoribosylamine--glycine ligase [Marinobacter aquaeolei VT8]
          Length = 428

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/425 (44%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK +QSP   +++  PGN G A+  + + V +D+ +   + +F 
Sbjct: 1   MNILVIGSGGREHALAWKASQSPQADKVFVAPGNAGTAREPNLENVDLDVMDLDGLANFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ ++ L +VGPE PLV G+ D   A G ++FGPS  AA+LE SK+F K F  +  IPTA
Sbjct: 61  EQNNVGLTIVGPEAPLVAGVVDKFEARGLRIFGPSAGAAQLEGSKAFTKDFLARQKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y +F+D  +A  YV+ K  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 DYANFTDVDQALAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGKNVLAMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  +++++I PT+ GM  E +P++G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 ADVHQRIMEEVIYPTVNGMAAEGHPYKGFLYAGLMIDASGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+  + V G L      W    ++ +V+A +GYP  Y  G +IS +P+  T 
Sbjct: 301 LRMKSDLVELCQAAVDGKLDACDSEWDERASVGIVLAARGYPASYQKGDVISGLPEGETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++   GGRVL ATALG T+TE+++ AY + + I W   ++R DI  
Sbjct: 361 GEKVFHAGTRLNGDDVVTAGGRVLCATALGNTVTEAQQRAYELAKKISWNGMFYRNDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|89075363|ref|ZP_01161785.1| phosphoribosylamine--glycine ligase [Photobacterium sp. SKA34]
 gi|89048912|gb|EAR54481.1| phosphoribosylamine--glycine ligase [Photobacterium sp. SKA34]
          Length = 428

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A   +   V I +++ +A++ F 
Sbjct: 1   MKVLIIGNGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVEIGVEDIAALVEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  +A   +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNQIGLTIVGPEAPLVIGVVDAFRSAKLPIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T  EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVVKADGLAAGKGVIVAMTEQEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+EGM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDIHDRVMKEVIYPTVEGMAAEGAPYTGFLYAGLMIMSDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+  + +   L      W    ++ VV+A  GYP  Y  G +IS +PQ    
Sbjct: 301 LRMQSDLVELCLAAIDEKLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPQQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAG A  N N+  NGGRVL ATA+G T+ E+++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFHAGAANNNGNIVTNGGRVLCATAMGDTVLEAQQRAYALAKQISWDGMFHRDDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|206580118|ref|YP_002241054.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae 342]
 gi|288937699|ref|YP_003441758.1| phosphoribosylamine/glycine ligase [Klebsiella variicola At-22]
 gi|290513207|ref|ZP_06552568.1| phosphoribosylamine-glycine ligase [Klebsiella sp. 1_1_55]
 gi|206569176|gb|ACI10952.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae 342]
 gi|288892408|gb|ADC60726.1| phosphoribosylamine/glycine ligase [Klebsiella variicola At-22]
 gi|289774304|gb|EFD82311.1| phosphoribosylamine-glycine ligase [Klebsiella sp. 1_1_55]
          Length = 431

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQNVAIGVTDIPALLRFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+++IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDENIDLTIVGPEAPLVIGVVDAFRAAGLTIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +R++SD++++  +   G L      W    +L VVVA  GYP  Y  G  I  +PQ    
Sbjct: 301 LRMKSDLVDLCLAACAGKLDEKTSEWDDRASLGVVVAAGGYPGNYNTGDEIFGLPQQEAA 360

Query: 353 T-QLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG+T+ ++++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDQRVVTNGGRVLCVTALGETVAQAQQRAYQLLTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|46578904|ref|YP_009712.1| phosphoribosylamine--glycine ligase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603496|ref|YP_967896.1| phosphoribosylamine--glycine ligase [Desulfovibrio vulgaris DP4]
 gi|46448316|gb|AAS94971.1| phosphoribosylamine--glycine ligase [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120563725|gb|ABM29469.1| phosphoribosylamine--glycine ligase [Desulfovibrio vulgaris DP4]
 gi|311232762|gb|ADP85616.1| phosphoribosylamine/glycine ligase [Desulfovibrio vulgaris RCH1]
          Length = 424

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/424 (45%), Positives = 270/424 (63%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L++GSGGREHALAWK+ QSPL++EL+  PGN G A     V I   +  A++ F +E
Sbjct: 1   MRILIVGSGGREHALAWKLRQSPLVTELFIAPGNGGTALEGTNVPIADDDLPALVAFARE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDLVV GPELPLV G+ +AL       FGP+  AA+LE SK+FAK      G+PTA +
Sbjct: 61  QKIDLVVPGPELPLVLGLKEALVRENIPCFGPNAYAAQLEGSKAFAKNVMRDAGVPTADF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F +P  A+ YV  K  P+VVKADGL AGKGVVVA+T +EA +A+D     + + +   
Sbjct: 121 AVFDEPADARAYVLEKGAPLVVKADGLAAGKGVVVASTTEEAVAALDEIMGRKAYGRAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE L G E SF   CDG T +P  +A+DHK + DGD GPNTGGMGA SPA  +   
Sbjct: 181 HVVVEECLIGEEASFLCFCDGDTVLPLPSAQDHKAVFDGDKGPNTGGMGAYSPAPVLPAS 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
            Y  +I+ +I P +  M++  +PF G+L+AGLM+T  GP ++E+NVRFGDPECQ ++MRL
Sbjct: 241 RYDEIIEMVIRPVMREMERRGSPFSGILYAGLMMTAAGPKVLEFNVRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTT 353
           + D+  I+ +C  G L+   ++ K + AL VVVA KGYP  YP G +I  I   +  G  
Sbjct: 301 DGDLAAIMLACATGRLNEVTLDLKPQTALGVVVAAKGYPGTYPKGMVIEGIQEAEALGDI 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++F AGT + + +  + GGR+L  TALG  +  ++  AY  + +I     ++R DIG + 
Sbjct: 361 KVFQAGTRLEDGHTVSTGGRILCVTALGDDLAAAQRRAYEALAHIRMPDCHFRTDIGAKG 420

Query: 414 KERN 417
             R+
Sbjct: 421 LGRS 424


>gi|330005101|ref|ZP_08305111.1| phosphoribosylamine--glycine ligase [Klebsiella sp. MS 92-3]
 gi|328536434|gb|EGF62787.1| phosphoribosylamine--glycine ligase [Klebsiella sp. MS 92-3]
          Length = 431

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQTVAIGVTDIPALLRFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q++ IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDEKIDLTIVGPEAPLVIGVVDAFRAAGLNIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+  +   G L      W    +L VVVA  GYP  Y  G  I  +PQ    
Sbjct: 301 LRMKSDLVELCLAACAGKLDEKTSEWDDRASLGVVVAAGGYPGSYNTGDEIYGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG ++ ++++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLSDDQRVVTNGGRVLCVTALGDSVAQAQQRAYQLLTDIRWDGSFSRSDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|327398758|ref|YP_004339627.1| phosphoribosylamine--glycine ligase [Hippea maritima DSM 10411]
 gi|327181387|gb|AEA33568.1| Phosphoribosylamine--glycine ligase [Hippea maritima DSM 10411]
          Length = 424

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/417 (45%), Positives = 274/417 (65%), Gaps = 7/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++ ++G GGREHALAWKI QSPL   L+ +PGN G A+ A  + I  ++   ++ FC+E
Sbjct: 1   MKIAIVGGGGREHALAWKIKQSPLCDNLFCLPGNAGTAEIATNIDISAEDLDGVVGFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLV +GPE PL +GI D L+  G K FGPS++AA+LE+SKSF K F  KY IPTA Y
Sbjct: 61  KAIDLVAIGPENPLADGIVDRLSEVGIKAFGPSKKAAQLEASKSFTKDFLKKYNIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
           + F+    AK Y++ K  PIVVKADGL AGKGV VA T +EA  A     I++ F +  +
Sbjct: 121 ETFTSFEDAKAYIEKKGAPIVVKADGLAAGKGVTVAKTKEEAIKALKSIFIEKRFGEAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E SF    DG+  +P   A+DHK I++ D GPNTGGMG+ +PA  + + 
Sbjct: 181 RVVIEEFLEGEEASFLVFSDGENILPMIAAQDHKPIYNNDEGPNTGGMGSYAPAPIVDEN 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   +I  I+   I+GM+KE+ P++GVL+AGLMI ++ PY++E+N RFGDPE QA++  L
Sbjct: 241 LKQYIIDNIMKKAIDGMKKEEAPYKGVLYAGLMIKDKKPYVLEFNCRFGDPETQAILPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTT 353
           +SDI++I+ + + GNL+   ++WK  YA+ VV+A+ GYP  Y  G  I  + +       
Sbjct: 301 KSDIVQIMLATIEGNLNKYSLSWKEGYAVGVVLASGGYPLSYEKGKPIIGLDKIVELDDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT + +  +  NGGRVL+   + K    ++E AY+ ++ I +   ++R DIG
Sbjct: 361 IVFHAGTKLKDGQILTNGGRVLNVVGMDKDFRTAQEKAYNAIKFIHFDRMHYRTDIG 417


>gi|298370471|ref|ZP_06981787.1| phosphoribosylamine--glycine ligase [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281931|gb|EFI23420.1| phosphoribosylamine--glycine ligase [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 423

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/416 (46%), Positives = 268/416 (64%), Gaps = 7/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G +   +   + +  H+ +I FC++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPKVETVFVAPGNAGTSIEPKLKNLTLTAHADLIDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +HI   VVGPE PL  GI D   A G K FGP+Q AA+LESSK FAK F  KYGIPTA Y
Sbjct: 61  EHIAFTVVGPEAPLAAGIVDDFRAEGLKAFGPTQYAAQLESSKDFAKAFMKKYGIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q F +  KA +YV  K  PIV+KADGL AGKGVVVAAT+ EA  AID            +
Sbjct: 121 QTFENAEKAHEYVNQKGAPIVIKADGLAAGKGVVVAATLHEAHVAIDDMLLGNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGDNVLPMATSQDHKRLLDDDCGPNTGGMGAYSPAPVVTSD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI + G PY +E+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVNGMKAEGHKFTGFLYAGLMIDKTGAPYTVEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD++++L + + G L++T   W  + A+ VV+A + YP+    G II+ + +     +
Sbjct: 301 LNSDLVDLLEAAIDGKLNSTIAEWNPQTAVGVVLAAENYPDTPKKGDIITGLDEADRIGK 360

Query: 355 LFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
           +FHAGTA+  N  +  NGGRVL    LG  +  ++  AY  V+ I +    +R+DI
Sbjct: 361 VFHAGTALNENGKVVTNGGRVLCVVGLGDNVAAAKTKAYQAVQKISFDGMQYRKDI 416


>gi|212703677|ref|ZP_03311805.1| hypothetical protein DESPIG_01723 [Desulfovibrio piger ATCC 29098]
 gi|212672910|gb|EEB33393.1| hypothetical protein DESPIG_01723 [Desulfovibrio piger ATCC 29098]
          Length = 442

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 272/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC-VAIDIQNHSAIIHFCQ 59
           +R+L+IGSGGREHAL WK+ QSP +SE++  PGN G A+     VA+D  +   ++   +
Sbjct: 10  VRILVIGSGGREHALVWKLKQSPRVSEVFVAPGNGGTAREGAINVAVDAGDLDGLVELAR 69

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           ++ IDLVV GPELPL  GI+D +  AG   FGP    A+LE SK+FAK    + G+PTA 
Sbjct: 70  KEKIDLVVPGPELPLTKGITDRMREAGIPCFGPDAYCARLEGSKAFAKDVMNRAGVPTAH 129

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQIN 174
            Q F+DP KAK  V     P+VVKADGL AGKGVVVA T  EA  A+D     R      
Sbjct: 130 SQVFTDPDKAKNAVVKLGAPLVVKADGLAAGKGVVVAKTTQEALDAVDDIMCKRAHGAAG 189

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           + ++IEE+L G E SF  LCDGKTA+P  +A+DHK  +DGD GPNTGGMGA SPA  +  
Sbjct: 190 AKLVIEEFLVGEEASFLCLCDGKTAVPLPSAQDHKAAYDGDQGPNTGGMGAYSPAPILPY 249

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
                +   +I P +  + K+ +PF GVL+AGLM+TE GP ++EYN RFGDPECQ ++MR
Sbjct: 250 NEAEAMADTVIRPILAALAKDGHPFVGVLYAGLMMTENGPKVLEYNTRFGDPECQPLLMR 309

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-- 352
           LE D+++I+  C+ G L    ++  ++ AL VVVA +GYP  YP G +I  + +      
Sbjct: 310 LEGDLVQIMLDCIEGKLRPESLSHTSQTALGVVVAAEGYPHAYPKGMVIEGLDEADALPG 369

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            ++FH+GT++  + + ++GGRVL  TALG T+ +++  AY  V+ I     + R DIG Q
Sbjct: 370 VKVFHSGTSMDGDKILSSGGRVLCVTALGDTLADAQARAYEGVKAIRMDKSFHRSDIG-Q 428

Query: 413 KKERNVK 419
           K  R ++
Sbjct: 429 KGIRRLE 435


>gi|94496130|ref|ZP_01302708.1| phosphoribosylamine--glycine ligase [Sphingomonas sp. SKA58]
 gi|94424309|gb|EAT09332.1| phosphoribosylamine--glycine ligase [Sphingomonas sp. SKA58]
          Length = 430

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/425 (47%), Positives = 271/425 (63%), Gaps = 6/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+G GGREHALAWK+AQSP L  L++ PGNPGIAQHA  V +D  +H A++ FC  
Sbjct: 4   MNILLLGGGGREHALAWKLAQSPGLDTLYAAPGNPGIAQHATLVDLDAADHRAVLDFCIR 63

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVV+GPE PLV+G++D L   G  VFGP+++AA+LE SK F K  C +  IPTA Y
Sbjct: 64  HSIGLVVIGPEAPLVDGLADNLRTMGVPVFGPNRKAAQLEGSKGFTKDLCKRANIPTAAY 123

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINST 176
              +    A   + + ++P+V+KADGL AGKGV++A + +EA  A+D  F          
Sbjct: 124 VRVTSKDGAIAALDDFALPVVIKADGLAAGKGVIIAQSREEALEALDSMFSGAFGAAGEE 183

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFFAL DG   +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ +L
Sbjct: 184 VVLEEFMTGEEASFFALTDGSAILPFGSAQDHKRVGDGDTGPNTGGMGAYSPARILTPDL 243

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              VI  II PT++ +  E  P+ GVL+AGLM+TE GP LIEYN RFGDPECQ +M R +
Sbjct: 244 EQQVIDTIIRPTVDSLAAEGMPYSGVLYAGLMLTEAGPKLIEYNARFGDPECQVLMSRFD 303

Query: 297 SDILEILNSCVHGNLHNTHINWKAEY-ALTVVVATKGYPEEYPHGTIISKI-PQNTGTTQ 354
            D+  +L +     L +      AE  ALTVV+A  GYP     G  I+ +        +
Sbjct: 304 GDLAALLLAVAQSRLADQGPVALAERTALTVVMAANGYPGTPEKGGRIAGLDAAERAGAK 363

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  N +L  NGGRVL+ TA G ++  ++  AY  V+ ID+  G+ R DIG ++ 
Sbjct: 364 IFHAGTASRNGSLVGNGGRVLNVTATGNSVAAAQAAAYAAVDAIDFPSGFCRRDIGWREV 423

Query: 415 ERNVK 419
           ER  K
Sbjct: 424 EREAK 428


>gi|297528682|ref|YP_003669957.1| phosphoribosylamine/glycine ligase [Geobacillus sp. C56-T3]
 gi|297251934|gb|ADI25380.1| phosphoribosylamine/glycine ligase [Geobacillus sp. C56-T3]
          Length = 430

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 264/421 (62%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREHA+AWK AQSPL+ +L+  PGNPGIA  A+ V ID  +  A++ F ++
Sbjct: 1   MNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL +GI D   A G ++FGPSQRAA +E SK+FAK+   KYGIPTA +
Sbjct: 61  QAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
             F+   +AK Y++ K  PIVVKADGL AGKGV VA TV+E       + +D  F    S
Sbjct: 121 ATFTSYEEAKAYIEQKGAPIVVKADGLAAGKGVTVAQTVEEALAAAKAALVDGQFGTAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYLEG E SF A  +G+   P   A+DHKR +DGD GPNTGGMGA SP   +S E
Sbjct: 181 QVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++ I+ P  + +  E  PF GVL+AGLM T  GP +IE+N RFGDPE Q ++ RL
Sbjct: 241 MIDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D++E + + + G      + W  E  L VV+A KGYP  Y  G  I  + + +    L
Sbjct: 301 KTDLVEAVLAVMDGK--ELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALL 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT         NGGRVL   A G+T+ +++E AY  +  ID    ++R DIG +  E
Sbjct: 359 FHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE 418

Query: 416 R 416
           R
Sbjct: 419 R 419


>gi|152972867|ref|YP_001338013.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238892481|ref|YP_002917215.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262043754|ref|ZP_06016857.1| phosphoribosylamine-glycine ligase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150957716|gb|ABR79746.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238544797|dbj|BAH61148.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259038878|gb|EEW40046.1| phosphoribosylamine-glycine ligase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 431

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 280/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQNVAIGVTDIPALLRFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+++IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDENIDLTIVGPEAPLVIGVVDAFRAAGLNIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+  +   G L      W    +L VVVA  GYP  Y  G  I  +PQ    
Sbjct: 301 LRMKSDLVELCLAACAGKLDEKTSEWDDRASLGVVVAAGGYPGSYNTGDEIYGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG ++ ++++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLSDDQRVVTNGGRVLCVTALGDSVAQAQQRAYQLLTDIRWDGSFSRSDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|168823111|ref|ZP_02835111.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205340587|gb|EDZ27351.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320088605|emb|CBY98364.1| phosphoribosylamine-glycine ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 429

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 283/426 (66%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A+++F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A+ GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIASGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|254506382|ref|ZP_05118524.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus 16]
 gi|219550556|gb|EED27539.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus 16]
          Length = 429

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/427 (45%), Positives = 273/427 (63%), Gaps = 13/427 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   V I ++  S ++ F 
Sbjct: 1   MRVLIIGAGGREHALGWKAAQNPNVETVFVAPGNAGTALEPKLENVNIGVEAISELVSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QEK I+L +VGPE PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QEKKIELTIVGPEAPLVIGVVDAFREAGLPIFGPTEAAAQLEGSKAFTKDFLARHKIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DGK+ +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGKSVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E  P+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHERILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS   +    
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRASIGVVLAAGGYPADYAKGDVISLPTEQADD 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGTA  NN    +  NGGRVL ATALG +++E++E AY + + + W   + R DI
Sbjct: 361 QKIFHAGTA--NNAAGEVVTNGGRVLCATALGNSVSEAQEKAYALAKQVSWNGMFHRNDI 418

Query: 410 GLQKKER 416
           G +   R
Sbjct: 419 GYRAIAR 425


>gi|91203298|emb|CAJ72937.1| strongly similar to glycinamide ribonucleotide synthetase (GARS,
           glycinamide ribonucleotide synthetase) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 435

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/419 (44%), Positives = 276/419 (65%), Gaps = 7/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHA+AWKIAQSP + +++  PGNPGIA+ A+CV ID+ N   + +F   
Sbjct: 15  MKILIIGSGGREHAIAWKIAQSPKVKKIFCAPGNPGIAEVAECVDIDVNNIEGLFNFAIR 74

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL++GI D        +FGPS+RA+ +E SK FAK    K+ IPTA +
Sbjct: 75  QKIDLTVVGPEDPLLSGIVDTFKDGNLDIFGPSKRASLIEGSKVFAKTIMKKHSIPTADF 134

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F D   A++Y++    PIV+KADGL  GKGV V  T++EA        ++R F     
Sbjct: 135 RVFEDIKMAEKYLEKCFAPIVIKADGLAKGKGVFVCKTLEEAKEHLQEIMVERIFGNAGD 194

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE L G EVS  A+ DG+T IP ++ARDHK I++G+ GPNTGGMGA SP+  ++ E
Sbjct: 195 RVVIEECLHGEEVSILAITDGQTIIPLSSARDHKAIYEGNKGPNTGGMGAYSPSHLITNE 254

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V + I++P I  M++E  P+ G+++AGLM+T  GP ++E+N RFGDPE QA+++R+
Sbjct: 255 MQRYVEENILVPIIHAMKRENRPYSGIIYAGLMLTNAGPKVLEFNARFGDPETQALLVRM 314

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           +SD+  +L +  +  L    + W   +++ VV+A+KGYP +Y  G  IS +   +     
Sbjct: 315 KSDLASLLLAASNNTLDKAELEWYDSHSVCVVLASKGYPGKYRKGLPISGLQAVKALKNI 374

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           Q+FHAGTA V+ N+  NGGRVL  TA GK + E+R   Y  ++ + ++  Y+R+DIG+ 
Sbjct: 375 QVFHAGTANVHGNIVTNGGRVLGITATGKDLKEARTFVYDAIDRLSFEGVYYRKDIGVD 433


>gi|283836744|ref|ZP_06356485.1| phosphoribosylamine--glycine ligase [Citrobacter youngae ATCC
           29220]
 gi|291067297|gb|EFE05406.1| phosphoribosylamine--glycine ligase [Citrobacter youngae ATCC
           29220]
          Length = 429

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/429 (45%), Positives = 283/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAISVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P  + T
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLESST 360

Query: 353 -TQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DAKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQQRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|90581300|ref|ZP_01237097.1| phosphoribosylamine--glycine ligase [Vibrio angustum S14]
 gi|90437539|gb|EAS62733.1| phosphoribosylamine--glycine ligase [Vibrio angustum S14]
          Length = 429

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A   +   V I +++ +A++ F 
Sbjct: 1   MKVLIIGNGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVEIGVEDIAALVEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AA   +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNRIGLTIVGPEAPLVIGVVDAFRAAKLPIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T  +A  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVVKADGLAAGKGVIVAMTEQKAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           +E++  V++++I PT+EGM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 KEIHDRVMKEVIYPTVEGMAAEGAPYTGFLYAGLMIMSDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+  + +   L      W    ++ VV+A  GYP  Y  G +IS +PQ    
Sbjct: 301 LRMQSDLVELCLAAIDEKLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPQQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAG A  N N+  NGGRVL ATA+G T+ E+++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFHAGAANNNGNIVTNGGRVLCATAMGDTVLEAQQRAYALAKQISWDGMFHRDDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|134300200|ref|YP_001113696.1| phosphoribosylamine--glycine ligase [Desulfotomaculum reducens
           MI-1]
 gi|134052900|gb|ABO50871.1| phosphoribosylamine--glycine ligase [Desulfotomaculum reducens
           MI-1]
          Length = 422

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/422 (43%), Positives = 270/422 (63%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHAL WK+ QSP + +++  PGN GI+Q A C+ +  ++   +++F ++
Sbjct: 1   MKILVVGGGGREHALVWKLRQSPRVKQIYCAPGNAGISQIAACINVRAEDTQGLLNFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE+PL NGI D     G K+FGPS+ AA++E SK+ AK    KY IPTA Y
Sbjct: 61  EQIDLTVVGPEIPLTNGIVDLFQQEGLKIFGPSKAAAEIEGSKALAKDIMAKYNIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F D  +A++YV+    P V+KADGL AGKGV+VA   + A +A+D     R F +   
Sbjct: 121 ATFEDAEEAREYVKKYGAPCVIKADGLAAGKGVIVAMDDETALAAVDIIMAERAFGKAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G EVS  A  DG+T +P   ++DHKR+ D D GPNTGGMGA +PA   + E
Sbjct: 181 RVVIEEFLQGEEVSILAFVDGETIVPMVASQDHKRVGDQDTGPNTGGMGAYAPAPVYTSE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   V + I+ PT++ +  E   ++GVL+AGLM+T +GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LAKLVERDILYPTVKALASEGRTYRGVLYAGLMVTPEGPKVLEFNARFGDPETQPVLSLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+++I+ + +   L    + WK E A+ VV+A KGYP EY     I+   Q     ++
Sbjct: 301 ETDLVDIMEAIMEDRLAQQSVMWKDEAAVCVVMAAKGYPGEYEKDMAITGFDQVPAGVEV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT +    +  +GGRVL  TA G+ I+++ ELAY  V+ I +   ++R DIG +   
Sbjct: 361 FHAGTTLRQGEVVVSGGRVLGVTATGRDISKAVELAYQGVKAIHFAGAHYRSDIGQRALN 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|95930762|ref|ZP_01313495.1| phosphoribosylamine--glycine ligase [Desulfuromonas acetoxidans DSM
           684]
 gi|95133242|gb|EAT14908.1| phosphoribosylamine--glycine ligase [Desulfuromonas acetoxidans DSM
           684]
          Length = 423

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 262/423 (61%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHAL WKIAQSPL+ +++  PGNPG+ + A+ V + + N   +  F  +
Sbjct: 1   MKILVVGGGGREHALVWKIAQSPLVEKVYCAPGNPGMKELAETVHLAVDNIDGLCDFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL  GI D   A G  +FGPS+ AA++E SK F+K    KYGI TA Y
Sbjct: 61  EQIDLTVVGPELPLTLGIVDRFKAQGLAIFGPSKAAAQIEGSKGFSKDLMAKYGIKTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F+D   A  Y++ +  PIVVK DGL AGKGV++A TVDEA +A+D     + F     
Sbjct: 121 ESFTDRDAAAAYIRQQGAPIVVKVDGLAAGKGVILAQTVDEAIAAVDDILVKKTFGDAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE+L G E SFFA  DGK  +P  +++DHK+I DGD GPNTGGMGA SPA  ++  
Sbjct: 181 AVVVEEFLTGEEASFFAFTDGKNILPLASSQDHKQIFDGDKGPNTGGMGAYSPAPVVTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           LY  ++ +++ PTI+GM  E  P+ G+LF GLMI      ++E+N RFGDPECQ ++ R+
Sbjct: 241 LYQRIVDEVVQPTIDGMAAEGCPYCGILFVGLMIENDDFKVLEFNARFGDPECQPLLSRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           +SD++ +L  C  G L    + W    A+ VV+A  GYP  Y  G +I  I         
Sbjct: 301 KSDVVPVLLDCARGELTTKALEWYDRAAVCVVLAAGGYPASYSKGDVIEGIDAANAVDGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA  +  +   GGRVL  T  G+T+  + + AY   + I W     R DIG + 
Sbjct: 361 RVFHAGTAEQDGRIVTAGGRVLGVTGWGETVAVAIDKAYEGADKIQWNGMQMRRDIGQKA 420

Query: 414 KER 416
            +R
Sbjct: 421 LKR 423


>gi|222616781|gb|EEE52913.1| hypothetical protein OsJ_35522 [Oryza sativa Japonica Group]
          Length = 385

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 201/384 (52%), Positives = 257/384 (66%), Gaps = 15/384 (3%)

Query: 50  NHSAIIHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKF 109
           N  A+I FC+   + LVVVGPE PLV G+++ L  AG   FGPS  AA LE SK F KK 
Sbjct: 2   NSDAVISFCRNWGVGLVVVGPEAPLVAGLANELVKAGIPTFGPSSEAAALEGSKDFMKKL 61

Query: 110 CTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR- 168
           C KY IPTA YQ F+DP  AK+YV+ +  PIVVKADGL AGKGVVVA T+++A  AID  
Sbjct: 62  CDKYHIPTAKYQSFTDPSDAKKYVEEQGAPIVVKADGLAAGKGVVVAMTLEKAFEAIDSM 121

Query: 169 ----CFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMG 224
                F    S VI+EEYLEG EVSFFAL DG+TA+P  +A+DHKR+ DGD+GPNTGGMG
Sbjct: 122 LVEGSFGSAGSRVIVEEYLEGEEVSFFALVDGETALPLESAQDHKRVGDGDVGPNTGGMG 181

Query: 225 ACSPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG--PYLIEYNVR 282
           A SPA  ++++L   V++ II+PT++GM  E   F GVL+AG+MI ++   P LIEYNVR
Sbjct: 182 AYSPAPIVTEKLKCKVMESIIVPTVKGMATEGCKFVGVLYAGIMIEKKSGLPKLIEYNVR 241

Query: 283 FGDPECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTI 342
           FGDPECQ +MMRL+SD+ ++L +   G L +  + W  E A  VV+A++GYP  Y  GT+
Sbjct: 242 FGDPECQVLMMRLQSDLAQVLLAACRGELGSVSLTWSPELATVVVMASEGYPGVYKKGTV 301

Query: 343 ISKI---PQNTGTTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENI 398
           I  I    Q +   ++FHAGTA+  + N  A GGRVL  TA GK I E+R  AY  ++ +
Sbjct: 302 IKNIDEAEQVSPAVKIFHAGTALDRDGNFVAAGGRVLGVTAKGKDIEEARAKAYDALDVV 361

Query: 399 DWKHGYWREDIGLQKKERNVKYRN 422
           DW  G++R DIG     R  KYR 
Sbjct: 362 DWPEGFFRHDIGW----RAQKYRR 381


>gi|56418803|ref|YP_146121.1| phosphoribosylamine--glycine ligase [Geobacillus kaustophilus
           HTA426]
 gi|56378645|dbj|BAD74553.1| phosphoribosylglycinamide synthetase (glycinamide ribonucleotide
           synthetase) (phosphoribosylglycinamide synthetase)
           [Geobacillus kaustophilus HTA426]
          Length = 430

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 264/421 (62%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREHA+AWK AQSPL+ +L+  PGNPGIA  A+ V ID  +  A++ F ++
Sbjct: 1   MNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL +GI D   A G ++FGPSQRAA +E SK+FAK+   KYGIPTA +
Sbjct: 61  QAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
             F+   +AK Y++ K  PIV+KADGL AGKGV VA TV+E       + +D  F    S
Sbjct: 121 AAFTSYEEAKAYIEQKGAPIVIKADGLAAGKGVTVAQTVEEALAAAKAALVDGQFGTAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYLEG E SF A  +G+   P   A+DHKR +DGD GPNTGGMGA SP   +S E
Sbjct: 181 QVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++ I+ P  + +  E  PF GVL+AGLM T  GP +IE+N RFGDPE Q ++ RL
Sbjct: 241 MMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D++E + + + G      + W  E  L VV+A KGYP  Y  G  I  + + +    L
Sbjct: 301 KTDLVEAVLAVMDGK--ELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALL 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT         NGGRVL   A G+T+ +++E AY  +  ID    ++R DIG +  E
Sbjct: 359 FHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE 418

Query: 416 R 416
           R
Sbjct: 419 R 419


>gi|158431213|pdb|2YRW|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus
           Kaustophilus
 gi|158431214|pdb|2YRX|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus
           Kaustophilus
 gi|158431219|pdb|2YS6|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus
           Kaustophilus
 gi|158431220|pdb|2YS7|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus
           Kaustophilus
          Length = 451

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 264/421 (62%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREHA+AWK AQSPL+ +L+  PGNPGIA  A+ V ID  +  A++ F ++
Sbjct: 22  MNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQ 81

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL +GI D   A G ++FGPSQRAA +E SK+FAK+   KYGIPTA +
Sbjct: 82  QAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADH 141

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
             F+   +AK Y++ K  PIV+KADGL AGKGV VA TV+E       + +D  F    S
Sbjct: 142 AAFTSYEEAKAYIEQKGAPIVIKADGLAAGKGVTVAQTVEEALAAAKAALVDGQFGTAGS 201

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYLEG E SF A  +G+   P   A+DHKR +DGD GPNTGGMGA SP   +S E
Sbjct: 202 QVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISDE 261

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++ I+ P  + +  E  PF GVL+AGLM T  GP +IE+N RFGDPE Q ++ RL
Sbjct: 262 MMDAALEAILRPAAKALAAEGRPFLGVLYAGLMATANGPKVIEFNARFGDPEAQVVLPRL 321

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D++E + + + G      + W  E  L VV+A KGYP  Y  G  I  + + +    L
Sbjct: 322 KTDLVEAVLAVMDGK--ELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALL 379

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT         NGGRVL   A G+T+ +++E AY  +  ID    ++R DIG +  E
Sbjct: 380 FHAGTKREGGAWYTNGGRVLLLAAKGETLAKAKEKAYEQLAAIDCDGLFYRRDIGRRAIE 439

Query: 416 R 416
           R
Sbjct: 440 R 440


>gi|261250475|ref|ZP_05943050.1| phosphoribosylamine--glycine ligase [Vibrio orientalis CIP 102891]
 gi|260939044|gb|EEX95031.1| phosphoribosylamine--glycine ligase [Vibrio orientalis CIP 102891]
          Length = 429

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 274/427 (64%), Gaps = 13/427 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   V ID++  S ++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFVAPGNAGTALEPKLENVNIDVEAISELVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QEK I+L +VGPE PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QEKKIELTIVGPEAPLVIGVVDAFREAGLPIFGPTEAAAQLEGSKAFTKDFLARHKIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTEIEPALAYVRQQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG++ +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGQSVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E +P+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHERILEEVIYPTVRGMDAEGHPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS   +    
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRASIGVVLAAGGYPADYAKGDVISLPAEQADA 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGTA  NN    +  NGGRVL ATALG +++E++E AY + + + W   + R DI
Sbjct: 361 QKIFHAGTA--NNAAGEVVTNGGRVLCATALGNSVSEAQEKAYALAKQVSWNGMFHRNDI 418

Query: 410 GLQKKER 416
           G +   R
Sbjct: 419 GYRAIAR 425


>gi|325926801|ref|ZP_08188108.1| phosphoribosylamine--glycine ligase [Xanthomonas perforans 91-118]
 gi|325542822|gb|EGD14278.1| phosphoribosylamine--glycine ligase [Xanthomonas perforans 91-118]
          Length = 431

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 280/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  + E+   PGN G A  A+C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSARVREVLVAPGNAGTATEAKCRNVAIKVNDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGKHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            ++++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PQVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++L++ + G L   H  W    +L VV+A K YP+    G +I+ +     +
Sbjct: 301 LRLQSDLVDLLDAAIDGKLDGAHAQWDPRPSLGVVIAAKPYPDTPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  +E I W + + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVISAGGRVLCVAALGDSVQDAQRNAYAGLEPIHWPNAFQRSDIGW 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|156972571|ref|YP_001443478.1| phosphoribosylamine--glycine ligase [Vibrio harveyi ATCC BAA-1116]
 gi|156524165|gb|ABU69251.1| hypothetical protein VIBHAR_00211 [Vibrio harveyi ATCC BAA-1116]
          Length = 429

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/425 (44%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MNILIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALTYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMTSEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTNNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|296100633|ref|YP_003610779.1| phosphoribosylglycineamide synthetase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055092|gb|ADF59830.1| phosphoribosylglycineamide synthetase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 430

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 280/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ + D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   + +II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP  Y  G  I  +P + T 
Sbjct: 301 LRMKSDLVELCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGHYNTGDEIHGLPLEETE 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  NGGRVL ATALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GAKVFHAGTKLADDDRVLTNGGRVLCATALGHTVAEAQKRAYALMADIHWNGSFSRQDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|188989922|ref|YP_001901932.1| phosphoribosylamine--glycine ligase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167731682|emb|CAP49860.1| purD [Xanthomonas campestris pv. campestris]
          Length = 431

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/430 (44%), Positives = 281/430 (65%), Gaps = 11/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSARVSEVLVAPGNAGTATEAKCRNVAIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLSEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DG  A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGTHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD+++++ + + G L      W    +L VV+A K YPE    G +I+ +     +
Sbjct: 301 LRLQSDLVDLVEAAIDGTLDAAQAQWDPRPSLGVVIAAKPYPETPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAEGQVISAGGRVLCVAALGDSVLDAQRTAYAGLQPIQWASAFQRSDIGW 420

Query: 412 Q--KKERNVK 419
           +   +ER+ +
Sbjct: 421 RAIARERDAQ 430


>gi|320179531|gb|EFW54482.1| Phosphoribosylamine--glycine ligase [Shigella boydii ATCC 9905]
          Length = 429

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKIIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|320200154|gb|EFW74743.1| Phosphoribosylamine--glycine ligase [Escherichia coli EC4100B]
          Length = 429

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETIFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|288958826|ref|YP_003449167.1| phosphoribosylamine--glycine ligase [Azospirillum sp. B510]
 gi|288911134|dbj|BAI72623.1| phosphoribosylamine--glycine ligase [Azospirillum sp. B510]
          Length = 428

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 212/428 (49%), Positives = 269/428 (62%), Gaps = 12/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL W I++SPL   L+  PGN GIA  A  V I  ++  A++ F QE
Sbjct: 1   MKVLVVGSGGREHALCWAISRSPLCDALYCAPGNAGIADVATLVPIGSEDVEALVRFVQE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VVVGPE  LV G+ D L A G K FGP+  AA+LE SK F K    KYG+PTA Y
Sbjct: 61  TAIDFVVVGPEGALVLGLVDRLTALGVKAFGPNAAAAELEGSKGFMKDILAKYGVPTAFY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F DP  AK YV+    PIVVK DGL AGKGV VA +  EA  AID       F    +
Sbjct: 121 ERFKDPDAAKAYVRKHGAPIVVKTDGLAAGKGVTVARSEREAFEAIDDALVGGRFGAAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE+L+G EVSFFALCDG+ A+P  +A+DHK + DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 EVVVEEFLDGEEVSFFALCDGENALPLASAQDHKAVGDGDTGPNTGGMGAYSPAPVLTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI--TEQGPY--LIEYNVRFGDPECQAM 291
           L   V+++IILPT++GM  E  PF+GVLFAGLMI  T  GP    +E+NVRFGDPECQ +
Sbjct: 241 LQERVMREIILPTVKGMAAEGKPFKGVLFAGLMIMATPDGPVPKTLEFNVRFGDPECQTL 300

Query: 292 MMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG 351
           MMRL+SD L  L +   G L    + W  + AL VV+A  GYP +Y   T I  +     
Sbjct: 301 MMRLKSDALAALVAAADGVLDGIDLRWHDQTALCVVMAANGYPGDYAKNTEIRGLDTAGA 360

Query: 352 T--TQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
                +FHAGT    +  + + GGRVL  TAL  T+ E++  AY  V+ +DW  G+ R D
Sbjct: 361 VDGVTVFHAGTKRAEDGRVLSVGGRVLGVTALAPTVAEAQAAAYKAVDALDWPDGFCRRD 420

Query: 409 IGLQKKER 416
           IG +   R
Sbjct: 421 IGWRAVGR 428


>gi|78046101|ref|YP_362276.1| phosphoribosylamine--glycine ligase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78034531|emb|CAJ22176.1| phosphoribosylamine-glycine ligase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 431

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 280/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  + E+   PGN G A  A+C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSARVREVLVAPGNAGTATEAKCRNVAIKVNDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGKHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++L++ + G L   H  W    +L VV+A K YP+    G +I+ +     +
Sbjct: 301 LRLQSDLVDLLDAAIDGKLDGAHAQWDPRPSLGVVIAAKPYPDTPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W + + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVISAGGRVLCVAALGDSVQDAQRNAYAGLKPIHWPNAFQRSDIGW 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|168264569|ref|ZP_02686542.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205346981|gb|EDZ33612.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 429

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMADIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|119899185|ref|YP_934398.1| phosphoribosylamine--glycine ligase [Azoarcus sp. BH72]
 gi|119671598|emb|CAL95511.1| Phosphoribosylamine--glycine ligase [Azoarcus sp. BH72]
          Length = 425

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/424 (44%), Positives = 271/424 (63%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHALAWK+AQSP ++ +   PGNPG A+  +   + +    A++   ++
Sbjct: 1   MKVLVIGSGGREHALAWKLAQSPRVTRVLVAPGNPGTAREPKLQNVSVTAIDALVTLARD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   VVGPE PL  G+ DA  AAG  +FGP++ AA+LESSK FAK+F  ++ IPTA Y
Sbjct: 61  EQVGFTVVGPEAPLAAGVVDAFRAAGLPIFGPTKNAAQLESSKDFAKRFLVRHNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q FSD  +A  Y++ +  PIV+KADGL AGKGVVVA T+DEA  AID            +
Sbjct: 121 QTFSDAAEAHAYIEAEGAPIVIKADGLAAGKGVVVAMTLDEAHGAIDMMLLDNKMGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+++G E SF  + DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 RVVIEEFMQGEEASFIVMADGKHALPLATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II PT+ GM  +  P+ G L+AGLMI + G P ++E+N R GDPE Q +MMR
Sbjct: 241 VHARVMREIIQPTLAGMAADGLPYTGFLYAGLMIDDAGKPRVVEFNCRMGDPETQPIMMR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTT 353
           L++D+ +++ + + G L      W    AL VV+A  GYP+    G  IS +P       
Sbjct: 301 LKTDLADLVEAAIAGKLDQAETEWDRRIALGVVLAAGGYPDSPKKGDAISGLPAAALDDA 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA  +  +   GGRVL  TALG  +  +++ AY + + I ++   +R DIG + 
Sbjct: 361 HVFHAGTAEQDGAIVTAGGRVLCVTALGDNVKAAQKRAYELADAIQFEGRQFRRDIGHRA 420

Query: 414 KERN 417
             R 
Sbjct: 421 VARK 424


>gi|204931273|ref|ZP_03222033.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204319888|gb|EDZ05095.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 429

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACEGKLDGKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|74314499|ref|YP_312918.1| phosphoribosylamine--glycine ligase [Shigella sonnei Ss046]
 gi|73857976|gb|AAZ90683.1| phosphoribosylglycinamide synthetase [Shigella sonnei Ss046]
 gi|323167476|gb|EFZ53184.1| phosphoribosylamine--glycine ligase [Shigella sonnei 53G]
          Length = 429

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|332085406|gb|EGI90576.1| phosphoribosylamine--glycine ligase [Shigella dysenteriae 155-74]
          Length = 429

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|21229972|ref|NP_635889.1| phosphoribosylamine--glycine ligase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66766848|ref|YP_241610.1| phosphoribosylamine--glycine ligase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|25091070|sp|Q8PD48|PUR2_XANCP RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|21111486|gb|AAM39813.1| phosphoribosylamine-glycine ligase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572180|gb|AAY47590.1| phosphoribosylamine-glycine ligase [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 431

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/430 (44%), Positives = 281/430 (65%), Gaps = 11/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A+C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSARVSEVLVAPGNAGTATEAKCRNVAIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLGEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DG  A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGTHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PEVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD+++++ + + G L      W    +L VV+A K YPE    G +I+ +     +
Sbjct: 301 LRLQSDLVDLVEAAIDGTLDAAQAQWDPRPSLGVVIAAKPYPETPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAEGQVISAGGRVLCVAALGDSVLDAQRTAYAGLQPIQWASAFQRSDIGW 420

Query: 412 Q--KKERNVK 419
           +   +ER+ +
Sbjct: 421 RAIARERDAQ 430


>gi|218697713|ref|YP_002405380.1| phosphoribosylamine--glycine ligase [Escherichia coli 55989]
 gi|256021674|ref|ZP_05435539.1| phosphoribosylamine--glycine ligase [Shigella sp. D9]
 gi|260858115|ref|YP_003232006.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O26:H11 str. 11368]
 gi|332282917|ref|ZP_08395330.1| phosphoribosylglycinamide synthetase [Shigella sp. D9]
 gi|218354445|emb|CAV01261.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli 55989]
 gi|257756764|dbj|BAI28266.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O26:H11 str. 11368]
 gi|323155545|gb|EFZ41722.1| phosphoribosylamine--glycine ligase [Escherichia coli EPECa14]
 gi|323182105|gb|EFZ67515.1| phosphoribosylamine--glycine ligase [Escherichia coli 1357]
 gi|332105269|gb|EGJ08615.1| phosphoribosylglycinamide synthetase [Shigella sp. D9]
          Length = 429

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|157163474|ref|YP_001460792.1| phosphoribosylamine--glycine ligase [Escherichia coli HS]
 gi|331670860|ref|ZP_08371695.1| phosphoribosylamine--glycine ligase [Escherichia coli TA271]
 gi|157069154|gb|ABV08409.1| phosphoribosylamine--glycine ligase [Escherichia coli HS]
 gi|324115437|gb|EGC09382.1| phosphoribosylamine-glycine ligase [Escherichia coli E1167]
 gi|331061948|gb|EGI33872.1| phosphoribosylamine--glycine ligase [Escherichia coli TA271]
          Length = 429

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|149911049|ref|ZP_01899677.1| phosphoribosylamine--glycine ligase [Moritella sp. PE36]
 gi|149805875|gb|EDM65863.1| phosphoribosylamine--glycine ligase [Moritella sp. PE36]
          Length = 429

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG GGREHAL WK AQS  +  ++  PGN G +   +C  V I +++  A++ F 
Sbjct: 1   MNVLIIGGGGREHALGWKAAQSKHVETVFIAPGNIGSSLENKCKNVPIQVEDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE  I+L +VGPE+PLV G+ DA  A G  +FGP+Q AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  QENKIELTIVGPEVPLVLGVVDAFQAEGLAIFGPTQGAAQLEGSKAFSKDFFARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   AK YV     PIV+KADGL AGKGV++A T  +A SAID       F   
Sbjct: 121 AYQNFTEIAPAKAYVSEMGCPIVIKADGLAAGKGVIIAETEAQAFSAIDDMLEGNKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L G E SF  + DG+  +   T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLVGEEASFIVMVDGENILALATSQDHKARDNGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q ++   + ++I PT++GM+ E N + G L+AGLMI   G   ++EYN RFGDPE Q +M
Sbjct: 241 QAVHDFAMNEVIRPTVDGMKAEGNTYTGFLYAGLMIAPDGTAKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+SD++E+  + V G L     ++    A+ VV+A  GYP +Y  G II+ +P+   T
Sbjct: 301 MRLKSDLVELCLAAVAGKLDTVTADYDERAAVGVVIAAGGYPADYAKGDIITGLPKTDST 360

Query: 353 -TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            +++FHAGTA+  +N+  NGGRVL ATALG T+TE++E AY +   I W+  ++R DIG 
Sbjct: 361 ESKVFHAGTALQGDNIVTNGGRVLCATALGNTVTEAQENAYKLAAQISWEGAFYRTDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|16762282|ref|NP_457899.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29143770|ref|NP_807112.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161617314|ref|YP_001591279.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197249645|ref|YP_002149083.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|213161650|ref|ZP_03347360.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213428475|ref|ZP_03361225.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580342|ref|ZP_03362168.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213612382|ref|ZP_03370208.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213647188|ref|ZP_03377241.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289826731|ref|ZP_06545696.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|20139495|sp|Q8Z334|PUR2_SALTI RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|25293795|pir||AC0931 phosphoribosylglycineamide synthetase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504586|emb|CAD09469.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139405|gb|AAO70972.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161366678|gb|ABX70446.1| hypothetical protein SPAB_05165 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197213348|gb|ACH50745.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 429

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|224585715|ref|YP_002639514.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224470243|gb|ACN48073.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322717123|gb|EFZ08694.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 429

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/429 (45%), Positives = 282/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|238752804|ref|ZP_04614272.1| Phosphoribosylamine--glycine ligase [Yersinia rohdei ATCC 43380]
 gi|238709002|gb|EEQ01252.1| Phosphoribosylamine--glycine ligase [Yersinia rohdei ATCC 43380]
          Length = 428

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 274/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A   +   +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPRLENVDIGVMDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEIEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPY-LIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM  E N + G L+AGLMI+  G   +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMISTDGQLKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL SD++E+  +   G L     +W    AL VV A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRLRSDLVELCLAGTQGKLDEKTSDWDERPALGVVFAAGGYPADYRQGDVIYGLPQQEAA 360

Query: 353 T-QLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG+++ ++++ AY + ENI W+  ++R+DIG
Sbjct: 361 DGKVFHAGTRLDSNNNVVTSGGRVLCVTALGESVAQAQQRAYELAENIQWEGAFYRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|121535468|ref|ZP_01667278.1| phosphoribosylamine--glycine ligase [Thermosinus carboxydivorans
           Nor1]
 gi|121305977|gb|EAX46909.1| phosphoribosylamine--glycine ligase [Thermosinus carboxydivorans
           Nor1]
          Length = 425

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 199/415 (47%), Positives = 267/415 (64%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L+IGSGGREHAL WK+A SP +++++  PGNPGIA  A+CV+ID  + +A+  F  E
Sbjct: 1   MRILVIGSGGREHALVWKLAASPRVTQIYCAPGNPGIAALAECVSIDASDIAALRQFALE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL+ G++D   A G KVFGP Q AA++E SK+FAK    KY IPTA +
Sbjct: 61  RQIDLTVVGPELPLMQGLADEFAAYGLKVFGPKQAAARIEGSKAFAKALMQKYNIPTAKF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
             F D   A   ++    P+VVKADGL AGKGVVVA TV EA  A+     DR F    +
Sbjct: 121 AVFEDIAAAMDCIRRWGAPVVVKADGLAAGKGVVVAQTVAEALDAVQTIMRDRAFGAAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEY+EG E S  A  DG T +P   A+DHKR  DGD GPNTGGMGA +PA  ++  
Sbjct: 181 RVVIEEYMEGEEASVLAFTDGYTVVPMVAAQDHKRACDGDHGPNTGGMGAYAPAPVVTAA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V+++I+ P ++ +++E   +QG L+AGLMIT  GP ++E+N RFGDPE QA++  L
Sbjct: 241 VRERVVREILQPVVDALRQEGCLYQGCLYAGLMITADGPKVVEFNARFGDPETQAVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIIS-KIPQNTGTTQ 354
            SD++ I+ +CV G LH   I W    A+ VV A  GYP  Y  G +IS           
Sbjct: 301 ASDLVMIMEACVDGRLHEIDIAWADGAAVCVVAAAGGYPGPYRKGDVISGLAAAEAAGAL 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
           +FHAGTAI +  L  +GGRVL  TA  +TI  + + AY  + NI++ + ++R DI
Sbjct: 361 IFHAGTAISDGKLVTSGGRVLGVTACAETIATAVDKAYRAINNINFANIHYRRDI 415


>gi|16767429|ref|NP_463044.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167994977|ref|ZP_02576067.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|131617|sp|P26977|PUR2_SALTY RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|154288|gb|AAA27198.1| 5-phosphoribosylglycinamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|6960361|gb|AAF33521.1| Salmonella typhimurium phosphoribosylamine--glycine ligase
           (SW:P26977); contains similarity to Pfam domain PF01071
           (GARS), Score=962, E=1.5e-285, N=1 [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16422734|gb|AAL23003.1| phosphoribosylglycinamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|205327266|gb|EDZ14030.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261249279|emb|CBG27141.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996476|gb|ACY91361.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|312915281|dbj|BAJ39255.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321223375|gb|EFX48442.1| Phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|332990994|gb|AEF09977.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 429

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|261418596|ref|YP_003252278.1| phosphoribosylamine--glycine ligase [Geobacillus sp. Y412MC61]
 gi|319765411|ref|YP_004130912.1| phosphoribosylamine/glycine ligase [Geobacillus sp. Y412MC52]
 gi|261375053|gb|ACX77796.1| phosphoribosylamine/glycine ligase [Geobacillus sp. Y412MC61]
 gi|317110277|gb|ADU92769.1| phosphoribosylamine/glycine ligase [Geobacillus sp. Y412MC52]
          Length = 430

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 198/421 (47%), Positives = 265/421 (62%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREHA+AWK AQSPL+ +L+  PGNPGIA  A+ + ID  +  A++ F ++
Sbjct: 1   MNVLVIGRGGREHAIAWKAAQSPLVGKLYVAPGNPGIADVAELIPIDELDIEALVQFAKQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL +GI D   A G ++FGPSQRAA +E SK+FAK+   KYGIPTA +
Sbjct: 61  QAIDLTIVGPEAPLASGIVDRFMAEGLRIFGPSQRAALIEGSKAFAKELMKKYGIPTADH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
             F+   +AK Y++ K  PIVVKADGL AGKGV VA TV++       + +D  F    S
Sbjct: 121 ATFTSYEEAKAYIEQKGAPIVVKADGLAAGKGVTVAQTVEDALAAAKAALVDGQFGTAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYLEG E SF A  +G+   P + A+DHKR +DGD GPNTGGMGA SP   +S E
Sbjct: 181 QVVIEEYLEGEEFSFMAFVNGEKVYPLSIAQDHKRAYDGDEGPNTGGMGAYSPVPQISAE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
              T ++ I+ P  + +  E  PF GVL+AGL+ T  GP +IE+N RFGDPE Q ++ RL
Sbjct: 241 TVETALETILRPAAKALVAEGRPFTGVLYAGLIETATGPKVIEFNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D++E + + + G      + W  E  L VV+A KGYP  Y  G  I  + + +    L
Sbjct: 301 KTDLVEAVLAVMDGK--ELELEWTDEAVLGVVLAAKGYPGAYERGAEIRGLDRISPDALL 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT         NGGRVL   A G+T+ E++E AY  +  ID    ++R DIG +  E
Sbjct: 359 FHAGTKREGGAWYTNGGRVLLLAAKGETLAEAKERAYEQLAAIDCDGLFYRRDIGRRAIE 418

Query: 416 R 416
           R
Sbjct: 419 R 419


>gi|168234403|ref|ZP_02659461.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194471203|ref|ZP_03077187.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194457567|gb|EDX46406.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205331662|gb|EDZ18426.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 429

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P ++  
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEDAA 360

Query: 352 TTQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + + N +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADGNRVLTSGGRVLCATALGHTVAEAQKRAYALMIDIRWDGNFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|302608236|emb|CBW44467.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Marinobacter hydrocarbonoclasticus]
          Length = 428

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSP   +++  PGN G A+  + + V +D+ +   + +F 
Sbjct: 1   MNILVIGSGGREHALAWKAAQSPQADKVFVAPGNAGTAREPNLENVDLDVMDLDGLANFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ ++ L +VGPE PLV G+ D   A G ++FGPS  AA+LE SK+F K F  +  IPTA
Sbjct: 61  EQNNVGLTIVGPEAPLVAGVVDKFEARGLRIFGPSAGAAQLEGSKAFTKDFLARQKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y +F+D  +A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 DYANFTDVDEALAYVREKGAPIVVKADGLAAGKGVIVAMTLAEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGKNVLAMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  ++ ++I PT+ GM  E +P++G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 ADVHQRIMDEVIYPTVNGMAAEGHPYKGFLYAGLMIDTSGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+  + V G L      W    ++ +V+A  GYP  Y  G +IS +P   T 
Sbjct: 301 LRMKSDLVELCQAAVDGKLDACDSEWDERASVGIVLAAGGYPASYDKGDVISGLPDGETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++   GGRVL ATALG T+TE+++ AY + + I W   ++R DI  
Sbjct: 361 GEKVFHAGTKLNGDDVVTAGGRVLCATALGNTVTEAQQRAYELAKKISWNGMFYRNDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|161505337|ref|YP_001572449.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160866684|gb|ABX23307.1| hypothetical protein SARI_03482 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 433

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 196/426 (46%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPKVKTVFVAPGNAGTALEPTLQNVAISVTDIPALLSFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHNIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    +L VV+A  GYP +Y  G  I  +P +   
Sbjct: 305 LRLKSDLVDLCLAACDGRLDEKTSEWDDRASLGVVMAAGGYPGDYRTGDEIHGLPLEEVA 364

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + N++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 365 DGKVFHAGTTLSNDDRVLTSGGRVLCATALGDTVAEAQQRAYALMTDIHWDDCFCRNDIG 424

Query: 411 LQKKER 416
            +  ER
Sbjct: 425 WRAIER 430


>gi|24115289|ref|NP_709799.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2a str. 301]
 gi|30064713|ref|NP_838884.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2a str.
           2457T]
 gi|24054584|gb|AAN45506.1| phosphoribosylglycinamide synthetase, GAR synthetase [Shigella
           flexneri 2a str. 301]
 gi|30042973|gb|AAP18695.1| phosphoribosylglycinamide synthetase, GAR synthetase [Shigella
           flexneri 2a str. 2457T]
 gi|281603389|gb|ADA76373.1| Phosphoribosylglycinamide synthetase, GAR synthetase [Shigella
           flexneri 2002017]
 gi|313648656|gb|EFS13096.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2a str.
           2457T]
 gi|332749203|gb|EGJ79625.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2747-71]
 gi|332762852|gb|EGJ93111.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2930-71]
 gi|332765549|gb|EGJ95763.1| phosphoribosylamine--glycine ligase [Shigella flexneri K-671]
 gi|333014355|gb|EGK33708.1| phosphoribosylamine--glycine ligase [Shigella flexneri K-304]
          Length = 429

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 281/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  +++ PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFAAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALVYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDNGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L+VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLSVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|239995219|ref|ZP_04715743.1| Phosphoribosylamine-glycine ligase [Alteromonas macleodii ATCC
           27126]
          Length = 430

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/430 (45%), Positives = 277/430 (64%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG GGREHALA+K AQS  +S ++  PGN G A   +   VAID+ + + ++ F 
Sbjct: 1   MNVLVIGGGGREHALAFKAAQSSDVSTVFVAPGNAGTATEPKLENVAIDVNDIAGLVSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   ++L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QGNDVELTIVGPEAPLVAGVVDAFTNAGLMIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+ K  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 EYQNFTEIDPAIAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRAADGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  ++Q++I+PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 QDIHDRIMQEVIMPTVNGMAAEGNDYVGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++ +  +   G L    I +    ++ VV+A  GYP  Y  G +I+   +    
Sbjct: 301 LRLKSDLVPLCQAACKGELAGETIEFDERASVGVVLAAGGYPGSYDKGDVITGFEEAAKL 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATALG  +TE+++ AY +++ I +K  Y+R DI  
Sbjct: 361 DGKVFHAGTALQDGEVVTAGGRVLCATALGNNVTEAQQKAYELLKAIQFKDVYYRTDIAH 420

Query: 412 QKKERNVKYR 421
           +   R  + +
Sbjct: 421 RAIAREAEAK 430


>gi|323703214|ref|ZP_08114867.1| phosphoribosylamine/glycine ligase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531873|gb|EGB21759.1| phosphoribosylamine/glycine ligase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 425

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/421 (44%), Positives = 272/421 (64%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHAL WK+ QSP + +++  PGN GI+Q A CV I   +   +++F Q+
Sbjct: 1   MKILVVGGGGREHALVWKLRQSPKVDQIFCAPGNAGISQIATCVNIPAGDVYGLLNFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE+PL NGI D    AG K+FGP++ AA++E SK+ AK+   KY IPTA Y
Sbjct: 61  QQIDLTVVGPEIPLTNGIVDIFEQAGLKIFGPTRAAAEIEGSKALAKEIMAKYNIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F+D  +AK+Y++    P VVKADGL AGKGV+VA   + A +A+D     R F Q   
Sbjct: 121 GIFADAAQAKEYIKQYGAPCVVKADGLAAGKGVIVAMDEETALAAVDIIMAQRAFGQAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYL+G EVS  A  +G T IP   ++DHKR+ D D GPNTGGMGA +PA   + E
Sbjct: 181 KVVIEEYLQGEEVSVLAFVEGDTIIPMVASQDHKRVGDHDTGPNTGGMGAYAPAPLYTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   V + I+ PT++ +  E  P++GVL+AGLMIT+ GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LAEIVERDILQPTVKALAAEGRPYRGVLYAGLMITDAGPKVLEFNARFGDPETQPVLSLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+++I+ + + G L +  + WK   A+ VV+A +GYP  Y  G  I  +       ++
Sbjct: 301 ETDLVDIIEAILEGRLASQPVTWKNGAAVCVVMAAQGYPGNYERGQEIKGLNNLPSGIEV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTA+ +  +  +GGRVL  TA+G  I ++ + AY  V  I +   ++R DIG +  E
Sbjct: 361 FHAGTALKDGKIVTDGGRVLGVTAVGTDIADAIKKAYQGVAAIHFAGAHYRTDIGQKALE 420

Query: 416 R 416
           +
Sbjct: 421 K 421


>gi|160933237|ref|ZP_02080626.1| hypothetical protein CLOLEP_02083 [Clostridium leptum DSM 753]
 gi|156868311|gb|EDO61683.1| hypothetical protein CLOLEP_02083 [Clostridium leptum DSM 753]
          Length = 428

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/420 (46%), Positives = 271/420 (64%), Gaps = 12/420 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L++GSGGREHAL  K+ +SP   E++  PGN GI++ A CV I  ++   I  F +E
Sbjct: 6   MRILMVGSGGREHALIRKLKESPRCEEIYCAPGNGGISKDAVCVDISAEDIDGIAAFAKE 65

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K+IDLV V P+ PL  G+ DAL  AG + FGP + AA +ESSK F+K    KYGIPTA Y
Sbjct: 66  KNIDLVFVAPDDPLAAGMVDALEQAGIRAFGPRKNAAVIESSKVFSKNLMKKYGIPTAGY 125

Query: 121 QHFSDPMKAKQYV--QNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
           + FS+P KA +Y+  QNK  P+VVKADGL  GKGV++   ++EA  A+     D+ F   
Sbjct: 126 EVFSEPKKAIEYITAQNK-FPVVVKADGLALGKGVMICQDLEEAKEAVHSIMEDKIFGAS 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V++EE++ G EVS  +  DGKT +P  +++DHKR +DGD G NTGGMG  SP    S
Sbjct: 185 GNQVVVEEFITGPEVSVLSFTDGKTVVPMVSSKDHKRAYDGDRGLNTGGMGTISPNPHYS 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
            E+    +++I  PTI+ M++E  PFQG L+ GLM+T+ GP +IEYN RFGDPE Q ++ 
Sbjct: 245 GEMARRCMKEIFQPTIDAMREEGRPFQGCLYFGLMLTQDGPKVIEYNSRFGDPETQVVLP 304

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN---T 350
           RL++D++EIL +C+ G L    I W  E A  VV+A+ GYP+ YP G  I  + +N   +
Sbjct: 305 RLKTDLVEILEACIDGTLKELDIQWSDEAAACVVMASGGYPKSYPKGIEIKGLDENGQIS 364

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           G T ++HAGT   +     NGGRVL  TA G  + E+ E AY  VE I +   ++R+DIG
Sbjct: 365 GAT-VYHAGTVYRDGRFFTNGGRVLGVTACGAGLDEALEKAYDAVERISFDGAHYRKDIG 423


>gi|292493441|ref|YP_003528880.1| phosphoribosylamine/glycine ligase [Nitrosococcus halophilus Nc4]
 gi|291582036|gb|ADE16493.1| phosphoribosylamine/glycine ligase [Nitrosococcus halophilus Nc4]
          Length = 442

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/426 (46%), Positives = 266/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A   +   VAI   N  A++ F 
Sbjct: 6   MKVLVIGGGGREHALAWKLAQSPKVDRVYVAPGNAGTALEPKLENVAIKPDNIPALVAFA 65

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + I L VVGPE PLV GI DA   AG    GP + AA+LE +KSFAK F  + GIPTA
Sbjct: 66  SAEQIGLTVVGPEAPLVLGIVDAFEEAGLGCLGPHREAARLEGAKSFAKDFLMRCGIPTA 125

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y+ FS+   A  Y++ +  PIVVKADGL AGKGVVVA T  EA  A+        F + 
Sbjct: 126 RYRTFSEVESAVAYIKMQGAPIVVKADGLAAGKGVVVAQTEQEAIDAVHGMLAGGAFGEA 185

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G EVSF  L DG+  +P  +++DHK    GD GPNTGGMGA SPA  ++
Sbjct: 186 GRRVVVEEFLRGEEVSFIVLTDGEHILPLASSQDHKARDRGDTGPNTGGMGAYSPAPVVT 245

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           + ++  V+Q++I+PT+ GM +E  P++G L+AGLMI E G P ++EYN RFGDPE Q +M
Sbjct: 246 EAVHKRVMQEVIVPTVRGMAEEGYPYRGFLYAGLMIAEDGSPRVLEYNCRFGDPEAQPIM 305

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL SD++ +  + + G LH   + W +  AL VV+A KGYP  YP G  I  +P     
Sbjct: 306 MRLRSDLVALCQAALEGRLHEVDVTWDSRAALGVVMAAKGYPGSYPVGDPIYGLPAPERE 365

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            +++FH GTA     +   GGRVL    LG ++T+++  AY +V+ I WK  Y+R DIG 
Sbjct: 366 DSKVFHGGTAEKEGRIVTAGGRVLCVCGLGDSVTQAQATAYALVQQITWKEAYYRTDIGY 425

Query: 412 QKKERN 417
           +   R 
Sbjct: 426 RAVARE 431


>gi|27262160|gb|AAN87361.1| Phosphoribosylamine--glycine ligase [Heliobacillus mobilis]
          Length = 438

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/428 (45%), Positives = 271/428 (63%), Gaps = 12/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           ++VL++G GGREHAL WK+ QSP +SE++  PGN GI + A+CV I   + + ++ F  E
Sbjct: 9   LKVLVVGGGGREHALVWKLRQSPRVSEVYCAPGNAGIEKIAKCVNIKADDVTGLLTFAWE 68

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL VVGPE PL  GI D  N     +FGP+Q+AA++E SK+F+K    KYGIPTA+Y
Sbjct: 69  KRIDLTVVGPEAPLSAGIVDVFNDHEMPIFGPTQKAAEIEGSKAFSKDLMQKYGIPTASY 128

Query: 121 QHFSDPMKAKQYVQNKSM-------PIVVKADGLCAGKGVVVAATVDEATSAI-----DR 168
             F++   A  +V   +        P VVKADGL AGKGV+VA  V EA  A+       
Sbjct: 129 GVFTEVEPALAFVDELAARKTIAGSPCVVKADGLAAGKGVIVAKDVTEAKEAVRSMLEGN 188

Query: 169 CFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSP 228
            F    S V+IEE++EG EVS  A  DG   IP  +A+DHKRI D D GPNTGGMGA SP
Sbjct: 189 AFGSAGSRVVIEEFMEGEEVSILAFTDGDHVIPMVSAQDHKRIFDNDEGPNTGGMGAYSP 248

Query: 229 ALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPEC 288
           A   ++EL   V + I+ PT+E M+ E  P+ GVL+AGLMIT +GP ++EYN RFGDPE 
Sbjct: 249 APVYTEELAQQVQESILKPTVEAMKAEGRPYSGVLYAGLMITAEGPKVLEYNARFGDPET 308

Query: 289 QAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ 348
           Q ++MRL++D+++I+ + +   L    I+W  + A+ VV++ KGYP +Y  G  I+ +  
Sbjct: 309 QPVLMRLDTDLVDIIEAILEKRLDQQAISWSTDAAVCVVMSAKGYPGDYEKGNFITGLDN 368

Query: 349 NTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
                ++FHAGTA   +++   GGRVL  TA  + I E+ ELAY  V N+ +   ++R+D
Sbjct: 369 PIAGVEVFHAGTAQKGDHVVTTGGRVLGVTAKAQGIREAIELAYRQVGNVCFDGAHYRKD 428

Query: 409 IGLQKKER 416
           IG +  ER
Sbjct: 429 IGRRALER 436


>gi|193066412|ref|ZP_03047459.1| phosphoribosylamine--glycine ligase [Escherichia coli E22]
 gi|194429955|ref|ZP_03062464.1| phosphoribosylamine--glycine ligase [Escherichia coli B171]
 gi|209921485|ref|YP_002295569.1| phosphoribosylamine--glycine ligase [Escherichia coli SE11]
 gi|218556560|ref|YP_002389474.1| phosphoribosylamine--glycine ligase [Escherichia coli IAI1]
 gi|260846805|ref|YP_003224583.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O103:H2 str. 12009]
 gi|293474313|ref|ZP_06664722.1| phosphoribosylamine-glycine ligase [Escherichia coli B088]
 gi|300819817|ref|ZP_07100004.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 107-1]
 gi|192925936|gb|EDV80583.1| phosphoribosylamine--glycine ligase [Escherichia coli E22]
 gi|194411984|gb|EDX28297.1| phosphoribosylamine--glycine ligase [Escherichia coli B171]
 gi|209914744|dbj|BAG79818.1| phosphoribosylglycinamide synthase [Escherichia coli SE11]
 gi|218363329|emb|CAR00979.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli IAI1]
 gi|257761952|dbj|BAI33449.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O103:H2 str. 12009]
 gi|291321343|gb|EFE60784.1| phosphoribosylamine-glycine ligase [Escherichia coli B088]
 gi|300527638|gb|EFK48700.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 107-1]
 gi|323161302|gb|EFZ47211.1| phosphoribosylamine--glycine ligase [Escherichia coli E128010]
 gi|323943606|gb|EGB39714.1| phosphoribosylamine-glycine ligase [Escherichia coli H120]
 gi|324017341|gb|EGB86560.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 117-3]
          Length = 429

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|308048134|ref|YP_003911700.1| phosphoribosylamine--glycine ligase [Ferrimonas balearica DSM 9799]
 gi|307630324|gb|ADN74626.1| phosphoribosylamine--glycine ligase [Ferrimonas balearica DSM 9799]
          Length = 428

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/424 (44%), Positives = 275/424 (64%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHALAWK+AQ+P + +++  PGN G A   +   + +  + A++ F +E
Sbjct: 2   MKVLVIGSGGREHALAWKVAQNPAVEQVFVAPGNAGTATEPKVENVAVSGNEALVAFARE 61

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             + L +VGPE PLV G+ DA +AAG  +FGP+  AA+LE SK+F K F  ++ IPTA Y
Sbjct: 62  NGVGLTIVGPEAPLVEGVVDAFDAAGLTIFGPTAAAAQLEGSKAFTKDFLARHAIPTAEY 121

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           Q+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A++       F     
Sbjct: 122 QNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLAEAEAAVEDMLAGNAFGDAGH 181

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++Q 
Sbjct: 182 RVVIEEFLEGEEASFIVMVDGDNILPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTQA 241

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           ++  ++ ++I PT++GM+ E +P++G L+AGLMI   G P +IEYN RFGDPE Q +M+R
Sbjct: 242 IHDRIMAEVIRPTVDGMKAEGHPYKGFLYAGLMIDADGTPKVIEYNCRFGDPETQPIMLR 301

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI-PQNTGTT 353
           ++SD++E+  +   G L      +    A+ VV+A+ GYP  Y  G  IS +  +     
Sbjct: 302 MQSDLVELCLAACEGKLDQHTAEFDPRAAVGVVLASGGYPASYEKGFAISGLRTEYAEGE 361

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA  +  +   GGRVL ATALG T+TE+++ AY + + I W+  + R DI  + 
Sbjct: 362 KVFHAGTAEQDGAIVNTGGRVLCATALGHTVTEAQQRAYALADQISWQGMFTRRDIAYRA 421

Query: 414 KERN 417
             R 
Sbjct: 422 IARE 425


>gi|138893924|ref|YP_001124377.1| phosphoribosylamine--glycine ligase [Geobacillus
           thermodenitrificans NG80-2]
 gi|196250526|ref|ZP_03149217.1| phosphoribosylamine--glycine ligase [Geobacillus sp. G11MC16]
 gi|134265437|gb|ABO65632.1| Phosphoribosylamine-glycine ligase [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210016|gb|EDY04784.1| phosphoribosylamine--glycine ligase [Geobacillus sp. G11MC16]
          Length = 430

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 263/421 (62%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++G GGREHA+AWK+AQSPL  +L++ PGNPGI + A+ V ID  +  A++ F ++
Sbjct: 1   MNILVVGRGGREHAIAWKVAQSPLAGKLYAAPGNPGIGEVAELVNIDELDIDALVQFAKQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL +VGPE PL  GI+D   A G ++FGP+Q AA +E SK+FAK+    YGIPTA +
Sbjct: 61  NAIDLTIVGPEAPLAAGIADRFMAEGLRIFGPNQAAALIEGSKAFAKELMKTYGIPTAEH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
             FS   +AK Y++ K  PIV+KADGL AGKGV VA TV+E       + +D  F    S
Sbjct: 121 ATFSSYEEAKAYIEEKGAPIVIKADGLAAGKGVTVAQTVEEALAAAKAALVDGQFGTAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYLEG E SF A  +G+   P   A+DHKR +DGD GPNTGGMGA SP   +S +
Sbjct: 181 QVVIEEYLEGEEFSFMAFVNGEKVYPLAIAQDHKRAYDGDEGPNTGGMGAYSPVPQISAD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++ I+ PT + +  E  PF GVL+AGL+ T +GP +IE+N RFGDPE Q ++ RL
Sbjct: 241 MVQRALETILRPTAKALASEGRPFTGVLYAGLIATAEGPKVIEFNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+LE + + + G      + W  E  L VV+A KGYP  Y  G  I  + +      L
Sbjct: 301 KTDLLEAILAVMEGK--ELELEWTNEAVLGVVLAAKGYPGAYERGVAIRGLDRLAPDALL 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT      L  NGGRVL   A G T+ E++E AY  +  I+    ++R DIG +  E
Sbjct: 359 FHAGTKREGGTLYTNGGRVLLLAAKGGTLAEAKEKAYQQLAAIECDGLFYRRDIGRRAIE 418

Query: 416 R 416
           R
Sbjct: 419 R 419


>gi|269959586|ref|ZP_06173967.1| phosphoribosylamine--glycine ligase [Vibrio harveyi 1DA3]
 gi|269835644|gb|EEZ89722.1| phosphoribosylamine--glycine ligase [Vibrio harveyi 1DA3]
          Length = 429

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHRIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTDNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQICWDGMFHRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|168467893|ref|ZP_02701730.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197264018|ref|ZP_03164092.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|238913753|ref|ZP_04657590.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|195629008|gb|EDX48400.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197242273|gb|EDY24893.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
          Length = 429

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|121594259|ref|YP_986155.1| phosphoribosylamine--glycine ligase [Acidovorax sp. JS42]
 gi|120606339|gb|ABM42079.1| phosphoribosylamine--glycine ligase [Acidovorax sp. JS42]
          Length = 428

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK++QSP  S+++  PGN G A   +   + I + +A+  + Q 
Sbjct: 1   MKILVIGGGGREHALAWKLSQSPKTSKVYVAPGNGGTALSPKYENVPISDVTALREWAQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D     G ++FGP+Q AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  QKIALTVVGPEAPLAAGVVDEFRTHGLRIFGPTQAAAQLESSKAFSKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF---------Q 171
           + F+DP  A  YV     PIV+KADGL AGKGVVVA T+ EA  A+D             
Sbjct: 121 ETFTDPQAAHAYVDRLGAPIVIKADGLAAGKGVVVAMTLQEAHDAVDFMLVDNKYGVAHN 180

Query: 172 QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG 231
           +  + V+IE++LEG E SF  LCDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  
Sbjct: 181 EGGARVVIEQFLEGEEASFIVLCDGKNVLALATSQDHKRLKDGDQGPNTGGMGAYSPAPV 240

Query: 232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQA 290
           ++ ++++  ++++ILPTI GM+K+  P+ G L+AGLMI   G P  +E+N R GDPE Q 
Sbjct: 241 VTADVHARAMREVILPTIRGMEKDGIPYTGFLYAGLMIDATGHPKTLEFNCRMGDPETQP 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           ++MRL+SD++E+L + V G L    + W    AL VV+A +GYPE    G  I+ +PQ+ 
Sbjct: 301 ILMRLKSDLVEVLGAAVDGKLDQVELQWDRRTALGVVMAAQGYPENPRKGDAITGLPQDA 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
               +FHAGT +V+  +  +GGRVL  TAL  ++ ++++  Y +   I +    +R DIG
Sbjct: 361 DDAMVFHAGTQLVDGVVRTSGGRVLCVTALADSVKQAQQRVYDVARGIHFDGAQYRHDIG 420

Query: 411 LQKKERN 417
            +  + N
Sbjct: 421 HRAVKAN 427


>gi|194445679|ref|YP_002043423.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194404342|gb|ACF64564.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
          Length = 429

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|259906950|ref|YP_002647306.1| Phosphoribosylamine-glycine ligase [Erwinia pyrifoliae Ep1/96]
 gi|224962572|emb|CAX54027.1| Phosphoribosylamine-glycine ligase [Erwinia pyrifoliae Ep1/96]
 gi|283476744|emb|CAY72579.1| phosphoribosylamine-glycine ligase [Erwinia pyrifoliae DSM 12163]
          Length = 426

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +   +++F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALQNVAISPTDIQGLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + IDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LNEKIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRKKGAPIVIKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVRGMAAEGNVYTGFLYAGLMINKSGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V+GNL      W   ++L VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAAVNGNLDQKDSVWDPRHSLGVVLAAGGYPGDYVNGQPIQGLPSEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL  TALG+ +  +++ AY + + I W   + R DIG 
Sbjct: 361 DGKVFHAGTTLQDDRVVTSGGRVLCVTALGEDVAAAQQRAYQLAKPISWHGSFCRTDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIDR 425


>gi|301154809|emb|CBW14272.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Haemophilus parainfluenzae T3T1]
          Length = 429

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/425 (45%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  ++++ PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFAAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHDRIMREVIYPTVNGMAAEGNVYTGFLYAGLMIMSNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RLESD++E+      G L      W  + +L +V+A +GYP +Y  G +IS +PQ+   
Sbjct: 301 LRLESDLIELCLKACEGKLDEVKSQWNPKASLGIVLAAEGYPGDYRKGDVISGLPQSAVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ ++++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEKEGKLVTNGGRVLCVTALGESVFDAQQKALKLAEQIQWTGRFYRRDIGY 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAVER 425


>gi|330813629|ref|YP_004357868.1| phosphoribosylamine--glycine ligase [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486724|gb|AEA81129.1| phosphoribosylamine--glycine ligase [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 420

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/415 (45%), Positives = 273/415 (65%), Gaps = 5/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M V +IGSGGREHAL +K++ S  +S+L+ IPGNPG     + + ID  N   +     +
Sbjct: 1   MNVAVIGSGGREHALCFKLSLSKKISKLFCIPGNPGTDSICENIEIDPLNFDLLYSVLLK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K+I  V+VGPE+PLV GI D L+      FGPS+ A++LE SK F KK C  + IPTA Y
Sbjct: 61  KNISTVIVGPEIPLVKGIVDFLSEKNIFTFGPSKEASQLEGSKDFMKKLCKDFNIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ---QINSTV 177
           + F + +KA+ +++    P+V+K+DGL AGKGV ++  V+E+T       +   + +S V
Sbjct: 121 ESFDNLLKAQDFIKKSKHPLVIKSDGLAAGKGVTISNNVEESTKCAKEILEGKFKTSSKV 180

Query: 178 IIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELY 237
           +IEE+LEG E S+F + DG+  +P  TA+DHKRI + D G NTGGMGA SP+L ++ ++ 
Sbjct: 181 VIEEFLEGEEASYFVITDGENYLPIGTAQDHKRIGENDTGLNTGGMGAYSPSLLITNDMQ 240

Query: 238 STVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLES 297
             + +KII PTI+ +      F G+L+AGLMI    P LIEYN+RFGDPECQ +MMRLE+
Sbjct: 241 EKINKKIIEPTIKSLNTIGCSFVGILYAGLMIKNNEPKLIEYNIRFGDPECQVIMMRLEN 300

Query: 298 DILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQL 355
           D+L+++ S  + NL +  I WK +  +TVV + KGYPEEY   T I  +   +N  T QL
Sbjct: 301 DLLDLILSVKNKNLDDQKIFWKKDPCITVVASAKGYPEEYQTKTHIKNLENIENNFTQQL 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FHAGT  V+  + ANGGRVL+ATA+  ++ E+R+ A+ M++ +DW+  Y+R DI 
Sbjct: 361 FHAGTIEVDKKILANGGRVLNATAVASSLQEARDKAHQMLDLVDWEDKYFRRDIA 415


>gi|200388238|ref|ZP_03214850.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199605336|gb|EDZ03881.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 429

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVGTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|56416001|ref|YP_153076.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364928|ref|YP_002144565.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205354423|ref|YP_002228224.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207859353|ref|YP_002246004.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|56130258|gb|AAV79764.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197096405|emb|CAR62010.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205274204|emb|CAR39222.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206711156|emb|CAR35530.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|326629555|gb|EGE35898.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|260870716|ref|YP_003237118.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O111:H- str. 11128]
 gi|257767072|dbj|BAI38567.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O111:H- str. 11128]
 gi|323177561|gb|EFZ63146.1| phosphoribosylamine--glycine ligase [Escherichia coli 1180]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKVFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|168239601|ref|ZP_02664659.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194734737|ref|YP_002117076.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194710239|gb|ACF89460.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197287734|gb|EDY27125.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|322616284|gb|EFY13194.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322617273|gb|EFY14175.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625955|gb|EFY22770.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626647|gb|EFY23449.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631482|gb|EFY28239.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635195|gb|EFY31913.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642600|gb|EFY39196.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646811|gb|EFY43315.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650809|gb|EFY47202.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655891|gb|EFY52192.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657290|gb|EFY53569.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322665552|gb|EFY61737.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669735|gb|EFY65880.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670986|gb|EFY67118.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322679190|gb|EFY75243.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322679348|gb|EFY75395.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322688115|gb|EFY84079.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195792|gb|EFZ80967.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200697|gb|EFZ85770.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202186|gb|EFZ87242.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209297|gb|EFZ94232.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211622|gb|EFZ96459.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323218040|gb|EGA02753.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221329|gb|EGA05751.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225744|gb|EGA09965.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230968|gb|EGA15085.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235750|gb|EGA19832.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240064|gb|EGA24110.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242603|gb|EGA26625.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249689|gb|EGA33596.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252572|gb|EGA36413.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323256934|gb|EGA40646.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262043|gb|EGA45607.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323263951|gb|EGA47465.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268436|gb|EGA51906.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 282/426 (66%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +++ IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  RDEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|323190137|gb|EFZ75415.1| phosphoribosylamine--glycine ligase [Escherichia coli RN587/1]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|113461762|ref|YP_719831.1| phosphoribosylamine--glycine ligase [Haemophilus somnus 129PT]
 gi|112823805|gb|ABI25894.1| phosphoribosylamine--glycine ligase [Haemophilus somnus 129PT]
          Length = 432

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/430 (46%), Positives = 275/430 (63%), Gaps = 15/430 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQC----VAIDIQNHSAI 54
           M +L+IG+GGREHAL WK+AQSPL S+++  PGN G A     +C    VAI   +  A+
Sbjct: 1   MNILIIGNGGREHALVWKVAQSPLASKIFVAPGNAGTAMETDGKCAVENVAISATDIDAL 60

Query: 55  IHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYG 114
           ++F QE  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ 
Sbjct: 61  VNFAQENQIGLTIVGPEAPLVLGVVDAFRAAGLKIFGPTQGAAQLEGSKAFTKDFLARHH 120

Query: 115 IPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RC 169
           IPTA Y+ F++  KA  YV+ K  PIVVKADGL  GKGV+VA T+ EA  A+        
Sbjct: 121 IPTAEYRSFTEVEKAIAYVREKGAPIVVKADGLATGKGVIVAMTLAEAEKAVQDMLSGNA 180

Query: 170 FQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA 229
           F +  + V+IEE+LEG E SF  + DGK   P  T++DHKR+ + D GPNTGGMGA SPA
Sbjct: 181 FGKAGNRVVIEEFLEGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGPNTGGMGAYSPA 240

Query: 230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPEC 288
             ++ E+++ ++Q+II PT+ GM KE N + G L+AGLMI + G P +IE+N RFGDPE 
Sbjct: 241 PVVTPEIHTRIMQQIIYPTVNGMAKEGNIYTGFLYAGLMIDKHGQPKVIEFNCRFGDPET 300

Query: 289 QAMMMRLESDILEI-LNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP 347
           Q +MMR+ SD++E+ LN+C  G L      W  + AL +V+A +GYP  Y  G  I  +P
Sbjct: 301 QPIMMRMRSDLVELCLNAC-EGKLDQVKSEWSEQAALGIVLAAEGYPNNYRKGDEIQGLP 359

Query: 348 QNTGTTQ-LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
            + G  Q +F AG       L  NGGRVL  TA+G+ +  +++ A  + + I W   ++R
Sbjct: 360 ISAGENQKVFLAGVEQKGERLLTNGGRVLCVTAMGENVFAAQQQALKLAKQIQWSGRFYR 419

Query: 407 EDIGLQKKER 416
           +DIG +   R
Sbjct: 420 QDIGYRAVAR 429


>gi|281181069|dbj|BAI57399.1| phosphoribosylglycinamide synthetase [Escherichia coli SE15]
 gi|330908321|gb|EGH36840.1| phosphoribosylamine--glycine ligase [Escherichia coli AA86]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|324110917|gb|EGC04909.1| phosphoribosylamine-glycine ligase [Escherichia fergusonii B253]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|222110897|ref|YP_002553161.1| phosphoribosylamine--glycine ligase [Acidovorax ebreus TPSY]
 gi|221730341|gb|ACM33161.1| phosphoribosylamine/glycine ligase [Acidovorax ebreus TPSY]
          Length = 428

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK++QSP  S+++  PGN G A   +   + I + +A+  + Q 
Sbjct: 1   MKILVIGGGGREHALAWKLSQSPKTSKVYVAPGNGGTALSPKYENVPISDVTALREWAQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D     G ++FGP+Q AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  QKIALTVVGPEAPLAAGVVDEFRTHGLRIFGPTQAAAQLESSKAFSKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF---------Q 171
           + F+DP  A  YV     PIV+KADGL AGKGVVVA T+ EA  A+D             
Sbjct: 121 ETFTDPQAAHAYVNRLGAPIVIKADGLAAGKGVVVAMTLQEAHDAVDFMLVDNKYGVAHN 180

Query: 172 QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG 231
           +  + V+IE++LEG E SF  LCDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  
Sbjct: 181 EGGARVVIEQFLEGEEASFIVLCDGKNVLALATSQDHKRLKDGDQGPNTGGMGAYSPAPV 240

Query: 232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQA 290
           ++ ++++  ++++ILPTI GM+K+  P+ G L+AGLMI   G P  +E+N R GDPE Q 
Sbjct: 241 VTADVHARAMREVILPTIRGMEKDGIPYTGFLYAGLMIDATGHPKTLEFNCRMGDPETQP 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           ++MRL+SD++E+L + V G L    + W    AL VV+A +GYPE    G  I+ +PQ+ 
Sbjct: 301 ILMRLKSDLVEVLGAAVDGKLDQVELQWDRRTALGVVMAAQGYPENPRKGDAITGLPQDA 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
               +FHAGT +V+  +  +GGRVL  TAL  ++ ++++  Y +   I +    +R DIG
Sbjct: 361 DDAMVFHAGTQLVDGVVRTSGGRVLCVTALADSVKQAQQRVYDVARGIHFDGAQYRHDIG 420

Query: 411 LQKKERN 417
            +  + N
Sbjct: 421 HRAVKAN 427


>gi|222035716|emb|CAP78461.1| Phosphoribosylamine--glycine ligase [Escherichia coli LF82]
 gi|312948579|gb|ADR29406.1| phosphoribosylamine--glycine ligase [Escherichia coli O83:H1 str.
           NRG 857C]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLIELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|215489337|ref|YP_002331768.1| phosphoribosylamine--glycine ligase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215267409|emb|CAS11860.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O127:H6 str. E2348/69]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|329296838|ref|ZP_08254174.1| phosphoribosylamine/glycine ligase [Plautia stali symbiont]
          Length = 452

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/427 (45%), Positives = 273/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNVAISATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+++IDL +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  IPTA
Sbjct: 61  QQENIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLNGEEASFIVMVDGDNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM+ E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQIIWPTVNGMKAEGNTYTGFLYAGLMIDNAGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++ +  + V G L      W    +L VV+A  GYP  Y  G  I  +P ++  
Sbjct: 301 LRLQSDLVALCLAAVDGKLDQQQSQWDPRPSLGVVLAAGGYPGNYNTGDQIHGLPLEDVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL  TALG+ +  +++ AY + ++I W   + R DIG 
Sbjct: 361 DGKVFHAGTTLKDDLVVTSGGRVLCVTALGEDVAAAQKNAYALAQHISWNGSFCRNDIGY 420

Query: 412 QKKERNV 418
           +   R V
Sbjct: 421 RAINRKV 427


>gi|323498787|ref|ZP_08103773.1| phosphoribosylamine--glycine ligase [Vibrio sinaloensis DSM 21326]
 gi|323316149|gb|EGA69174.1| phosphoribosylamine--glycine ligase [Vibrio sinaloensis DSM 21326]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 274/427 (64%), Gaps = 13/427 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFVAPGNAGTALEPKLENVNIGVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QEK I+L +VGPE PLV G+ DA    G  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QEKKIELTIVGPEAPLVIGVVDAFREVGLPIFGPTQAAAQLEGSKAFTKDFLARHDIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
           +Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 SYANFTEIEPAIAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGSSVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIAADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS    +   
Sbjct: 301 MRMESDLVELCLMAIDEKLDQAESKWDPRASIGVVLAAGGYPADYAKGDVISLPTGDVEG 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGTA  NN   ++  NGGRVL ATALG +++E++E AY + + + W   + R DI
Sbjct: 361 QKIFHAGTA--NNEAGDVVTNGGRVLCATALGNSVSEAQERAYALTKQVSWNGMFHRNDI 418

Query: 410 GLQKKER 416
           G +  ER
Sbjct: 419 GYRAIER 425


>gi|331655706|ref|ZP_08356696.1| phosphoribosylamine--glycine ligase [Escherichia coli M718]
 gi|331046631|gb|EGI18718.1| phosphoribosylamine--glycine ligase [Escherichia coli M718]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|16124552|ref|NP_419116.1| phosphoribosylamine--glycine ligase [Caulobacter crescentus CB15]
 gi|221233238|ref|YP_002515674.1| phosphoribosylamine--glycine ligase [Caulobacter crescentus NA1000]
 gi|20139683|sp|Q9ABD2|PUR2_CAUCR RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|13421438|gb|AAK22284.1| phosphoribosylamine--glycine ligase [Caulobacter crescentus CB15]
 gi|220962410|gb|ACL93766.1| phosphoribosylamine--glycine ligase [Caulobacter crescentus NA1000]
          Length = 427

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/424 (47%), Positives = 267/424 (62%), Gaps = 10/424 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           + +LL+GSGGREHALAWKIAQSPL   L + PGNPGI   A+  A+   +   ++   QE
Sbjct: 4   LTILLVGSGGREHALAWKIAQSPLCGRLVAAPGNPGIEAVAELRAVKATDADGLVALAQE 63

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
              DLVVVGPE  L  G++D L A G   FG SQRAA+LE+SK+F K FC ++G+PTA Y
Sbjct: 64  IGADLVVVGPESALEVGLADKLAAVGIPCFGGSQRAAQLETSKAFTKDFCQRHGLPTAAY 123

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVA----ATVDEATSAIDRCFQQINST 176
             F D   A  ++     P V+KADGL AGKGVV+A    A        +   F    + 
Sbjct: 124 GVFEDAASAGAFLDTLEAPFVIKADGLAAGKGVVIAPDRAAADAAVVDMLGGRFGSAGAR 183

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E S FA+CDGKTA+ F  A+DHKR +DGD GPNTGGMG  SP   ++  L
Sbjct: 184 VVIEEFMHGEEASLFAVCDGKTAVLFGAAQDHKRAYDGDEGPNTGGMGTYSPPPVLTDAL 243

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
                +++I+PT+EGM  E NP+ GVL+AGLM+T  GP L+EYN RFGDPECQ +M+RL+
Sbjct: 244 IDQAWRELIVPTVEGMAAEGNPYVGVLYAGLMLTPTGPKLVEYNARFGDPECQTLMLRLD 303

Query: 297 SDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG-TTQ 354
           SDI+ IL +   G L N     W+ E A+ VV+A +GYP+    G  I     + G    
Sbjct: 304 SDIVPILLAAAKGELANAEPPKWREEAAICVVLAAEGYPDAPKTGGRIQGADADFGDDVV 363

Query: 355 LFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG--- 410
           +FHAGT       L A+GGRVL+  ALG T++E+RE AY  +E I  + G++R DIG   
Sbjct: 364 VFHAGTTREFEGRLVASGGRVLNVCALGATLSEAREAAYGALETISLEGGFYRTDIGWRA 423

Query: 411 LQKK 414
           LQ++
Sbjct: 424 LQQR 427


>gi|300919424|ref|ZP_07135928.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 115-1]
 gi|300413517|gb|EFJ96827.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 115-1]
          Length = 429

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   I++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTIERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|52425351|ref|YP_088488.1| phosphoribosylamine--glycine ligase [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307403|gb|AAU37903.1| PurD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 429

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL S+++  PGN G A+ +    +DI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLASKVFVAPGNAGTARESAVENVDISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ ++ L +VGPE PLV G+ DA   AG  +FGP Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDNNVGLTIVGPEAPLVVGVVDAFEQAGLTIFGPCQSAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           QE++  V+++II PT+ GM  E N ++G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 241 QEIHQRVMEQIIYPTVRGMAAENNVYKGFLYAGLMIDKNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MR++SD++E+      G L      W  + AL +V+A +GYP +Y  G  IS IP Q + 
Sbjct: 301 MRMQSDLVELCLKACKGELDQIKSEWDPQAALGIVLAAEGYPGDYRKGDEISGIPVQASQ 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG ++  +++ A  + E ++W   ++R DIG 
Sbjct: 361 DEKVFLAGVAEKEGKLVTNGGRVLCVTALGNSVLSAQQKALKLAEQVNWTGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|26250777|ref|NP_756817.1| phosphoribosylamine--glycine ligase [Escherichia coli CFT073]
 gi|91212789|ref|YP_542775.1| phosphoribosylamine--glycine ligase [Escherichia coli UTI89]
 gi|117626267|ref|YP_859590.1| phosphoribosylamine--glycine ligase [Escherichia coli APEC O1]
 gi|218561071|ref|YP_002393984.1| phosphoribosylamine--glycine ligase [Escherichia coli S88]
 gi|227885464|ref|ZP_04003269.1| phosphoribosylamine--glycine ligase [Escherichia coli 83972]
 gi|237702772|ref|ZP_04533253.1| phosphoribosylamine-glycine ligase [Escherichia sp. 3_2_53FAA]
 gi|300977007|ref|ZP_07173725.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 45-1]
 gi|301047742|ref|ZP_07194799.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 185-1]
 gi|29427781|sp|Q8FB69|PUR2_ECOL6 RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|26111208|gb|AAN83391.1|AE016770_191 Phosphoribosylamine--glycine ligase [Escherichia coli CFT073]
 gi|91074363|gb|ABE09244.1| Phosphoribosylamine--glycine ligase [Escherichia coli UTI89]
 gi|115515391|gb|ABJ03466.1| phosphoribosylamine--glycine ligase [Escherichia coli APEC O1]
 gi|218367840|emb|CAR05635.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli S88]
 gi|226903085|gb|EEH89344.1| phosphoribosylamine-glycine ligase [Escherichia sp. 3_2_53FAA]
 gi|227837538|gb|EEJ48004.1| phosphoribosylamine--glycine ligase [Escherichia coli 83972]
 gi|294492808|gb|ADE91564.1| phosphoribosylamine--glycine ligase [Escherichia coli IHE3034]
 gi|300300377|gb|EFJ56762.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 185-1]
 gi|300409926|gb|EFJ93464.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 45-1]
 gi|307556148|gb|ADN48923.1| phosphoribosylamine--glycine ligase [Escherichia coli ABU 83972]
 gi|307628379|gb|ADN72683.1| phosphoribosylamine--glycine ligase [Escherichia coli UM146]
 gi|315288326|gb|EFU47725.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 110-3]
 gi|315294359|gb|EFU53710.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 153-1]
 gi|320197099|gb|EFW71717.1| Phosphoribosylamine--glycine ligase [Escherichia coli WV_060327]
 gi|323948824|gb|EGB44721.1| phosphoribosylamine-glycine ligase [Escherichia coli H252]
 gi|323953783|gb|EGB49590.1| phosphoribosylamine-glycine ligase [Escherichia coli H263]
 gi|324009502|gb|EGB78721.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 57-2]
          Length = 429

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|331649859|ref|ZP_08350937.1| phosphoribosylamine--glycine ligase [Escherichia coli M605]
 gi|331041325|gb|EGI13477.1| phosphoribosylamine--glycine ligase [Escherichia coli M605]
          Length = 433

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 305 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 364

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 365 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERE 431


>gi|323492064|ref|ZP_08097226.1| phosphoribosylamine--glycine ligase [Vibrio brasiliensis LMG 20546]
 gi|323313625|gb|EGA66727.1| phosphoribosylamine--glycine ligase [Vibrio brasiliensis LMG 20546]
          Length = 429

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 274/427 (64%), Gaps = 13/427 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ S ++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFVAPGNAGTALEPKLENVNIGVESISELVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK ++L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKQVELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTEIEPALAYVRQQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGASVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI + G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS        
Sbjct: 301 MRMESDLVELCLMAIDEKLDKAESKWDPRASIGVVLAAGGYPADYAKGDVISLPESEQDG 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGTA  NN    +  NGGRVL ATALG +++E++E AY + + + W   + R DI
Sbjct: 361 EKIFHAGTA--NNAAGEVVTNGGRVLCATALGNSVSEAQERAYALAKQVSWNGMFHRNDI 418

Query: 410 GLQKKER 416
           G +  ER
Sbjct: 419 GYRAIER 425


>gi|119475085|ref|ZP_01615438.1| Phosphoribosylamine-glycine ligase [marine gamma proteobacterium
           HTCC2143]
 gi|119451288|gb|EAW32521.1| Phosphoribosylamine-glycine ligase [marine gamma proteobacterium
           HTCC2143]
          Length = 430

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/425 (44%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQS  +  ++  PGN G A  ++C  VAID  +  A+  F 
Sbjct: 1   MNILIIGSGGREHALAWKSAQSDHVDTVFVAPGNAGTATESKCANVAIDTMDFLALATFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ ++ L +VGPE PLV G+ D     G + FGP++ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  KDNNVGLTIVGPEAPLVEGVVDYFAEQGLRCFGPNKGAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y+ F++   A  Y++++  PIV+KADGL AGKGV+VA T  EA  A+        F + 
Sbjct: 121 AYETFTEIEPALLYIKSRGAPIVIKADGLAAGKGVIVALTETEAADAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IE++LEG E SF  + DGK  +P  T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEDFLEGEEASFIVMVDGKNILPMATSQDHKRAGDGDEGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             +Y  ++ ++I PT+ GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 PAIYQRIMDEVIKPTVAGMAAEGNDYTGFLYAGLMINPAGEPRVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL  D++ + NS + G L +T + W    ++ VV+A  GYP +Y  G +IS + + +T 
Sbjct: 301 MRLRGDLITMCNSALDGTLDDTVVEWDPRPSIGVVLAAGGYPGDYAKGNLISGLDKCDTS 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + N  +  +GGRVL ATALG ++TE+++ AY  V  + W + Y+R+DIG 
Sbjct: 361 EAKVFHAGTKLENGQVVTSGGRVLCATALGNSVTEAQQKAYQQVNTLSWDNMYFRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|332143332|ref|YP_004429070.1| Phosphoribosylamine-glycine ligase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327553354|gb|AEB00073.1| Phosphoribosylamine-glycine ligase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 430

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/430 (45%), Positives = 276/430 (64%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG GGREHALA+K AQS  +S ++  PGN G A   +   VAID+ + + ++ F 
Sbjct: 1   MNVLVIGGGGREHALAFKAAQSSDVSTVFVAPGNAGTATEPKLENVAIDVNDIAGLVSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   + L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QGNDVALTIVGPEAPLVAGVVDAFTNAGLMIFGPTQAAAQLEGSKAFTKDFLARHSIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+ K  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 EYQNFTEIDPAIAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAEEAIRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRAADGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           Q+++  ++Q++I+PT++GM  E N + G L+AGLMI   G P  IEYN RFGDPE Q +M
Sbjct: 241 QDIHDRIMQEVIMPTVDGMAAEGNDYVGFLYAGLMIMADGTPKAIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++ +  +   G L    I +    ++ VV+A  GYP  Y  G +I+   +    
Sbjct: 301 LRLKSDLVPLCQAACKGELAGKTIEFDERASVGVVLAAGGYPGSYDKGDVITGFEEAAKL 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATALG  +TE+++ AY +++ I +K  Y+R DI  
Sbjct: 361 DGKVFHAGTALQDGEVVTAGGRVLCATALGNNVTEAQQKAYELLKAIQFKDVYYRTDIAH 420

Query: 412 QKKERNVKYR 421
           +   R  + +
Sbjct: 421 RAIAREAEAK 430


>gi|331675491|ref|ZP_08376240.1| phosphoribosylamine--glycine ligase [Escherichia coli TA280]
 gi|331067369|gb|EGI38775.1| phosphoribosylamine--glycine ligase [Escherichia coli TA280]
          Length = 429

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEADAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|293417507|ref|ZP_06660130.1| phosphoribosylamine-glycine ligase [Escherichia coli B185]
 gi|291430834|gb|EFF03831.1| phosphoribosylamine-glycine ligase [Escherichia coli B185]
          Length = 429

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+++A +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEKAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|301632141|ref|XP_002945149.1| PREDICTED: phosphoribosylamine--glycine ligase-like, partial
           [Xenopus (Silurana) tropicalis]
          Length = 430

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/428 (45%), Positives = 273/428 (63%), Gaps = 14/428 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHALAWK+ QSP  ++++  PGN G AQH +   + I + + +  + Q 
Sbjct: 5   MKVLVIGGGGREHALAWKLIQSPRATKVYLAPGNGGTAQHPKFENLPITDVAQLCEWAQA 64

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + + L VVGPE PL  G+ DA  A G +VFGP++ AA+LESSK F+K F  ++GIPTA Y
Sbjct: 65  QKVGLTVVGPEAPLAAGVVDAFRAHGLRVFGPTRAAAQLESSKVFSKAFMRRHGIPTADY 124

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN------ 174
             F+DP  A  +V+    PIVVKADGL AGKGVVVA T+ +A  A+D  F  ++      
Sbjct: 125 DTFTDPAAAHAFVERMGAPIVVKADGLAAGKGVVVATTLQQAHEAVD--FMLVSDKHGVA 182

Query: 175 -----STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA 229
                + V+IEE+L G E SF  LCDG+ A+   T++DHKR+ DGD GPNTGGMGA SPA
Sbjct: 183 HNAGGARVVIEEFLVGEEASFIVLCDGRNAVALATSQDHKRLRDGDGGPNTGGMGAYSPA 242

Query: 230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPEC 288
             ++ ++++  +++IILPTI GM+ +  P+ G L+AGLMI  +G P  +E+N R GDPE 
Sbjct: 243 PVVTPDVHARAMREIILPTIRGMEMDGMPYTGFLYAGLMIDAKGHPKTLEFNCRMGDPET 302

Query: 289 QAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ 348
           Q ++MRL+SD++E+L + V   L    + W    AL VV+A  GYPE    G  I+ +P 
Sbjct: 303 QPILMRLKSDLMEVLGAAVDARLDEIELQWDRRTALGVVMAAHGYPEAPRQGDAITGLPA 362

Query: 349 NTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +     +FHAGT + +  L  +GGRVL  TAL  +  ++++ AY MV  I +    +R D
Sbjct: 363 DADDAMVFHAGTQLADGVLRTSGGRVLCVTALADSARQAQQRAYDMVRGIHFDGAQYRRD 422

Query: 409 IGLQKKER 416
           IG +  +R
Sbjct: 423 IGHRAVKR 430


>gi|146309882|ref|YP_001174956.1| phosphoribosylamine--glycine ligase [Enterobacter sp. 638]
 gi|145316758|gb|ABP58905.1| phosphoribosylamine--glycine ligase [Enterobacter sp. 638]
          Length = 430

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +S ++  PGN G A     Q VAI + +  A+++F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPRVSTVFVAPGNAGTALEPTLQNVAIGVTDIPALLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QSEKIDLTIVGPEAPLVIGVVDAFRAAGLTIFGPTEGAAQLEGSKAFTKDFLARHKIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   + +II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDDRASLGVVIAAGGYPGDYRNGDEIHGLPLEEVD 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  NGGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 GGKVFHAGTKLADDDRVLTNGGRVLCATALGNTVAEAQKRAYALMADIHWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|322515407|ref|ZP_08068399.1| phosphoribosylamine-glycine ligase [Actinobacillus ureae ATCC
           25976]
 gi|322118562|gb|EFX90794.1| phosphoribosylamine-glycine ligase [Actinobacillus ureae ATCC
           25976]
          Length = 428

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 198/425 (46%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F T++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLTRHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDSGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           + ++  V+ +II PT++GM  E  P+ G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 KAIHQRVMDEIIYPTVQGMASENTPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++E+      G L +    W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVELCLKACEGKLDSVQSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++  +++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFAAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|301160671|emb|CBW20202.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
          Length = 429

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 280/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +   ++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPTLLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|167856537|ref|ZP_02479246.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis 29755]
 gi|167852340|gb|EDS23645.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis 29755]
          Length = 431

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK  QSPL  +++  PGN G A  A  + VAI   + +A+++F 
Sbjct: 1   MNILIIGNGGREHALAWKFRQSPLAEKVFVAPGNAGTALEAGIENVAISATDLTALVNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  + L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  KENEVGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFAKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ F++   A  Y+  K+ PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQTFTEIEPALAYLHQKNAPIVIKADGLAAGKGVIVAMTLAEAEEAVKDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLAGEEASFIVMVDGKNVEPMATSQDHKRVGEGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+Q+II PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PDVHQRVMQEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MRLESD++E+      G L+     W  + AL +V+A +GYP +Y     I+ IP +   
Sbjct: 301 MRLESDLVELCLKACDGKLNEIQSKWCEQAALGIVLAAEGYPADYRQNDEITGIPTDCCA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG +  N  L   GGRVL ATALG T++++++ A  + E I W+  ++R DIG 
Sbjct: 361 DKKVFLAGVSQQNGKLVTKGGRVLCATALGSTVSDAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIQR 425


>gi|325499263|gb|EGC97122.1| phosphoribosylamine-glycine ligase [Escherichia fergusonii ECD227]
          Length = 433

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 305 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 364

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 365 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYGLMTDIHWDDCFCRKDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERE 431


>gi|240948277|ref|ZP_04752663.1| phosphoribosylamine--glycine ligase [Actinobacillus minor NM305]
 gi|240297316|gb|EER47857.1| phosphoribosylamine--glycine ligase [Actinobacillus minor NM305]
          Length = 430

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/430 (45%), Positives = 274/430 (63%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+ QS L S+++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVRQSLLASKVFVAPGNAGTALEEGIENVAISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  I+L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQNAIELTIVGPEAPLVVGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLRQKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+++II PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 ADIHQRVMEEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RLESD++E+      G L      W  + AL +V+A +GYP +Y  G  I+ +P +N  
Sbjct: 301 LRLESDLVELCLKACEGKLDEIQSKWCEQAALGIVLAAEGYPADYRKGDEITGLPTENRA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL ATALG T+ E+++ A  + E I W+  ++R DIG 
Sbjct: 361 DEKVFLAGVEQKEGKLVTNGGRVLCATALGATVFEAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERNVKYR 421
           +   R    R
Sbjct: 421 RAVAREQSGR 430


>gi|298530255|ref|ZP_07017657.1| phosphoribosylamine/glycine ligase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509629|gb|EFI33533.1| phosphoribosylamine/glycine ligase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 421

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/417 (45%), Positives = 266/417 (63%), Gaps = 7/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL++GSGGREHALAWKI QSP +  L+  PGN G A   + VA+D+ +   ++   + 
Sbjct: 1   MRVLIVGSGGREHALAWKIRQSPRVERLFIAPGNGGTALEGENVAVDVDDIPGLVKLART 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K +DLV+VGPELPLV G++DAL       FGP    A+LE SK+FAK   ++  +PTA Y
Sbjct: 61  KKVDLVIVGPELPLVLGLTDALEKENILCFGPGAYPAQLEGSKAFAKSLMSQAEVPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F D  +A +YVQ +  P+V+KADGL AGKGVVVA   ++A  A+D     + F +   
Sbjct: 121 RVFEDFNQAVKYVQGRDFPVVIKADGLAAGKGVVVADDFEQAREALDDMLVKQVFGKAGE 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE L G E SF ALCDG+  +   +++DHKRI + D GPNTGGMGA SPA  +   
Sbjct: 181 RVVIEEALSGEEASFLALCDGRNFLLLPSSQDHKRIGENDTGPNTGGMGAYSPAPVLPAA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
            Y      +I P ++ +++   PF+GVL+AGL+ +E GP ++EYNVRFGDPECQ ++MRL
Sbjct: 241 KYQETADLVIRPMLQHLEQTDQPFKGVLYAGLIFSEDGPRVLEYNVRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTT 353
           +SD+LE++ +CVHG      +  K E ++ VV++  GYP  Y  G  I+ I   +     
Sbjct: 301 DSDLLEVIMACVHGRAAERSLQIKDEASVCVVLSAGGYPARYTKGHEITGIEEAETDPLV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           ++FHAGTA  +  L  +GGRVL  TALG  + ++ E  Y  VE I ++  Y+R DIG
Sbjct: 361 RVFHAGTAYKDGRLVTSGGRVLGVTALGTDLGDAIERCYRAVEKISFEGMYYRRDIG 417


>gi|293413441|ref|ZP_06656101.1| phosphoribosylamine-glycine ligase [Escherichia coli B354]
 gi|291468036|gb|EFF10535.1| phosphoribosylamine-glycine ligase [Escherichia coli B354]
          Length = 433

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 305 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 364

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 365 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERE 431


>gi|167631118|ref|YP_001681617.1| phosphoribosylamine--glycine ligase [Heliobacterium modesticaldum
           Ice1]
 gi|167593858|gb|ABZ85606.1| phosphoribosylamine--glycine ligase [Heliobacterium modesticaldum
           Ice1]
          Length = 439

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/429 (45%), Positives = 269/429 (62%), Gaps = 13/429 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           ++VL++G GGREHAL WK+ QSP ++E++  PGN GIA+ A CV I   + + I+ F  E
Sbjct: 9   LKVLVVGGGGREHALVWKLKQSPRVAEVYCAPGNAGIARIAHCVDIKADDVTGILTFAWE 68

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL VVGPE PL  GI D  N     +FGP+++AA++E SK+FAK    KY IPTA Y
Sbjct: 69  KRIDLTVVGPEAPLSAGIVDVFNDHEMPIFGPTKKAAEIEGSKAFAKDLMRKYDIPTAAY 128

Query: 121 QHFSDPMKAKQYVQNKSM--------PIVVKADGLCAGKGVVVAATVDEATSAI-----D 167
             F++   A Q++   +         P VVKADGL AGKGV+VAA V EA  A+      
Sbjct: 129 GVFTEIEPAFQFIDKLAAARPVEAGCPCVVKADGLAAGKGVIVAADVAEAKEAVRSMLKG 188

Query: 168 RCFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACS 227
             F      V+IEE+LEG EVS  A  DG   +P  +A+DHKRI DGD GPNTGGMGA S
Sbjct: 189 NAFGDAGRRVVIEEFLEGEEVSILAFTDGDHVLPMVSAQDHKRIFDGDQGPNTGGMGAYS 248

Query: 228 PALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPE 287
           PA   ++ L   V + ++LPTI+ M+ E  P++GVL+AGLM+T QGP ++EYN RFGDPE
Sbjct: 249 PAPVYTEALAREVEKTVLLPTIQAMKAEGRPYRGVLYAGLMVTAQGPKVLEYNARFGDPE 308

Query: 288 CQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP 347
            Q ++MR+++D+++++ + +   L    I W ++  + VV+A  GYP +Y  G  IS + 
Sbjct: 309 TQPVLMRMQTDLVDVIEAILENRLEEQPIEWSSDATVCVVMAAGGYPGDYEKGKAISGLD 368

Query: 348 QNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRE 407
                 ++FHAGTA   + +   GGRVL+ TA G TI E+ +LAY  VE I +    +R 
Sbjct: 369 DALPGVEVFHAGTAAKEDQIVTAGGRVLAVTAKGPTIGEAIDLAYRQVERIHFDGLQFRR 428

Query: 408 DIGLQKKER 416
           DIG +  ER
Sbjct: 429 DIGRRALER 437


>gi|82778819|ref|YP_405168.1| phosphoribosylamine--glycine ligase [Shigella dysenteriae Sd197]
 gi|81242967|gb|ABB63677.1| phosphoribosylglycinamide synthetase [Shigella dysenteriae Sd197]
          Length = 429

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDKRTSLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKCAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|323132511|gb|ADX19941.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 433

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 280/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +   ++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPTLLSFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 305 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 364

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 365 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 424

Query: 411 LQKKER 416
            +  ER
Sbjct: 425 WRAIER 430


>gi|239906311|ref|YP_002953052.1| phosphoribosylamine--glycine ligase [Desulfovibrio magneticus RS-1]
 gi|239796177|dbj|BAH75166.1| phosphoribosylamine--glycine ligase [Desulfovibrio magneticus RS-1]
          Length = 428

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/428 (45%), Positives = 263/428 (61%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L++GSGGREHALA  + +SP +S + + PGN G A   + V +   +   I+   ++
Sbjct: 1   MRILVVGSGGREHALAHTLLKSPDVSAVIAAPGNGGTATCGENVPLSDTDVPGIVALAKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +DLVVVGPE PLV G+ DAL  A    FGP   AA+LE SK+FAK   T  G+PTA Y
Sbjct: 61  RGMDLVVVGPEAPLVAGLRDALETASVPCFGPDAYAAQLEGSKAFAKDVMTAAGVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
             F+D  KA+ Y Q+   P+VVKADGL AGKGV V     +A +AID     + F     
Sbjct: 121 ASFTDAAKARAYAQDLGRPVVVKADGLAAGKGVTVCTQTAQALAAIDEAMVDKAFGAAGG 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV++EE L G E SF A CDG+TA+P T  +DHK + DGD GPNTGGMGA  PA  +   
Sbjct: 181 TVVVEEMLVGEEASFLAFCDGETAVPMTACQDHKAVFDGDQGPNTGGMGAYCPAPVLPPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
            Y+ ++  +I P ++ M K  +PF G+L+AGLM+TE GP ++EYNVRFGDPECQ ++MRL
Sbjct: 241 RYAEMMDLVIHPILKEMAKRGHPFTGILYAGLMMTEAGPKVLEYNVRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI----PQNTG 351
            SD+  I+ +C  G L    + W  + AL VV+A  GYP  YP G  I+ I        G
Sbjct: 301 ASDLPAIMLACRAGKLSPELVRWSDKSALCVVMAAPGYPGSYPKGMAITGIEAAEAAGDG 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AGT +VN  +  +GGRVL  TALG  + +++  AY  VE + +   + R DIG 
Sbjct: 361 LVKVFQAGTKLVNGQVVTSGGRVLGVTALGDGLAQAKATAYRAVEKLHFDGAFCRRDIGD 420

Query: 412 QKKERNVK 419
           +  +R  K
Sbjct: 421 KGLKREGK 428


>gi|332751440|gb|EGJ81842.1| phosphoribosylamine--glycine ligase [Shigella flexneri 4343-70]
 gi|332998846|gb|EGK18441.1| phosphoribosylamine--glycine ligase [Shigella flexneri K-272]
 gi|332998973|gb|EGK18563.1| phosphoribosylamine--glycine ligase [Shigella flexneri K-218]
 gi|333010739|gb|EGK30167.1| phosphoribosylamine--glycine ligase [Shigella flexneri VA-6]
 gi|333014306|gb|EGK33660.1| phosphoribosylamine--glycine ligase [Shigella flexneri K-227]
          Length = 429

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 280/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALVYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDNGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L+VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLSVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|225850922|ref|YP_002731156.1| phosphoribosylamine--glycine ligase [Persephonella marina EX-H1]
 gi|225645317|gb|ACO03503.1| phosphoribosylamine--glycine ligase [Persephonella marina EX-H1]
          Length = 429

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/416 (46%), Positives = 272/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G+GGREHALAWKI QSPL+ EL+   GN GI Q A+ V I   +   ++ F +E
Sbjct: 1   MKVLVVGNGGREHALAWKIKQSPLVKELYCAKGNAGIWQIARKVDISPTDIKNLVKFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI DA   AG K+FG  + +A LE+SK FAK F  KYGIPTA Y
Sbjct: 61  EKIDLTVVGPEQPLSEGIVDAFEEAGLKIFGHRRSSAILEASKVFAKNFMKKYGIPTAFY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           + F +  +A ++V+    PIV+KADGL AGKGVV+A + +EA + I       F + +  
Sbjct: 121 ETFDNENEAVEFVKKMGTPIVIKADGLAAGKGVVIANSEEEAVNTIKDMFGGRFGEASKR 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IEE+L G E S+ A+  G   +P  T++DHKR+ D D GPNTGGMGA SPA  ++ E+
Sbjct: 181 IVIEEFLTGEEASYIAMVKGDKLVPMATSQDHKRVFDNDKGPNTGGMGAYSPAPLVTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              +++KI+ PT+ GMQ E     G L+AGLMI E+G  ++E+NVR GDPE Q +M RL+
Sbjct: 241 EKEILEKIMYPTLRGMQSEGRELCGFLYAGLMIGEKGINVLEFNVRMGDPETQPIMRRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI--PQNTGTTQ 354
           SD++E +   + G + +    W  +Y++ VV+A+ GYP +Y  G +I+ I   +      
Sbjct: 301 SDLVEHIMDILEGRIESVKPEWSEDYSIGVVMASAGYPGKYEKGKVITGIEDAEKDPDIV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT I + NL  +GGRVL+ TA GKT+TE++E  Y  VE I ++  ++R DIG
Sbjct: 361 VFHAGTDIKDGNLVTSGGRVLTVTATGKTLTEAKEKVYRAVEKIHFEGAHYRRDIG 416


>gi|311696119|gb|ADP98992.1| phosphoribosylamine-glycine ligase [marine bacterium HP15]
          Length = 428

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/425 (44%), Positives = 269/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSP    ++  PGN G A+    + V ID+ +   + +F 
Sbjct: 1   MNILVIGSGGREHALAWKAAQSPKADRVFVAPGNAGTARETGLENVDIDVMDLDGLANFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              H+ L +VGPE PLV GI D     G +VFGPS  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  ATNHVGLTIVGPEAPLVAGIVDKFEQRGLRVFGPSAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y +F+D  +A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 GYGNFTDVDEALAYVRQQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG+  +   T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGENVLAMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  ++ ++I PT+ GM  E +P++G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 ADVHQRIMDEVIYPTVRGMAAEGHPYKGFLYAGLMIDNSGTPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R++SD++E+ ++ + G L      W    ++ +V+A  GYP  Y  G  IS +P   T 
Sbjct: 301 LRMKSDLVELCDAAIDGKLDQCDSEWDDRASVGIVLAAGGYPGSYNKGDAISGLPDTETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL ATALG T+TE+++ AY +   I W   ++R+DI  
Sbjct: 361 GEKVFHAGTRLNGDQVVTNGGRVLCATALGNTVTEAQKRAYELASRIQWDGAFYRKDIAF 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|110644340|ref|YP_672070.1| phosphoribosylamine--glycine ligase [Escherichia coli 536]
 gi|191174304|ref|ZP_03035812.1| phosphoribosylamine--glycine ligase [Escherichia coli F11]
 gi|218692286|ref|YP_002400498.1| phosphoribosylamine--glycine ligase [Escherichia coli ED1a]
 gi|300985436|ref|ZP_07177439.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 200-1]
 gi|331660566|ref|ZP_08361499.1| phosphoribosylamine--glycine ligase [Escherichia coli TA206]
 gi|110345932|gb|ABG72169.1| phosphoribosylamine-glycine ligase [Escherichia coli 536]
 gi|190905436|gb|EDV65067.1| phosphoribosylamine--glycine ligase [Escherichia coli F11]
 gi|218429850|emb|CAR10676.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli ED1a]
 gi|300306528|gb|EFJ61048.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 200-1]
 gi|315300748|gb|EFU59973.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 16-3]
 gi|324015259|gb|EGB84478.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 60-1]
 gi|331052349|gb|EGI24387.1| phosphoribosylamine--glycine ligase [Escherichia coli TA206]
          Length = 429

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|188532336|ref|YP_001906133.1| Phosphoribosylamine-glycine ligase [Erwinia tasmaniensis Et1/99]
 gi|188027378|emb|CAO95225.1| Phosphoribosylamine-glycine ligase [Erwinia tasmaniensis Et1/99]
          Length = 426

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +   +++F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALQNVAIAPTDIQGLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + IDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LNEKIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T  EA  AI+       F   
Sbjct: 121 EYQNFTEVEPALAYVREKGAPIVIKADGLAAGKGVIVAMTQQEAEDAIEDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI ++G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVRGMADEGNVYTGFLYAGLMIDKRGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V G L      W    AL VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAAVDGKLDQKDSVWDPRPALGVVLAAGGYPGDYVNGEQIHGLPVEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+  + +  NGGRVL  TALG+ +  +++ AY + + I W   + R DIG 
Sbjct: 361 DGKVFHAGTALEGDRVVTNGGRVLCVTALGENVAAAQQRAYQLTKPISWNGSFCRSDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|237727858|ref|ZP_04558339.1| phosphoribosylglycineamide synthetase [Citrobacter sp. 30_2]
 gi|226910415|gb|EEH96333.1| phosphoribosylglycineamide synthetase [Citrobacter sp. 30_2]
          Length = 429

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/429 (45%), Positives = 282/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYIGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVELCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|323963776|gb|EGB59275.1| phosphoribosylamine-glycine ligase [Escherichia coli M863]
 gi|327250478|gb|EGE62188.1| phosphoribosylamine--glycine ligase [Escherichia coli STEC_7v]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHLRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|219871532|ref|YP_002475907.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis SH0165]
 gi|219691736|gb|ACL32959.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis SH0165]
          Length = 431

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/425 (45%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+ QSPL  +++  PGN G A  A  + VAI   + +A+++F 
Sbjct: 1   MNILIIGNGGREHALAWKVRQSPLAEKVFVAPGNAGTALEAGIENVAISATDLTALVNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  + L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  KENEVGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFAKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ F++   A  Y+  ++ PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQTFTEIEPALAYLYQRNAPIVIKADGLAAGKGVIVAMTLAEAEEAVKDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLAGEEASFIVMIDGKNVEPMATSQDHKRVGEGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+Q+II PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PDVHQRVMQEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MRLESD++E+      G L+     W  + AL +V+A +GYP +Y     I+ +P +   
Sbjct: 301 MRLESDLVELCLKACDGKLNEIQSKWCEQAALGIVLAAEGYPADYRQNDEITGVPTDYCA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG +  N  L   GGRVL ATALG T++++++ A  + E I W+  ++R DIG 
Sbjct: 361 DEKVFLAGVSQQNGKLVTKGGRVLCATALGSTVSDAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIQR 425


>gi|193067795|ref|ZP_03048761.1| phosphoribosylamine--glycine ligase [Escherichia coli E110019]
 gi|192958770|gb|EDV89207.1| phosphoribosylamine--glycine ligase [Escherichia coli E110019]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGLTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|157156020|ref|YP_001465501.1| phosphoribosylamine--glycine ligase [Escherichia coli E24377A]
 gi|170021992|ref|YP_001726946.1| phosphoribosylamine--glycine ligase [Escherichia coli ATCC 8739]
 gi|191168670|ref|ZP_03030451.1| phosphoribosylamine--glycine ligase [Escherichia coli B7A]
 gi|300824614|ref|ZP_07104722.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 119-7]
 gi|300907559|ref|ZP_07125197.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 84-1]
 gi|300925875|ref|ZP_07141718.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 182-1]
 gi|301302182|ref|ZP_07208314.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 124-1]
 gi|307315021|ref|ZP_07594607.1| phosphoribosylamine/glycine ligase [Escherichia coli W]
 gi|309797710|ref|ZP_07692096.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 145-7]
 gi|331680129|ref|ZP_08380790.1| phosphoribosylamine--glycine ligase [Escherichia coli H591]
 gi|157078050|gb|ABV17758.1| phosphoribosylamine--glycine ligase [Escherichia coli E24377A]
 gi|169756920|gb|ACA79619.1| phosphoribosylamine--glycine ligase [Escherichia coli ATCC 8739]
 gi|190901310|gb|EDV61078.1| phosphoribosylamine--glycine ligase [Escherichia coli B7A]
 gi|300400726|gb|EFJ84264.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 84-1]
 gi|300418065|gb|EFK01376.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 182-1]
 gi|300522863|gb|EFK43932.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 119-7]
 gi|300842345|gb|EFK70105.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 124-1]
 gi|306905526|gb|EFN36059.1| phosphoribosylamine/glycine ligase [Escherichia coli W]
 gi|308118722|gb|EFO55984.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 145-7]
 gi|309704421|emb|CBJ03770.1| phosphoribosylglycineamide synthetase [Escherichia coli ETEC
           H10407]
 gi|315063331|gb|ADT77658.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli W]
 gi|315252726|gb|EFU32694.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 85-1]
 gi|323380605|gb|ADX52873.1| phosphoribosylamine/glycine ligase [Escherichia coli KO11]
 gi|331072284|gb|EGI43618.1| phosphoribosylamine--glycine ligase [Escherichia coli H591]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|332345996|gb|AEE59330.1| phosphoribosylamine--glycine ligase PurD [Escherichia coli UMNK88]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|332083897|gb|EGI89110.1| phosphoribosylamine--glycine ligase [Shigella boydii 5216-82]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 278/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHK + D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKHVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|300938767|ref|ZP_07153481.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 21-1]
 gi|300456301|gb|EFK19794.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 21-1]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLAGNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|307129004|ref|YP_003881020.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Dickeya dadantii 3937]
 gi|306526533|gb|ADM96463.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Dickeya dadantii 3937]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/431 (45%), Positives = 278/431 (64%), Gaps = 15/431 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA-----QHAQCVAIDIQNHSAII 55
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     ++    A DI    A++
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENVNIAATDI---PALL 57

Query: 56  HFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGI 115
            F ++  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  I
Sbjct: 58  DFARQNTIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQHI 117

Query: 116 PTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCF 170
           PTA YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A         F
Sbjct: 118 PTAEYQNFTEIEPALAYIRRKGAPIVIKADGLAAGKGVIVAMTLEEAENAATDMLAGNAF 177

Query: 171 QQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPAL 230
                 +++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA 
Sbjct: 178 GDAGHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAP 237

Query: 231 GMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQ 289
            ++ E++  V+ +II PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q
Sbjct: 238 VVTDEVHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQ 297

Query: 290 AMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-Q 348
            +M+RL+SD++E+  +   G L     +W A  +L VV+A  GYP +Y +G +IS +P Q
Sbjct: 298 PIMLRLKSDLVELCLAACDGKLDEKTSDWDARPSLGVVLAAGGYPADYRNGDVISGLPTQ 357

Query: 349 NTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
           +    ++FHAGT +  +++  NGGRVL  TALG ++ E+++ AY + + I W+  + R D
Sbjct: 358 DATDGKVFHAGTRLNGDDVVTNGGRVLCVTALGHSVAEAQQRAYELAKPISWEGSFCRSD 417

Query: 409 IGLQKKERNVK 419
           IG +   R  K
Sbjct: 418 IGYRAIAREQK 428


>gi|238899074|ref|YP_002924756.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466834|gb|ACQ68608.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 431

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 283/426 (66%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG--IAQHAQCVAIDIQNHSAIIHFC 58
           + VL++G+GGREHAL+WK AQSPL+++++  PGN G  +    + V ID  + S +++F 
Sbjct: 4   INVLIVGNGGREHALSWKAAQSPLVNKVYVAPGNAGTFLEPMLENVLIDTCDISELLNFA 63

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q +HI L +VGPE PLV GI DA  +AG  +FGP+Q AA+LE SK F K F  ++ IPTA
Sbjct: 64  QTQHIGLTIVGPEAPLVIGIVDAFRSAGQVIFGPTQAAAQLEGSKIFTKNFLNRHNIPTA 123

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            +Q F+D   A  YVQ K  PIV+KADGL AGKGVVVA +  EA S I        F   
Sbjct: 124 EHQAFTDQEAALHYVQAKGTPIVIKADGLAAGKGVVVAMSQKEAESTIKDMLSGHAFGDA 183

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+LEG E SF  + DG+  +P  T++DHK+ +DGD GPNTGGMGA SPA  ++
Sbjct: 184 GHRIVIEEFLEGEEASFIVMVDGENVLPMATSQDHKKAYDGDQGPNTGGMGAYSPAPVIT 243

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITE-QGPYLIEYNVRFGDPECQAMM 292
            E+Y  V+QKIILPT++GM  E + + G L+AGLM+ + + P +IE+N RFGDPE Q +M
Sbjct: 244 DEMYEKVMQKIILPTVKGMAAEGHEYTGFLYAGLMVCKNKEPKVIEFNCRFGDPETQPIM 303

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R+ SD++E+  +     L+  ++ W    AL VV+A++GYP EY  G +IS +P +   
Sbjct: 304 LRMRSDLVELCLAATKKQLNGKNVIWDERCALGVVLASQGYPGEYQQGHMISGLPYKERS 363

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FH+GT    N+++  +GGRVL  TALG  I+++RE AY + + + W+  ++R+DIG
Sbjct: 364 DEKIFHSGTRFNENHHIVTSGGRVLCLTALGNDISKARERAYQLTKKLQWEGCFFRKDIG 423

Query: 411 LQKKER 416
            +  ER
Sbjct: 424 YRAIER 429


>gi|124266531|ref|YP_001020535.1| phosphoribosylamine--glycine ligase [Methylibium petroleiphilum
           PM1]
 gi|124259306|gb|ABM94300.1| phosphoribosylamine--glycine ligase [Methylibium petroleiphilum
           PM1]
          Length = 430

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/430 (45%), Positives = 266/430 (61%), Gaps = 14/430 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A   +   + I    A+ +F Q 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPKVQMVYVAPGNGGTALDVRLKNVAITEVDALANFAQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D   A G +VFGP+Q AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  EKIGLTVVGPEAPLAAGVVDVFRARGLRVFGPTQAAAQLESSKAFSKDFMKRHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF---------- 170
           + FSD   A  YV     PIVVKADGL AGKGVVVAAT+DEA  A+D             
Sbjct: 121 ETFSDAAAAHAYVDRMGAPIVVKADGLAAGKGVVVAATLDEAHQAVDWMLAGHSGDNKLG 180

Query: 171 ---QQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACS 227
                  + V+IEE+L G E SF  L DG+  +P  T++DHKR+ DGD GPNTGGMGA S
Sbjct: 181 VTHNAGGARVVIEEFLAGEEASFIVLADGRHVLPLATSQDHKRLKDGDAGPNTGGMGAYS 240

Query: 228 PALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDP 286
           PA  ++  +++ V+ +II PT++GM ++  P+ G L+AGLMI  QG P  +E+N R GDP
Sbjct: 241 PAPVVTPNIHAKVMHEIIQPTLDGMARDGIPYTGFLYAGLMIDAQGNPKTLEFNCRMGDP 300

Query: 287 ECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI 346
           E Q +MMRL+SD+L++L     G L    + W   +AL VV+A  GYPE+     +I+ +
Sbjct: 301 ETQPIMMRLKSDLLDVLTHAADGTLDQVELQWDRRFALGVVMAAHGYPEQPRKADVITGL 360

Query: 347 PQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
           P  T    +FHAGT+    ++  +GGRVL  TALG +   ++  AY  +  I +    +R
Sbjct: 361 PPETADAVVFHAGTSKPGKDIVTSGGRVLCVTALGDSAKVAQARAYDALSGIAFDGMQFR 420

Query: 407 EDIGLQKKER 416
            DIG +  +R
Sbjct: 421 RDIGHRAIKR 430


>gi|110807855|ref|YP_691375.1| phosphoribosylamine--glycine ligase [Shigella flexneri 5 str. 8401]
 gi|110617403|gb|ABF06070.1| phosphoribosylamine--glycine ligase [Shigella flexneri 5 str. 8401]
          Length = 429

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 280/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALVYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVCDKDNGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L+VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLSVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|156935795|ref|YP_001439711.1| phosphoribosylamine--glycine ligase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156534049|gb|ABU78875.1| hypothetical protein ESA_03671 [Cronobacter sakazakii ATCC BAA-894]
          Length = 432

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/429 (45%), Positives = 277/429 (64%), Gaps = 12/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK  QSPL+  ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAVQSPLVETVFVAPGNAGTALEPALQNVAISPTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q ++IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QAENIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTKGAAQLEGSKAFTKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTETEPALAYIREKGAPIVIKADGLAAGKGVIVAMTLAEAETAVLDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+   P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVEPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT+ GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVFQRTMERIIWPTVRGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--- 349
           MRL+SD++E+  +   G L      W A  AL VV+A  GYP +Y  G +I  +P     
Sbjct: 301 MRLQSDLVELCLAACEGKLDTVKSQWDARPALGVVMAAGGYPGDYRTGDVIHGLPIEEIA 360

Query: 350 TGTTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
            G  ++FHAGT + +++ +  +GGRVL  TALG ++ +++  AY + E+I W   + R+D
Sbjct: 361 NGDGKVFHAGTTLRDDDRVVTSGGRVLCVTALGDSVAQAQARAYRLAEDIHWDDCFCRKD 420

Query: 409 IGLQKKERN 417
           IG +   R 
Sbjct: 421 IGYRAIARE 429


>gi|303231535|ref|ZP_07318264.1| phosphoribosylamine--glycine ligase [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302513781|gb|EFL55794.1| phosphoribosylamine--glycine ligase [Veillonella atypica
           ACS-049-V-Sch6]
          Length = 420

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/417 (45%), Positives = 270/417 (64%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IG+GGREHA+AW+++ SP + +++++PG+  +   A+ V ID  +   +I F ++
Sbjct: 1   MKVCVIGNGGREHAIAWRLSISPSVEKVYAVPGSAAMKNCAELVGIDWSHTDHLIRFLKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G++DAL+ AG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLVAGLADALHEAGIPVFGPSKAAAQLEGSKVFAKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             FS+  +AKQ++     PIVVKADGL AGKGVVVA TV+EA +A+D       F +  S
Sbjct: 121 GVFSNADEAKQFIAKTGAPIVVKADGLAAGKGVVVAMTVEEANAAVDDMLSGNRFGEAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++EG E S  A  DGKT +P   ++DHKRI DGD GPNTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMEGEEASLLAFVDGKTVVPMIASQDHKRIFDGDKGPNTGGMGTYAPAPVLTDV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M KE  P+ G L+AGLMIT +GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDEAMKTILEPMVAAMAKEGMPYVGCLYAGLMITNEGPKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E D+ +I+ +C  G L    + WK   A  V++A+KGYPE    G +I        T+ +
Sbjct: 301 EGDLGQIMMACATGTLQPNMVKWKDSSAACVILASKGYPETSSKGDVILGELVQYDTSII 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +  ++   NGGRVL    LGK +  + + AY  V++I +K   +R+DIG +
Sbjct: 361 FHSGTKLEGDHYVTNGGRVLGVVGLGKDLRTALDRAYERVDHITFKGMQYRKDIGAK 417


>gi|168245131|ref|ZP_02670063.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194450383|ref|YP_002048160.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194408687|gb|ACF68906.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205336121|gb|EDZ22885.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
          Length = 429

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/429 (45%), Positives = 281/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDEFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACEGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|300312852|ref|YP_003776944.1| phosphoribosylamine-glycine ligase [Herbaspirillum seropedicae
           SmR1]
 gi|300075637|gb|ADJ65036.1| phosphoribosylamine-glycine ligase protein [Herbaspirillum
           seropedicae SmR1]
          Length = 422

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/422 (45%), Positives = 266/422 (63%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAW IA+SP +  ++  PGN G A   +   I I + +A+  F ++
Sbjct: 1   MKILVVGSGGREHALAWAIAKSPRIQTVYVAPGNGGTALDERLQNIAITDPAALADFVEQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +H+ L VVGPE PL  GI +   A G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EHVALTVVGPEGPLAAGIVNVFRARGLKIFGPTKEAAQLESSKDFAKAFMQRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ-----QINS 175
           Q FSD   A  Y+ +K  PIV+KADGL AGKGVVVA T++EA SA+D            +
Sbjct: 121 QTFSDVAAAHDYIASKGAPIVIKADGLAAGKGVVVAMTLEEAHSAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKNILPLATSQDHKRLQDNDQGPNTGGMGAYSPAPIVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           L++ V+++II+PT++GM K+  PF G L+AGLMI  +G P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIIIPTVQGMAKDGIPFSGFLYAGLMIDAEGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L++D+L +    V G L    + W    AL VV+A  GYPEE   G +I+ IP  T    
Sbjct: 301 LKTDLLTVFEHAVTGTLDKIELEWDRRTALGVVMAAHGYPEEPRKGDLITDIPAETADCV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT +    LT +GGRVL    LG ++  +++ AY   + I +     R DIG +  
Sbjct: 361 TFHAGTTLNGEKLTTSGGRVLCVVGLGDSVKVAQKHAYDAADLIHFAGSQMRRDIGWRAL 420

Query: 415 ER 416
           +R
Sbjct: 421 KR 422


>gi|32033890|ref|ZP_00134161.1| COG0151: Phosphoribosylamine-glycine ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208640|ref|YP_001053865.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae L20]
 gi|165976600|ref|YP_001652193.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|307250428|ref|ZP_07532375.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|126097432|gb|ABN74260.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876701|gb|ABY69749.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|306857557|gb|EFM89666.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 428

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/425 (46%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEDIKNVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|9931344|gb|AAG02154.1|AF212041_10 phosphoribosylamine-glycine liase [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 416

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/418 (46%), Positives = 267/418 (63%), Gaps = 9/418 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIG+GGREHALAWKIAQSP L   ++  GNPGIA+ A+   I + +H+A++ FCQ+
Sbjct: 1   MNVLLIGTGGREHALAWKIAQSPSLDTFYATTGNPGIAKLAKPADITVTDHAAVVRFCQD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPS-QRAAKLESSKSFAKKFCTKYGIPTAT 119
             IDLVV+GPE PLV+G+ ++L AA  +  GP+ QR ++    K F K+           
Sbjct: 61  NAIDLVVIGPEAPLVDGLGNSLRAALLRFLGPTKQRPSR--RLKRFHKRSLRPLQYSDCP 118

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINS 175
                   +AK  + N S P+V+KADGL  GKGV++A +  EA  AI       F +   
Sbjct: 119 LSTCRSAEEAKAALDNFSTPVVIKADGLAGGKGVIIAESRLEAEQAIQDMTAGAFGKAGL 178

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE+++G E SFFA+ DG+T  PF TARDHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 179 EIVVEEFMQGEEASFFAISDGETVRPFGTARDHKRVGDGDTGPNTGGMGAYSPATSLTAD 238

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   V+Q+I+ PT++ M+++  PF G+L+AGLM+T +GP LIEYN R GDPECQ +MMRL
Sbjct: 239 LEKRVMQEIVTPTVQAMKEQGMPFVGILYAGLMLTSEGPKLIEYNARLGDPECQVLMMRL 298

Query: 296 ESDILEILNSCVHGNLH-NTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-T 353
           ESDIL +L +   G L       +  +YA+TVV+A +GYP     G II+++ +      
Sbjct: 299 ESDILPLLYAAATGKLQAQPEPTFSKDYAVTVVIAAQGYPASPKKGGIITRLNEAEANGA 358

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            +F AGT + N  L ANGGRVL+ TA       +R LAY  V  I +  G+WREDIGL
Sbjct: 359 VVFQAGTTLDNQTLKANGGRVLNVTAKAADFNAARYLAYQAVNVIVYPDGFWREDIGL 416


>gi|294627262|ref|ZP_06705849.1| phosphoribosylamine--glycine ligase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665535|ref|ZP_06730817.1| phosphoribosylamine--glycine ligase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598501|gb|EFF42651.1| phosphoribosylamine--glycine ligase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292604685|gb|EFF48054.1| phosphoribosylamine--glycine ligase [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 431

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/426 (44%), Positives = 277/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWKIAQS  +SE+   PGN G A  A C  VAI + +   ++   
Sbjct: 1   MKILVIGSGGREHALAWKIAQSAHVSEVLVAPGNAGTATEANCRNVAIKVDDLDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L VVGPE+PLV G+ D  +AAG ++FGP+ +AA+LE SK+FAK F  ++GIPTA
Sbjct: 61  QREAVALTVVGPEVPLVLGVVDRFHAAGLRIFGPTAKAAQLEGSKAFAKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y   ++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 YYAVHTEVDAALAYVREKGAPIVVKADGLAAGKGVIVAMTLAEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF ++ DG  A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFISMVDGTHALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            ++++ V+++++ PT++GM  +  PF G L+AGLMI   G P +IE+NVRFGDPE Q +M
Sbjct: 241 PDVHARVMREVVEPTVQGMIADGVPFTGFLYAGLMIDAHGAPKVIEFNVRFGDPETQPVM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++++L + + G L   H  W    +L VV+A + YP+    G +I+ +     +
Sbjct: 301 LRLQSDLVDLLEAAIDGRLDGAHAQWDPRPSLGVVIAARPYPDTPVTGEVITGLDAVPAS 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGTA+     + + GGRVL   ALG ++ +++  AY  ++ I W   + R DIG 
Sbjct: 361 AKVFHAGTALNAAGEVVSAGGRVLCVAALGDSVQDAQRTAYAGLKPIHWASAFQRSDIGW 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|219667533|ref|YP_002457968.1| phosphoribosylamine/glycine ligase [Desulfitobacterium hafniense
           DCB-2]
 gi|219537793|gb|ACL19532.1| phosphoribosylamine/glycine ligase [Desulfitobacterium hafniense
           DCB-2]
          Length = 419

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 271/416 (65%), Gaps = 7/416 (1%)

Query: 2   RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEK 61
           +VL++G+GGREHALAWKIAQSP + +L+  PGN G  +    VAI   +   ++ F Q++
Sbjct: 4   KVLIVGNGGREHALAWKIAQSPEVGKLYVAPGNAGTQEW--NVAIAATDIPGLLEFAQKE 61

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            IDL +VGPE PL  GI DA    G ++FGP+Q AA+LE SKSFAK+     G+PTA  +
Sbjct: 62  GIDLTIVGPEAPLTLGIVDAFQKEGLRIFGPTQEAARLEGSKSFAKEIMEAAGVPTAQSR 121

Query: 122 HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINSTV 177
            FS+P +AK+Y++    PIV+KADGL AGKGV+VA  +D A +A+D        +    +
Sbjct: 122 VFSEPEQAKEYIKQMGAPIVLKADGLAAGKGVIVAMDLDTALTAVDELMDGSLGESGKLL 181

Query: 178 IIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELY 237
           ++EEYLEG EVS   LCDG+ A+     +DHKR  DGD+G NTGGMG  SP    + EL 
Sbjct: 182 LVEEYLEGQEVSLLCLCDGEHAVALVPVQDHKRALDGDLGLNTGGMGTYSPPPFWNPELE 241

Query: 238 STVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLES 297
              ++ I+ PT++ M+ +  PFQGVLFAGLM+T+ GP  +E+NVRFGDPE Q +M R+ES
Sbjct: 242 EEALRTIVQPTLQVMKDKGMPFQGVLFAGLMLTKDGPKTLEFNVRFGDPETQVVMARMES 301

Query: 298 DILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFH 357
           D+ ++L +C  G + N  + WK E AL +V+A  GYP  Y  G  I+        + +FH
Sbjct: 302 DLFKVLWACTEGQIENLKLAWKKETALCIVMAAPGYPLAYAKGIPITLPEVPAQESVIFH 361

Query: 358 AGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           AGTA+     L ++GGRVL  TA G  + ++R+L Y +VE I++   ++R+DIG++
Sbjct: 362 AGTALSQGGELQSSGGRVLGVTAWGDDLNQARQLGYALVEKINFPGAHYRKDIGVK 417


>gi|307257228|ref|ZP_07538999.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306864270|gb|EFM96182.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 428

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP++Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPDDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++    + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQVLKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|312965341|ref|ZP_07779574.1| phosphoribosylamine--glycine ligase [Escherichia coli 2362-75]
 gi|312290015|gb|EFR17902.1| phosphoribosylamine--glycine ligase [Escherichia coli 2362-75]
          Length = 429

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+++A +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEKAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|284924097|emb|CBG37196.1| phosphoribosylglycineamide synthetase [Escherichia coli 042]
          Length = 429

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|310766095|gb|ADP11045.1| Phosphoribosylamine-glycine ligase [Erwinia sp. Ejp617]
          Length = 426

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +   +++F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALQNVAISPTDIQGLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + IDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LNEKIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRKKGAPIVIKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVRGMAAEGNVYTGFLYAGLMINKSGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V+GNL      W    +L VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAAVNGNLDQKDSVWDPRPSLGVVLAAGGYPGDYVNGQQIHGLPVEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL  TALG+ +  +++ AY + + I W   + R DIG 
Sbjct: 361 DGKVFHAGTTLQDDRVVTSGGRVLCVTALGEDVAAAQQRAYQLAKPISWHGSFCRTDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIDR 425


>gi|194439792|ref|ZP_03071859.1| phosphoribosylamine--glycine ligase [Escherichia coli 101-1]
 gi|253775365|ref|YP_003038196.1| phosphoribosylamine--glycine ligase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163947|ref|YP_003047055.1| phosphoribosylamine--glycine ligase [Escherichia coli B str.
           REL606]
 gi|297520394|ref|ZP_06938780.1| phosphoribosylamine--glycine ligase [Escherichia coli OP50]
 gi|300928825|ref|ZP_07144333.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 187-1]
 gi|194421289|gb|EDX37309.1| phosphoribosylamine--glycine ligase [Escherichia coli 101-1]
 gi|242379536|emb|CAQ34352.1| phosphoribosylamine-glycine ligase [Escherichia coli BL21(DE3)]
 gi|253326409|gb|ACT31011.1| phosphoribosylamine/glycine ligase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975848|gb|ACT41519.1| phosphoribosylamine-glycine ligase [Escherichia coli B str. REL606]
 gi|253980004|gb|ACT45674.1| phosphoribosylamine-glycine ligase [Escherichia coli BL21(DE3)]
 gi|300463206|gb|EFK26699.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 187-1]
 gi|323958932|gb|EGB54607.1| phosphoribosylamine-glycine ligase [Escherichia coli H489]
 gi|323969079|gb|EGB64387.1| phosphoribosylamine-glycine ligase [Escherichia coli TA007]
          Length = 429

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDIFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|198241778|ref|YP_002218091.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197936294|gb|ACH73627.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|326625884|gb|EGE32229.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 429

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 281/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ +A  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVNAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|218707624|ref|YP_002415143.1| phosphoribosylamine--glycine ligase [Escherichia coli UMN026]
 gi|293407622|ref|ZP_06651540.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1412]
 gi|298383370|ref|ZP_06992962.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1302]
 gi|300897580|ref|ZP_07115989.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 198-1]
 gi|331665662|ref|ZP_08366558.1| phosphoribosylamine--glycine ligase [Escherichia coli TA143]
 gi|218434721|emb|CAR15653.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli UMN026]
 gi|291425390|gb|EFE98430.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1412]
 gi|298276249|gb|EFI17770.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1302]
 gi|300358656|gb|EFJ74526.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 198-1]
 gi|331057180|gb|EGI29172.1| phosphoribosylamine--glycine ligase [Escherichia coli TA143]
          Length = 429

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLTDDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|170770126|ref|ZP_02904579.1| phosphoribosylamine--glycine ligase [Escherichia albertii TW07627]
 gi|170121008|gb|EDS89939.1| phosphoribosylamine--glycine ligase [Escherichia albertii TW07627]
          Length = 429

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/427 (44%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDDRASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|157147201|ref|YP_001454520.1| phosphoribosylamine--glycine ligase [Citrobacter koseri ATCC
           BAA-895]
 gi|157084406|gb|ABV14084.1| hypothetical protein CKO_02984 [Citrobacter koseri ATCC BAA-895]
          Length = 429

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 280/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPQVETVYVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLIEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACDGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W + + R+DIG
Sbjct: 361 DGKVFHAGTKLAEDDRVVTSGGRVLCATALGHTVAEAQQRAYALMADIRWDNCFSRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|323974205|gb|EGB69337.1| phosphoribosylamine-glycine ligase [Escherichia coli TW10509]
          Length = 429

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHLRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCITALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|51594654|ref|YP_068845.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           32953]
 gi|170022614|ref|YP_001719119.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           YPIII]
 gi|186893656|ref|YP_001870768.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           PB1/+]
 gi|51587936|emb|CAH19539.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           32953]
 gi|169749148|gb|ACA66666.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           YPIII]
 gi|186696682|gb|ACC87311.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           PB1/+]
          Length = 428

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/426 (44%), Positives = 275/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T++EA +A++       F   
Sbjct: 121 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTLEEAETAVNDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N+ +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|329117983|ref|ZP_08246696.1| phosphoribosylamine-glycine ligase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465871|gb|EGF12143.1| phosphoribosylamine-glycine ligase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 456

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/415 (45%), Positives = 267/415 (64%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK+AQSP +  ++  PGN G A   +   + +  H+ +I FC+ 
Sbjct: 35  MKLLVIGGGGREHALAWKLAQSPDVETVFVAPGNAGTAVEPKLRNVPLLPHAGLIAFCRA 94

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI D   AAG  VFGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 95  EKIAFTLVGPEAPLAAGIVDDFRAAGLPVFGPTRAAAQLESSKDFAKAFMQRHGIPTAAY 154

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F +  +A  YV+ K  PIV+KADGL AGKGV+VA   DEA +AID         +  +
Sbjct: 155 RTFENAGEAHAYVKEKGAPIVIKADGLAAGKGVIVAMNEDEAHAAIDDMLLANKMGEAGA 214

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  +CDG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++ E
Sbjct: 215 RVVIEDFLQGEEASFIVMCDGENVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTDE 274

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           +Y  V+ +I+LP + GM+ +  PF G L+AGLMI   G P +IE+N RFGDPE Q +M R
Sbjct: 275 VYRRVMDEIVLPAVRGMKADGIPFTGFLYAGLMIDASGAPSVIEFNCRFGDPETQPVMSR 334

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD   ++ + + G L+     WK + A+ VV+A  GYP+      II  I     T +
Sbjct: 335 LDSDFAALVQAGIEGRLNEATAQWKPQTAVGVVLAAAGYPDSPRKRDIIEGIDAANETGK 394

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
           +FHAGTA+ + +  +NGGRVL    LG T+ ++++ AY  V+ I +    +R+DI
Sbjct: 395 VFHAGTALSDGHTVSNGGRVLCVVGLGDTVEQAQQTAYQAVQKIRFDGMQYRKDI 449


>gi|123440691|ref|YP_001004683.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087652|emb|CAL10434.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 431

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 273/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYSGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAEKIQWEGAFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAITR 426


>gi|238760271|ref|ZP_04621415.1| Phosphoribosylamine--glycine ligase [Yersinia aldovae ATCC 35236]
 gi|238701535|gb|EEP94108.1| Phosphoribosylamine--glycine ligase [Yersinia aldovae ATCC 35236]
          Length = 428

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 273/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMSQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L     +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLDEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + ENI W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAENIQWEGVFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|295095111|emb|CBK84201.1| phosphoribosylamine--glycine ligase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 430

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 280/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPQVETVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q ++IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNENIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ + D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   + +II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACEGKLDEKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLEEID 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +++ +  NGGRVL ATALG+T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GAKVFHAGTKLSDDDRVLTNGGRVLCATALGQTVAEAQKRAYALMADIHWNGSFSRQDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|170683731|ref|YP_001746390.1| phosphoribosylamine--glycine ligase [Escherichia coli SMS-3-5]
 gi|218702640|ref|YP_002410269.1| phosphoribosylamine--glycine ligase [Escherichia coli IAI39]
 gi|170521449|gb|ACB19627.1| phosphoribosylamine--glycine ligase [Escherichia coli SMS-3-5]
 gi|218372626|emb|CAR20501.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli IAI39]
          Length = 429

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|16131835|ref|NP_418433.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. MG1655]
 gi|89110033|ref|AP_003813.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. W3110]
 gi|170083466|ref|YP_001732786.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. DH10B]
 gi|187730149|ref|YP_001882691.1| phosphoribosylamine--glycine ligase [Shigella boydii CDC 3083-94]
 gi|188495477|ref|ZP_03002747.1| phosphoribosylamine--glycine ligase [Escherichia coli 53638]
 gi|238903062|ref|YP_002928858.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli BW2952]
 gi|254039262|ref|ZP_04873311.1| phosphoribosylglycineamide synthetase [Escherichia sp. 1_1_43]
 gi|300947387|ref|ZP_07161580.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 116-1]
 gi|300954763|ref|ZP_07167193.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 175-1]
 gi|301023376|ref|ZP_07187166.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 196-1]
 gi|301645738|ref|ZP_07245659.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 146-1]
 gi|307140697|ref|ZP_07500053.1| phosphoribosylamine--glycine ligase [Escherichia coli H736]
 gi|312974208|ref|ZP_07788378.1| phosphoribosylamine--glycine ligase [Escherichia coli 1827-70]
 gi|331644742|ref|ZP_08345860.1| phosphoribosylamine--glycine ligase [Escherichia coli H736]
 gi|417557|sp|P15640|PUR2_ECOLI RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|42596|emb|CAA36213.1| purD gene product [Escherichia coli K-12]
 gi|396344|gb|AAC43103.1| phosphoribosylglycineamide synthetase [Escherichia coli str. K-12
           substr. MG1655]
 gi|1790438|gb|AAC76979.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. MG1655]
 gi|85676064|dbj|BAE77314.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K12 substr. W3110]
 gi|169891301|gb|ACB05008.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. DH10B]
 gi|187427141|gb|ACD06415.1| phosphoribosylamine--glycine ligase [Shigella boydii CDC 3083-94]
 gi|188490676|gb|EDU65779.1| phosphoribosylamine--glycine ligase [Escherichia coli 53638]
 gi|226838497|gb|EEH70527.1| phosphoribosylglycineamide synthetase [Escherichia sp. 1_1_43]
 gi|238862063|gb|ACR64061.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli BW2952]
 gi|260451166|gb|ACX41588.1| phosphoribosylamine/glycine ligase [Escherichia coli DH1]
 gi|299880896|gb|EFI89107.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 196-1]
 gi|300318262|gb|EFJ68046.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 175-1]
 gi|300452991|gb|EFK16611.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 116-1]
 gi|301075987|gb|EFK90793.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 146-1]
 gi|310331375|gb|EFP98640.1| phosphoribosylamine--glycine ligase [Escherichia coli 1827-70]
 gi|315138562|dbj|BAJ45721.1| phosphoribosylamine--glycine ligase [Escherichia coli DH1]
 gi|315617370|gb|EFU97976.1| phosphoribosylamine--glycine ligase [Escherichia coli 3431]
 gi|320172733|gb|EFW47967.1| Phosphoribosylamine--glycine ligase [Shigella dysenteriae CDC
           74-1112]
 gi|323174482|gb|EFZ60107.1| phosphoribosylamine--glycine ligase [Escherichia coli LT-68]
 gi|323933953|gb|EGB30427.1| phosphoribosylamine-glycine ligase [Escherichia coli E1520]
 gi|323938878|gb|EGB35098.1| phosphoribosylamine-glycine ligase [Escherichia coli E482]
 gi|331036042|gb|EGI08279.1| phosphoribosylamine--glycine ligase [Escherichia coli H736]
          Length = 429

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/426 (45%), Positives = 278/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|89896671|ref|YP_520158.1| hypothetical protein DSY3925 [Desulfitobacterium hafniense Y51]
 gi|89336119|dbj|BAE85714.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 419

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/416 (46%), Positives = 271/416 (65%), Gaps = 7/416 (1%)

Query: 2   RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEK 61
           +VL++G+GGREHALAWKIAQSP + +L+  PGN G  +    VAI   +   ++ F Q++
Sbjct: 4   KVLIVGNGGREHALAWKIAQSPEVGKLYVAPGNAGTQEW--NVAIAATDIPRLLEFAQKE 61

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            IDL +VGPE PL  GI DA    G ++FGP+Q AA+LE SKSFAK+     G+PTA  +
Sbjct: 62  GIDLTIVGPEAPLTLGIVDAFQKEGLRIFGPTQEAARLEGSKSFAKEIMEAAGVPTAQSR 121

Query: 122 HFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ----QINSTV 177
            FS+P +AK+Y++    PIV+KADGL AGKGV+VA  +D A +A+D        +    +
Sbjct: 122 VFSEPEQAKEYIKQLGAPIVLKADGLAAGKGVIVAMDLDTALTAVDELMDGSLGESGKLL 181

Query: 178 IIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELY 237
           ++EEYLEG EVS   LCDG+ A+     +DHKR  DGD+G NTGGMG  SP    + EL 
Sbjct: 182 LVEEYLEGQEVSLLCLCDGEHAVALVPVQDHKRALDGDLGLNTGGMGTYSPPPFWNPELE 241

Query: 238 STVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLES 297
              ++ I+ PT++ M+ +  PFQGVLFAGLM+T+ GP  +E+NVRFGDPE Q +M R+ES
Sbjct: 242 EEALRTIVQPTLQVMKDKGMPFQGVLFAGLMLTKDGPKTLEFNVRFGDPETQVVMARMES 301

Query: 298 DILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFH 357
           D+ ++L +C  G + N  + WK E AL +V+A  GYP  Y  G  I+        + +FH
Sbjct: 302 DLFKVLWACTEGQIENLKLAWKKETALCIVMAAPGYPLAYAKGIPITLPEVPAQESVIFH 361

Query: 358 AGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           AGTA+     L ++GGRVL  TA G  + ++R+L Y +VE I++   ++R+DIG++
Sbjct: 362 AGTALSQGGELQSSGGRVLGVTAWGDDLNQARQLGYTLVEKINFPGAHYRKDIGVK 417


>gi|317046457|ref|YP_004114105.1| phosphoribosylamine/glycine ligase [Pantoea sp. At-9b]
 gi|316948074|gb|ADU67549.1| phosphoribosylamine/glycine ligase [Pantoea sp. At-9b]
          Length = 426

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 272/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNVAISATDVPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q++ IDL +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  IPTA
Sbjct: 61  QQEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGDNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM+ E N + G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQIIWPTVNGMKAEGNTYTGFLYAGLMIDKAGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++ +  +   G L      W    +L VV+A  GYP +Y  G  I  +P +   
Sbjct: 301 LRLQSDLVALCLAACDGKLDQQTSQWDPRPSLGVVLAAGGYPGDYNTGDQIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  NGGRVL  TALG+ +  +++ AY + ++I W+  + R DIG 
Sbjct: 361 DGKVFHAGTTLKDDLVVTNGGRVLCVTALGEDVAAAQQRAYELAKSISWEGSFCRHDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|170761174|ref|YP_001788197.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A3 str.
           Loch Maree]
 gi|169408163|gb|ACA56574.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A3 str.
           Loch Maree]
          Length = 413

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/415 (43%), Positives = 277/415 (66%), Gaps = 8/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHA+AWKI ++PL+ +++  PGN   A    C  I+I ++  ++ F  +
Sbjct: 1   MKILIVGSGGREHAIAWKIGKNPLVEKIFCAPGNGCTALEHNCENINISSNEELLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +DL +VGPE+PL+ GI D     G  +FGP ++AA LE SK+FAK F  KY I TA Y
Sbjct: 61  RDVDLTIVGPEVPLMEGIVDLFRDKGLNIFGPDKKAALLEGSKAFAKDFMKKYNIKTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F +  KA +Y++N   P+V+KADGL AGKGVV++ + +E+ S ++       F+    
Sbjct: 121 EVFEEEKKALEYLKNSEHPVVIKADGLAAGKGVVISNSFEESKSTLEEFMAKDKFKGAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S  ++ DG+T IPF ++RDHK+I+DG +GPNTGGMG  +P    ++E
Sbjct: 181 KVVIEEFLEGPEASILSITDGETIIPFISSRDHKQIYDGGLGPNTGGMGVIAPNPYCTKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V + I+ PT++G+QKE   F G++F G+MIT++GPYL+EYN+R GDPE +A++  +
Sbjct: 241 VLEGVNEDILKPTLKGLQKENLKFSGIIFFGIMITKKGPYLLEYNLRMGDPETEAVLPLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+L ++   ++  L NT+I WK  Y+  V+ A+KGYPE Y  G  I+ +    G   +
Sbjct: 301 DSDLLNLILMSINKELKNTNIKWKKAYSTCVIAASKGYPESYEKGFPINGVANLEG---I 357

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           F AG  + +N L  NGGRVL   A+G+T+ +S   AY  +E I+++  Y+R+DIG
Sbjct: 358 FGAGVKLKDNRLLTNGGRVLCTQAIGETLEQSINTAYEKMEKINFEGIYYRKDIG 412


>gi|320539745|ref|ZP_08039408.1| putative phosphoribosylglycinamide synthetase
           phosphoribosylamine-glycine ligase [Serratia symbiotica
           str. Tucson]
 gi|320030210|gb|EFW12226.1| putative phosphoribosylglycinamide synthetase
           phosphoribosylamine-glycine ligase [Serratia symbiotica
           str. Tucson]
          Length = 427

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 269/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A  A+   VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEAKLENVAISATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQHF++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA   +        F   
Sbjct: 121 EYQHFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLAEAEDTVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLAGEEASFIVMVDGEHVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   + ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRAMDQVIWPTVRGMAAEGNIYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +RL SD++E+  +   G L     +W    AL VV+AT GYP  Y  G +I  + Q    
Sbjct: 301 LRLRSDLVELCLAGAEGKLGEKTSDWDERPALGVVMATGGYPGNYHSGEVIQGLSQQEYA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  +GGRVL  TALG T+ ++++ AY +   I W   + R+DIG 
Sbjct: 361 DGKVFHAGTCMQGDEVVTSGGRVLCVTALGATVEQAQQRAYQLTAGIQWPGSFCRKDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARG 426


>gi|331685748|ref|ZP_08386330.1| phosphoribosylamine--glycine ligase [Escherichia coli H299]
 gi|331077058|gb|EGI48274.1| phosphoribosylamine--glycine ligase [Escherichia coli H299]
          Length = 429

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYHTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|85711857|ref|ZP_01042912.1| Phosphoribosylamine-glycine ligase [Idiomarina baltica OS145]
 gi|85694254|gb|EAQ32197.1| Phosphoribosylamine-glycine ligase [Idiomarina baltica OS145]
          Length = 426

 Score =  388 bits (997), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/417 (46%), Positives = 266/417 (63%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M++L++G GGREHALAWK AQS  ++E++  PGN G A  A    V+I  ++   +  F 
Sbjct: 1   MKILVVGGGGREHALAWKAAQSKQVTEVFVAPGNAGTADEANLKNVSISAEDIEGLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  +DL +VGPE PLV GI D   +    +FGPS  AA+LE SKSF+K F  ++ IPTA
Sbjct: 61  QKNAVDLTIVGPEAPLVKGIVDLFQSRKLAIFGPSAAAAQLEGSKSFSKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y  F+D   AK YV++  +PIV+KADGL AGKGV++A T+++A +AID       F + 
Sbjct: 121 AYDTFTDIAAAKSYVRDNQLPIVIKADGLAAGKGVIIAETLEQADAAIDDMLAGNKFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L G E SF  + DGKTA+ F +++DHK   DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLTGEEASFIVIADGKTAVAFASSQDHKARDDGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPY-LIEYNVRFGDPECQAMM 292
            E++  V+Q +I PTI+GM  E  P+ G L+AGLM+   G   ++EYN RFGDPE Q +M
Sbjct: 241 DEVHEWVMQHVIQPTIDGMAAEGTPYVGFLYAGLMVAPDGSAKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ SD++E+    + G L      +    A+ VV+A  GYPE Y  G  I  IP+ T +
Sbjct: 301 MRMRSDLVELCEKAITGQLAGASARFDERTAVGVVMAAGGYPESYHKGDEIKGIPEATES 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGT      L  NGGRVL   ALG  + +++  AY +V++I W + Y+R DI
Sbjct: 361 YKVFHAGTKYEQGRLLTNGGRVLCCVALGDDVQQAQLEAYQLVKHIHWDNVYYRNDI 417


>gi|148981206|ref|ZP_01816332.1| phosphoribosylamine--glycine ligase [Vibrionales bacterium SWAT-3]
 gi|145960962|gb|EDK26288.1| phosphoribosylamine--glycine ligase [Vibrionales bacterium SWAT-3]
          Length = 429

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 272/427 (63%), Gaps = 13/427 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFIAPGNAGTALEPKLENVNIGVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QEK I+L +VGPE PLV G+ DA    G  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QEKKIELTIVGPEAPLVIGVVDAFREVGLPIFGPTQVAAQLEGSKAFTKDFLARHDIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
           +Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 SYANFTEIEPAIAYVREQGAPIVVKADGLAAGKGVIVAMTIEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGSSVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS        
Sbjct: 301 MRMESDLVELCLMAIDEKLDQAESKWDPRASIGVVLAAGGYPADYAKGDVISLPTSEVEG 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGTA  NN   ++  NGGRVL ATALG T++E++E AY + + + W   + R DI
Sbjct: 361 QKVFHAGTA--NNEAGDVVTNGGRVLCATALGNTVSEAQERAYALTKQVSWNGMFHRNDI 418

Query: 410 GLQKKER 416
           G +   R
Sbjct: 419 GYRAIAR 425


>gi|261378565|ref|ZP_05983138.1| phosphoribosylamine--glycine ligase [Neisseria cinerea ATCC 14685]
 gi|269145119|gb|EEZ71537.1| phosphoribosylamine--glycine ligase [Neisseria cinerea ATCC 14685]
          Length = 423

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/423 (46%), Positives = 264/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   I +  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNTGTAIEPKLQNIALTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENITFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMVKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA  AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHVAIDDMLLGNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNHVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPTI GM+ E N F G L+AGLMI + G PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTIAGMKAEGNEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLADLVEAAIDGKLDSITAEWNPQTAVGVVLAAQNYPETPKKGDVISGLDAANQIGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    N+  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGNVLTNGGRVLCVVGLGDDVAQAKAKAYSALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|307255069|ref|ZP_07536887.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259506|ref|ZP_07541231.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306861942|gb|EFM93918.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866442|gb|EFM98305.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 428

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + +AI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEESIENLAIVATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|91774704|ref|YP_544460.1| phosphoribosylamine--glycine ligase [Methylobacillus flagellatus
           KT]
 gi|91708691|gb|ABE48619.1| phosphoribosylamine--glycine ligase [Methylobacillus flagellatus
           KT]
          Length = 422

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/418 (46%), Positives = 270/418 (64%), Gaps = 6/418 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK+AQS  +S ++  PGN G A     V + I     ++ F Q+
Sbjct: 1   MKILVIGGGGREHALAWKLAQSERISRVFVAPGNAGTALDPDMVNVPITKVPELVEFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ DA  AAG K+FGP+Q AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIGLTVVGPEAPLSQGVVDAFRAAGLKIFGPTQAAAQLESSKDFAKAFMIRHNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ-----INS 175
             F+D   A  YV+ +  PIV+KADGL AGKGVVVA   DEA +AID            +
Sbjct: 121 ATFTDAAAAHDYVKQQGAPIVIKADGLAAGKGVVVAMNEDEAHAAIDAMLADNKLGAAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLTGEEASFIVMVDGKHILPLATSQDHKRLLDGDQGPNTGGMGAYSPAPVVTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPY-LIEYNVRFGDPECQAMMMR 294
           +++ V+++II PT+ GM K+  P+ G L+AGLMI+E G    +E+N R GDPE Q +M+R
Sbjct: 241 IHAKVMREIIDPTVAGMAKDGIPYTGFLYAGLMISEDGSVKTLEFNCRMGDPETQPIMLR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD++++L   V G L+ T  +W    AL VV+A+  YP+    G  I+ +P++     
Sbjct: 301 LKSDLVDLLEHAVDGTLNETQADWDRRCALGVVLASANYPDTPRLGDEITGLPKDLVDAY 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           +FHAG+AI ++ +  +GGRVL   ALG+T+  ++  AY + E I +    +R DIG +
Sbjct: 361 VFHAGSAIKDDKVVTSGGRVLCVAALGETVKYAQSQAYKVAEGIKFDGMQFRTDIGYR 418


>gi|315127808|ref|YP_004069811.1| phosphoribosylglycinamide synthetase [Pseudoalteromonas sp. SM9913]
 gi|315016322|gb|ADT69660.1| phosphoribosylglycinamide synthetase [Pseudoalteromonas sp. SM9913]
          Length = 428

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 275/426 (64%), Gaps = 11/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQ+  ++ ++  PGN G A   +   VAI++++   ++ F 
Sbjct: 1   MNVLVIGSGGREHALAFKAAQNTKVNTVYVAPGNAGTALEPKLENVAINVEDLDGLLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ +++L +VGPE+PLV G+ D     G  +FGP+  AA+LE SKSF K F  ++ IPTA
Sbjct: 61  QKNNVELTIVGPEVPLVLGVVDKFREHGLAIFGPTAGAAQLEGSKSFTKDFLARHAIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ F     A  Y++ K  PIV+KADGL AGKGV+VA    EA  AI        F   
Sbjct: 121 DYQTFEQIDPALAYLKEKGAPIVIKADGLAAGKGVIVAMDEREAEEAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DGK  +PF T++DHKR ++GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT+EGM  E +P+ G L+AGLMI + G P +IEYN RFGDPE Q MM
Sbjct: 241 DEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDDTGTPKVIEYNCRFGDPETQPMM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIIS--KIPQNT 350
           +RL+SD++E++ +     L  T I + +  A+ VV+A KGYP+ YP G  IS  K+    
Sbjct: 301 LRLQSDLVELIEAANRVELDKTTIEFDSRAAVGVVLAAKGYPDNYPKGDAISGLKVTYPE 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           G  ++FHAGT    +N+   GGRVL ATALG T+T++++ AY +V+ I W    +R DI 
Sbjct: 361 G-EKVFHAGTKQDGDNVVTAGGRVLCATALGNTVTQAQQRAYKLVDEISWDGMEYRTDIA 419

Query: 411 LQKKER 416
            +   R
Sbjct: 420 YRAIAR 425


>gi|332654356|ref|ZP_08420100.1| phosphoribosylamine--glycine ligase [Ruminococcaceae bacterium D16]
 gi|332517442|gb|EGJ47047.1| phosphoribosylamine--glycine ligase [Ruminococcaceae bacterium D16]
          Length = 418

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 271/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHA+ WK+AQSP ++EL+  PGN GIAQ A CV I   +  A++ +C+E
Sbjct: 1   MKVLVVGGGGREHAICWKLAQSPKVTELYCAPGNGGIAQVATCVPIKATDVDAMVAWCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D V+V P+ PL  G+ DAL AAG   FGP   AA +E+SK+F+K+   KY IPTA Y
Sbjct: 61  NAMDFVMVAPDDPLALGMVDALEAAGIPAFGPRANAAIIEASKAFSKELMKKYHIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
           + F++  KA  Y+  +  PIVVKADGL  GKGVVVA+TVDEA +A+     D  F Q  S
Sbjct: 121 ETFTEMDKALAYIDEQGAPIVVKADGLALGKGVVVASTVDEAKTAVREMMEDHKFGQSGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE + G EV+  A CDG+  +P  +++DHKR +DG++GPNTGGMGA  P+   + E
Sbjct: 181 TVVIEECMVGPEVTVLAFCDGEHLVPMLSSQDHKRAYDGNLGPNTGGMGAFCPSPKYTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++KI LPT+  ++ E  PF+GV++ GLM+T+ GP ++EYN RFGDPE Q ++  L
Sbjct: 241 IAKECMEKIFLPTVAALKAEGRPFKGVIYFGLMLTKDGPKVVEYNARFGDPETQPLLSML 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+++I  +CV+G L    + WK   A  +V+A+ GYP +Y  G  IS + +   +  +
Sbjct: 301 DSDLMDIFEACVNGTLDQVEVKWKDSAACCIVLASGGYPVKYQSGYPISGLEEAGKSATV 360

Query: 356 FHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FHAGT    +  +   GGRVL  TALG  + E+   AY     I ++  + R+DIG
Sbjct: 361 FHAGTKRQEDGTIVTAGGRVLGVTALGADLDEAISNAYAACAPISFQDMHMRKDIG 416


>gi|92113037|ref|YP_572965.1| phosphoribosylamine--glycine ligase [Chromohalobacter salexigens
           DSM 3043]
 gi|91796127|gb|ABE58266.1| phosphoribosylamine--glycine ligase [Chromohalobacter salexigens
           DSM 3043]
          Length = 432

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/429 (45%), Positives = 276/429 (64%), Gaps = 12/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK AQSP +  ++  PGN G A+ ++   VAID  + + +  F 
Sbjct: 1   MKVLIIGGGGREHALAWKAAQSPRVDAVFVAPGNAGTARESKLTNVAIDATDLAGLEAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   AAG  +FGP+Q AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  RDNGVDLTIVGPEAPLVEGVVDRFRAAGLAIFGPTQAAAQLEGSKAFAKDFLARHAIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y  FSD   A  YV+ +  PIV+KADGL AGKGV+VA +  EA +A+        F   
Sbjct: 121 AYATFSDVEPALAYVREQGAPIVIKADGLAAGKGVIVAMSEAEAETAVRDILAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+LEG E SF  + DG+  +P  T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRAGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           +E+   ++ ++ILPT+ GM +E +P+ G L+AGLMI+ QG P +IEYN RFGDPE Q ++
Sbjct: 241 REVEKRIMDEVILPTVRGMAEEGHPYTGFLYAGLMISPQGAPKVIEYNCRFGDPETQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++ +  +   G L +   +W    A+ VV+A  GYP +Y  G +I  +      
Sbjct: 301 LRLKSDLVGLCLAATRGQLASQQCDWDTRAAVGVVMAAGGYPGDYRKGDVIEGLDGAEAV 360

Query: 353 -TQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGTA+ ++  +  +GGRVL  TALG  +T +RE AY  V  I W+   +R DI 
Sbjct: 361 GCKVFHAGTALRDDGRVVTSGGRVLCVTALGARVTVAREHAYEGVAAIHWQDALYRRDIA 420

Query: 411 LQ--KKERN 417
            +   +ER+
Sbjct: 421 HRAVARERD 429


>gi|15804596|ref|NP_290637.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7
           EDL933]
 gi|15834182|ref|NP_312955.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           Sakai]
 gi|168752029|ref|ZP_02777051.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758598|ref|ZP_02783605.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764586|ref|ZP_02789593.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771478|ref|ZP_02796485.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777381|ref|ZP_02802388.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168780391|ref|ZP_02805398.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790366|ref|ZP_02815373.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC869]
 gi|168798360|ref|ZP_02823367.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC508]
 gi|195939631|ref|ZP_03085013.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806688|ref|ZP_03249025.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813417|ref|ZP_03254746.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821233|ref|ZP_03261553.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396846|ref|YP_002273522.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217325861|ref|ZP_03441945.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254796003|ref|YP_003080840.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227283|ref|ZP_05941564.1| phosphoribosylamine-glycine ligase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257030|ref|ZP_05949563.1| phosphoribosylamine-glycine ligase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285420|ref|YP_003502238.1| Phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           CB9615]
 gi|20139445|sp|Q8X612|PUR2_ECO57 RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|12518937|gb|AAG59202.1|AE005632_3 phosphoribosylglycinamide synthetase = GAR synthetase [Escherichia
           coli O157:H7 str. EDL933]
 gi|13364404|dbj|BAB38351.1| phosphoribosylglycinamide synthetase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187767359|gb|EDU31203.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014033|gb|EDU52155.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189001791|gb|EDU70777.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354601|gb|EDU73020.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359748|gb|EDU78167.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365461|gb|EDU83877.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370161|gb|EDU88577.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC869]
 gi|189379173|gb|EDU97589.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC508]
 gi|208726489|gb|EDZ76090.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734694|gb|EDZ83381.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741356|gb|EDZ89038.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158246|gb|ACI35679.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209751628|gb|ACI74121.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751630|gb|ACI74122.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751632|gb|ACI74123.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751634|gb|ACI74124.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751636|gb|ACI74125.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|217322082|gb|EEC30506.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254595403|gb|ACT74764.1| phosphoribosylamine-glycine ligase [Escherichia coli O157:H7 str.
           TW14359]
 gi|290765293|gb|ADD59254.1| Phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           CB9615]
 gi|320190897|gb|EFW65547.1| Phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320639096|gb|EFX08736.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           G5101]
 gi|320644490|gb|EFX13553.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H- str.
           493-89]
 gi|320649809|gb|EFX18330.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H- str.
           H 2687]
 gi|320655142|gb|EFX23098.1| phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660786|gb|EFX28240.1| phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665904|gb|EFX32935.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326347143|gb|EGD70873.1| Phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           1125]
 gi|326347606|gb|EGD71328.1| Phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           1044]
          Length = 429

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 279/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMASEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|187929468|ref|YP_001899955.1| phosphoribosylamine--glycine ligase [Ralstonia pickettii 12J]
 gi|309781757|ref|ZP_07676490.1| phosphoribosylamine--glycine ligase [Ralstonia sp. 5_7_47FAA]
 gi|187726358|gb|ACD27523.1| phosphoribosylamine/glycine ligase [Ralstonia pickettii 12J]
 gi|308919398|gb|EFP65062.1| phosphoribosylamine--glycine ligase [Ralstonia sp. 5_7_47FAA]
          Length = 422

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 264/416 (63%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V+++GSGGREHALAWK+A+SP +  ++  PGN G A   +   + I +   +  F + 
Sbjct: 1   MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNLPITDPEVLAAFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   VVGPE PL  GI D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGIHFTVVGPEAPLAAGIVDLFRAKGLRIFGPTKAAAQLESSKDFAKAFMHRHGIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ-----QINS 175
           Q FSD  +A  YV  +  PIVVKADGL AGKGVVVA T +EA SAID            +
Sbjct: 121 QTFSDAAQAHAYVDQEGAPIVVKADGLAAGKGVVVAMTAEEAHSAIDMMLADNRLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  +CDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVVCDGKNVVALATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           L++  +++II+PTI GM+K+  P+ G L+AGLMI  +G P  +E+N R GDPE Q +M R
Sbjct: 241 LHARALREIIMPTIRGMEKDGIPYTGFLYAGLMIDAEGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           +++D+ ++L+  + G L    ++W    AL VV+A   YP+    G +I+ IP+ T  + 
Sbjct: 301 MKTDLYDVLDRAIDGKLDGMELDWDRRTALGVVMAAHNYPDTPRKGDVITGIPKETEDSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            FHAGT + +  LT NGGRVL    L  T+  ++  AY+ +E I +    +R DIG
Sbjct: 361 TFHAGTTLKDGVLTTNGGRVLCVVGLADTVKAAQRAAYNAIEQIHFDGAQYRTDIG 416


>gi|311029273|ref|ZP_07707363.1| phosphoribosylamine--glycine ligase [Bacillus sp. m3-13]
          Length = 423

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/414 (45%), Positives = 268/414 (64%), Gaps = 7/414 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+AWK AQSP ++E++  PGN G+    + V I   + +++IHF +E
Sbjct: 1   MKVLVIGKGGREHAIAWKFAQSPSVTEVFIAPGNAGMETVGKLVPIQESDTNSLIHFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL +VGPE+PL+NGI DA  AAG +VFGP++ AA +E SK FAK    KYGIPTA Y
Sbjct: 61  NVIDLTMVGPEVPLLNGIVDAFQAAGLQVFGPTKAAALIEGSKGFAKDLMKKYGIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
           + F+D  +A+ Y++ K  PIV+KADGL AGKGVVVA T +EA  A+     +  F + +S
Sbjct: 121 ETFTDYEEARTYIEGKGAPIVLKADGLAAGKGVVVAMTDEEALEAVHEMMAESKFGEASS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+LEG E SF A  +G+   P   A+DHKR  DGD GPNTGGMGA SP   +   
Sbjct: 181 KLVIEEFLEGEEFSFMAFVNGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQIPSS 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++ ++LPT + M  E  PF G+L+AGL++T++GP +IE+N RFGDPE Q ++ RL
Sbjct: 241 VVEEALETVLLPTAKAMVDEGRPFVGILYAGLILTKKGPKVIEFNARFGDPETQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD+ E+L   + G+     + W  +  + VV+A+KGYPE Y +G +I    Q  G   +
Sbjct: 301 ESDLAEVLTGVLRGD-DELELKWSDQSVVGVVMASKGYPEAYENGAVIEGADQ-VGEGLV 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
           FHAGT      L  NGGRVL   A   ++ E+++  Y  +  +   + ++R+DI
Sbjct: 359 FHAGTEAKAGKLVTNGGRVLLVAAQSDSLEEAQKKVYEELRKVKCDNLFYRKDI 412


>gi|218710868|ref|YP_002418489.1| phosphoribosylamine--glycine ligase [Vibrio splendidus LGP32]
 gi|218323887|emb|CAV20248.1| Phosphoribosylamine--glycine ligase [Vibrio splendidus LGP32]
          Length = 429

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 271/427 (63%), Gaps = 13/427 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           MRVL+IG+GGREHAL WK AQ+P +  ++  PGN G A   +   V I +++ + ++ F 
Sbjct: 1   MRVLIIGAGGREHALGWKAAQNPNVETVFIAPGNAGTALEPKLENVNIGVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QEK I+L +VGPE PLV G+ DA    G  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QEKKIELTIVGPEAPLVIGVVDAFREVGLPIFGPTQAAAQLEGSKAFTKDFLARHEIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 YYSNFTEIEPAIAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGSSVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS        
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRASIGVVLAAGGYPADYAKGDVISLPTSEVEG 360

Query: 353 TQLFHAGTAIVNN---NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            ++FHAGT   NN   ++  NGGRVL ATALG T++E++E AY + + + W   + R DI
Sbjct: 361 QKVFHAGT--TNNEAGDVVTNGGRVLCATALGNTVSEAQERAYALTKQVSWNGMFHRNDI 418

Query: 410 GLQKKER 416
           G +   R
Sbjct: 419 GYRAIAR 425


>gi|108809593|ref|YP_653509.1| phosphoribosylamine--glycine ligase [Yersinia pestis Antiqua]
 gi|108810402|ref|YP_646169.1| phosphoribosylamine--glycine ligase [Yersinia pestis Nepal516]
 gi|153950785|ref|YP_001402795.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           31758]
 gi|153997237|ref|ZP_02022344.1| phosphoribosylamine--glycine ligase [Yersinia pestis CA88-4125]
 gi|165928312|ref|ZP_02224144.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938184|ref|ZP_02226743.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166012044|ref|ZP_02232942.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166214394|ref|ZP_02240429.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167402425|ref|ZP_02307885.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167422936|ref|ZP_02314689.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426824|ref|ZP_02318577.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|218930734|ref|YP_002348609.1| phosphoribosylamine--glycine ligase [Yersinia pestis CO92]
 gi|229837476|ref|ZP_04457638.1| phosphoribosylamine-glycine ligase [Yersinia pestis Pestoides A]
 gi|229839411|ref|ZP_04459570.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229899973|ref|ZP_04515113.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900578|ref|ZP_04515704.1| phosphoribosylamine-glycine ligase [Yersinia pestis Nepal516]
 gi|270488933|ref|ZP_06206007.1| phosphoribosylamine--glycine ligase [Yersinia pestis KIM D27]
 gi|294505400|ref|YP_003569462.1| phosphoribosylamine--glycine ligase [Yersinia pestis Z176003]
 gi|20139500|sp|Q8ZAR2|PUR2_YERPE RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|108774050|gb|ABG16569.1| phosphoribosylamine--glycine ligase [Yersinia pestis Nepal516]
 gi|108781506|gb|ABG15564.1| phosphoribosylamine--glycine ligase [Yersinia pestis Antiqua]
 gi|115349345|emb|CAL22316.1| phosphoribosylamine--glycine ligase [Yersinia pestis CO92]
 gi|149289345|gb|EDM39424.1| phosphoribosylamine--glycine ligase [Yersinia pestis CA88-4125]
 gi|152962280|gb|ABS49741.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           31758]
 gi|165913845|gb|EDR32463.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165919651|gb|EDR36984.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989039|gb|EDR41340.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166204398|gb|EDR48878.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166957147|gb|EDR55168.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167048205|gb|EDR59613.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167054206|gb|EDR64031.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229682398|gb|EEO78488.1| phosphoribosylamine-glycine ligase [Yersinia pestis Nepal516]
 gi|229686958|gb|EEO79034.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695777|gb|EEO85824.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229704164|gb|EEO91175.1| phosphoribosylamine-glycine ligase [Yersinia pestis Pestoides A]
 gi|262363466|gb|ACY60187.1| phosphoribosylamine--glycine ligase [Yersinia pestis D106004]
 gi|262367394|gb|ACY63951.1| phosphoribosylamine--glycine ligase [Yersinia pestis D182038]
 gi|270337437|gb|EFA48214.1| phosphoribosylamine--glycine ligase [Yersinia pestis KIM D27]
 gi|294355859|gb|ADE66200.1| phosphoribosylamine--glycine ligase [Yersinia pestis Z176003]
 gi|320013671|gb|ADV97242.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 428

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/426 (44%), Positives = 274/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T +EA +A++       F   
Sbjct: 121 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N+ +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|145634052|ref|ZP_01789763.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittAA]
 gi|145268496|gb|EDK08489.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittAA]
          Length = 429

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/428 (45%), Positives = 277/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKAAQSPLADKVFVTPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAENAVHDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSQVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM++E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMREVIYPTVNGMEEEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E+      G L      W  + +L +V+A +GYP++Y  G  IS +P++   
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVTSRWDPQASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNVK 419
           +  ER ++
Sbjct: 421 RAVERELQ 428


>gi|269137543|ref|YP_003294243.1| phosphoribosylamine-glycine ligase [Edwardsiella tarda EIB202]
 gi|267983203|gb|ACY83032.1| phosphoribosylamine-glycine ligase [Edwardsiella tarda EIB202]
 gi|304557617|gb|ADM40281.1| Phosphoribosylamine--glycine ligase [Edwardsiella tarda FL6-60]
          Length = 425

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/425 (45%), Positives = 269/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSPL   ++  PGN G A       IDI   +  A++ F 
Sbjct: 1   MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTALEPALENIDIAATDIDALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
               + L +VGPE PLV G+ DA  AAG  +FGPSQ AA+LE SK+F+K F  +  IPTA
Sbjct: 61  LRHQVGLTIVGPEAPLVLGVVDAFRAAGLPIFGPSQSAARLEGSKAFSKDFLARQRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y++F++   A  YV+ +  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 AYRNFTEVEPALAYVREQGAPIVIKADGLAAGKGVIVAMTREEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+LEG E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  +S
Sbjct: 181 GHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             ++  V++++I PT+ GM +E  P+ G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR++SD++ +  +  +G L      W    AL VV+A  GYP +Y  G +I  + Q T  
Sbjct: 301 MRMQSDLVALCLAGANGTLDQQSSAWDPRPALGVVLAAGGYPGDYRQGDVIHGLTQGTAQ 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGT +     +   GGRVL ATALG+ I E++  AY + + + W+ G+ R DIG 
Sbjct: 361 AKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRNAYRLADALSWEGGFCRRDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RALQR 425


>gi|77166279|ref|YP_344804.1| phosphoribosylamine--glycine ligase [Nitrosococcus oceani ATCC
           19707]
 gi|76884593|gb|ABA59274.1| phosphoribosylamine--glycine ligase [Nitrosococcus oceani ATCC
           19707]
          Length = 437

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 269/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHAL WK+AQS  + +++  PGN G A+   A+ VAI   N  A++ F 
Sbjct: 1   MKVLVIGGGGREHALTWKLAQSSQVDQIYVAPGNAGTAREPKAENVAIKSDNIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + I+L VVGPE PLV GI DA   AG   +GP   AA+LE SKSFAK+F  ++GIPTA
Sbjct: 61  SAEQIELTVVGPEAPLVLGIVDAFEEAGLPCWGPRHGAARLEGSKSFAKEFLIRWGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQI 173
            YQ FS    A  Y++ +  PIVVKADGL AGKGVVVA T +EA +A+ R      F + 
Sbjct: 121 RYQTFSQVEPAIAYIRTEGAPIVVKADGLAAGKGVVVAQTEEEAIAAVHRMLGDGVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G E SF  + DG+  +P  +A+DHK   +GD G NTGGMGA SPA  ++
Sbjct: 181 GCRVVVEEFLTGEEASFIVMSDGEHILPLASAQDHKAREEGDRGLNTGGMGAYSPAPILA 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           + ++  V+Q++I+PT+ GM +E  P++G L+AGLMI E G P ++EYN RFGDPE Q ++
Sbjct: 241 KAVHERVMQEVIVPTVRGMAEEGYPYRGFLYAGLMIAEDGSPKVLEYNCRFGDPEAQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL SD++++  + + G LH   ++W    AL VV+A KGYP  Y  G  I  +P     
Sbjct: 301 MRLRSDLVDLCQAALAGRLHEVSVDWDPRAALGVVMAAKGYPGSYSFGDPIYGLPAPERE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FH GTA     +   GGRVL    LG ++TE+   AY +V+ I WK  Y+R DIG 
Sbjct: 361 DRKVFHGGTAEKEGRIVTAGGRVLCVCGLGDSVTEAHATAYGLVQQITWKEAYYRGDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|226328710|ref|ZP_03804228.1| hypothetical protein PROPEN_02605 [Proteus penneri ATCC 35198]
 gi|225201896|gb|EEG84250.1| hypothetical protein PROPEN_02605 [Proteus penneri ATCC 35198]
          Length = 429

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 277/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK+AQSPL ++++  PGN G A     + VAI   +   ++ F 
Sbjct: 1   MKILIIGNGGREHALAWKVAQSPLATQVFVAPGNAGTALENGVENVAISATDIPTLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            E  IDL +VGPE PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LENQIDLTIVGPEAPLVIGVVDAFKEAGLTIFGPTKGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A +Y+     PIV+KADGL AGKGV+VA T  EA +AI        F   
Sbjct: 121 DYQNFTEIAPALEYLNKVGAPIVIKADGLAAGKGVIVAMTQSEAENAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  IP  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVIPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V++KII PT++GM  E + +QG L+AGLMI +QG   +IE+N RFGDPE Q +M
Sbjct: 241 NEIHQQVMEKIIYPTVKGMASEGHRYQGFLYAGLMIDKQGVAKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI-PQNTG 351
           MR++SD++E+  +   GNL +    W    AL +V+A  GYP +Y  G +I  + P ++ 
Sbjct: 301 MRMQSDLVELCLAGAKGNLKDKDSVWDPRPALGIVIAAGGYPADYRQGDVIEGLTPTSST 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           T ++F AGT + +   +   GGRVL ATALG  I ++++ AY + ++I W   ++R DIG
Sbjct: 361 TAKIFQAGTTLNDKGEVVTAGGRVLCATALGDDIEQAQKNAYALAKSIHWDGSFYRHDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|318607522|emb|CBY29020.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 431

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 272/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPALENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLAEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAEKIQWEGAFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|301019446|ref|ZP_07183619.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 69-1]
 gi|300399261|gb|EFJ82799.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 69-1]
          Length = 429

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
             ++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DGVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|292670979|ref|ZP_06604405.1| phosphoribosylamine-glycine ligase [Selenomonas noxia ATCC 43541]
 gi|292647600|gb|EFF65572.1| phosphoribosylamine-glycine ligase [Selenomonas noxia ATCC 43541]
          Length = 433

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/415 (46%), Positives = 263/415 (63%), Gaps = 9/415 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           + +L+IGSGGREHAL WK+++SP    +++IPGNPG+ +      I + +++AI+ F +E
Sbjct: 15  VNILVIGSGGREHALFWKLSESPQTERIYAIPGNPGMGEMTD---IAVTDNAAILQFAKE 71

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I LVVVGPE+PL+NG+ D L AAG   FGP   AA++E SKSFAK    KYGIPTA Y
Sbjct: 72  KDIGLVVVGPEVPLMNGLVDDLEAAGIPAFGPRANAAEIEGSKSFAKDLMKKYGIPTARY 131

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQINS 175
           + F++   A+ Y++++  PIVVKADGL AGKGVVVA T  EA  A+D       F    +
Sbjct: 132 EVFAEAEAARAYIRSEGTPIVVKADGLAAGKGVVVAMTEQEALDAVDAIMEHNSFGDAGA 191

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE++EG E S  A  DG    P  +A+DHKR  DGD GPNTGGMG  +PA  M+ E
Sbjct: 192 RVVIEEFMEGEEASLLAFTDGTVIRPMISAQDHKRAFDGDKGPNTGGMGTYAPAPVMTPE 251

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    +++I+ PTI  M+KE   ++G L+ GLMIT  GP ++E+N RFGDPE Q ++  L
Sbjct: 252 LTERAVEEILKPTISAMEKEGRAYRGCLYLGLMITADGPKVVEFNARFGDPETQVVLPLL 311

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           + D+++I+++C  G L +  I WK   A+ VV+A  GYP  Y  G  I  I        L
Sbjct: 312 DGDLVQIMHACAGGTLADVPIRWKDGAAVCVVLAAGGYPASYEKGNEIYGIGNAEKLGAL 371

Query: 356 -FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
            FHAGTA  N  +  NGGRVL    +GK I  + + AY  V+ I +K  Y R+DI
Sbjct: 372 VFHAGTAKKNGKIVTNGGRVLGVVGMGKDIASAVQSAYDAVDQISFKGEYHRKDI 426


>gi|307246088|ref|ZP_07528170.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306853023|gb|EFM85246.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 428

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 277/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + +AI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENLAIVATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|254436035|ref|ZP_05049542.1| phosphoribosylamine--glycine ligase [Nitrosococcus oceani AFC27]
 gi|207089146|gb|EDZ66418.1| phosphoribosylamine--glycine ligase [Nitrosococcus oceani AFC27]
          Length = 448

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 269/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHAL WK+AQS  + +++  PGN G A+   A+ VAI   N  A++ F 
Sbjct: 12  MKVLVIGGGGREHALTWKLAQSSQVDQIYVAPGNAGTAREPKAENVAIKSDNIPALVAFA 71

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + I+L VVGPE PLV GI DA   AG   +GP   AA+LE SKSFAK+F  ++GIPTA
Sbjct: 72  SAEQIELTVVGPEAPLVLGIVDAFEEAGLPCWGPRHGAARLEGSKSFAKEFLIRWGIPTA 131

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQI 173
            YQ FS    A  Y++ +  PIVVKADGL AGKGVVVA T +EA +A+ R      F + 
Sbjct: 132 RYQTFSQVEPAIAYIRTEGAPIVVKADGLAAGKGVVVAQTEEEAIAAVHRMLGDGVFGEA 191

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G E SF  + DG+  +P  +A+DHK   +GD G NTGGMGA SPA  ++
Sbjct: 192 GCRVVVEEFLTGEEASFIVMSDGEHILPLASAQDHKAREEGDRGLNTGGMGAYSPAPILA 251

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           + ++  V+Q++I+PT+ GM +E  P++G L+AGLMI E G P ++EYN RFGDPE Q ++
Sbjct: 252 KAVHERVMQEVIVPTVRGMAEEGYPYRGFLYAGLMIAEDGSPKVLEYNCRFGDPEAQPIL 311

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL SD++++  + + G LH   ++W    AL VV+A KGYP  Y  G  I  +P     
Sbjct: 312 MRLRSDLVDLCQAALAGRLHEVSVDWDPRAALGVVMAAKGYPGSYSFGDPIYGLPAPERE 371

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FH GTA     +   GGRVL    LG ++TE+   AY +V+ I WK  Y+R DIG 
Sbjct: 372 DRKVFHGGTAEKEGRIVTAGGRVLCVCGLGDSVTEAHATAYGLVQQITWKEAYYRGDIGY 431

Query: 412 QKKERN 417
           +   R 
Sbjct: 432 RAIARE 437


>gi|167035865|ref|YP_001671096.1| phosphoribosylamine--glycine ligase [Pseudomonas putida GB-1]
 gi|166862353|gb|ABZ00761.1| phosphoribosylamine--glycine ligase [Pseudomonas putida GB-1]
          Length = 431

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/425 (44%), Positives = 275/425 (64%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            EK++DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  -EKNVDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T+DEA +A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLDEAEAAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +I+ +      
Sbjct: 300 LRLESSLVLLIEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVINGLDAAAKI 359

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +T NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTALKDGQVTTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRTDIGY 419

Query: 412 QKKER 416
           +   R
Sbjct: 420 RAIAR 424


>gi|226950305|ref|YP_002805396.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A2 str.
           Kyoto]
 gi|226843742|gb|ACO86408.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A2 str.
           Kyoto]
          Length = 413

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/415 (42%), Positives = 279/415 (67%), Gaps = 8/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHA+AWKI ++ L+ +++  PGN   A   +C  I++ +   ++ F  +
Sbjct: 1   MKILIIGSGGREHAIAWKIGKNTLVEKIFCAPGNGCTALEQKCENINVSSDEELLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            ++DL +VGPE+PL++GI D     G  +FGP ++AA LE SK+FAK F  KY I TA Y
Sbjct: 61  NNVDLTIVGPEVPLMDGIVDLFKDKGLNIFGPDKKAALLEGSKAFAKDFMKKYNIKTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F +  KA +Y++N   P+V+KADGL AGKGVV++ + +E+ S ++       F+    
Sbjct: 121 EVFEEESKALEYLKNSEHPVVIKADGLAAGKGVVISNSFEESKSTLEEFMAKDKFKGAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S  ++ DG+T IPF +++DHK+I+DG +GPNTGGMG  +P    ++E
Sbjct: 181 KVVIEEFLEGPEASILSITDGETIIPFISSKDHKQIYDGGLGPNTGGMGVIAPNPYCTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I+ PT++G+QKE   F G++F G+MIT++GPYL+EYN+R GDPE +A++  +
Sbjct: 241 VLKDFNENILKPTLKGLQKENLKFSGIIFFGIMITKKGPYLLEYNLRMGDPETEAVLPLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD+L+++   ++  L +T+I WK  Y+  V+ A+KGYPE Y  G +I+ +  + G   +
Sbjct: 301 ESDLLDLILMSINKELKSTNIKWKKAYSTCVIAASKGYPESYEKGFLINGVENSDG---I 357

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           F AG  + +N L  NGGRVL   A+G+T+ +S   AY  +E I+++  Y+R+DIG
Sbjct: 358 FGAGVKLKDNRLLTNGGRVLCTQAIGETLEQSINTAYEKMEKINFEGIYYRKDIG 412


>gi|238790631|ref|ZP_04634396.1| Phosphoribosylamine--glycine ligase [Yersinia frederiksenii ATCC
           33641]
 gi|238721300|gb|EEQ12975.1| Phosphoribosylamine--glycine ligase [Yersinia frederiksenii ATCC
           33641]
          Length = 428

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/426 (44%), Positives = 274/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK+ QSPL  +++  PGN G A   +   +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKVTQSPLADKIYVAPGNAGTALEPRLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+     W    +L VV+A  GYP +Y  G +I  +PQ  T 
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSEWDERPSLGVVLAAGGYPADYRQGDVIYGLPQQETA 360

Query: 352 TTQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + + NN+   GGRVL  TALG T+ ++++ AY + E+I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDDQNNVVTAGGRVLCVTALGATVAQAQQHAYKLAESIQWEGAFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|325290457|ref|YP_004266638.1| phosphoribosylamine--glycine ligase [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324965858|gb|ADY56637.1| phosphoribosylamine--glycine ligase [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 426

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/415 (45%), Positives = 271/415 (65%), Gaps = 8/415 (1%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEKH 62
           +L+IG GGREHALAWK+AQSPL ++++  PGN G A+    V I   +  A+I F QE+ 
Sbjct: 11  ILVIGGGGREHALAWKLAQSPLCAKIFVAPGNAGTAEWN--VPIKADDFPALIKFAQEQK 68

Query: 63  IDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQH 122
           I++ +VGPE PL  GI +A  A G K+FGP++ AA+LE SK+FAK+   +  +PTA Y+ 
Sbjct: 69  IEITIVGPEDPLSLGIVNAFQAEGLKIFGPTREAARLEGSKAFAKEIMDEAAVPTAQYKV 128

Query: 123 FSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINSTVI 178
           F+D  +A+ Y+     PIV+KADGL AGKGV+VA+  DEA  A+D+     F +  + V+
Sbjct: 129 FTDQEEAEAYIGRVGAPIVIKADGLAAGKGVIVASLFDEAVEAVDKIMGGSFGEAGTKVV 188

Query: 179 IEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYS 238
           +EEYLEG EVS    CDG TA+P    +DHKR  +GD+G NTGGMG  SP    ++++ +
Sbjct: 189 VEEYLEGQEVSLLCFCDGTTALPMVAVQDHKRALNGDLGLNTGGMGTYSPPSFWTKDIEN 248

Query: 239 TVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESD 298
            V+ KI++PT+  MQK   PF GVLF GL++TE GP ++EYNVRFGDPE Q +M  + SD
Sbjct: 249 QVVDKIVMPTLNIMQKRGAPFVGVLFLGLIMTESGPKVLEYNVRFGDPETQVVMALMRSD 308

Query: 299 ILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL-FH 357
           +L ++ +C++G L      W  + A+ VV+A  GYP +Y  G  I+ +PQ  G  ++ FH
Sbjct: 309 MLPVIEACINGRLAEVQAEWYEDTAVCVVMAAPGYPGDYEKGIPIT-LPQVDGQREMIFH 367

Query: 358 AGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           AGTA+      ++GGRVL  T    ++  +R   Y +VE ID+   ++R DIG++
Sbjct: 368 AGTALQEGKTVSSGGRVLGVTVREDSLPAARTRVYELVEKIDFPDAHYRTDIGVK 422


>gi|77359309|ref|YP_338884.1| phosphoribosylglycinamide synthetase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874220|emb|CAI85441.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 429

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 272/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQ+  ++ ++  PGN G A   +   VAI++ +   ++ F 
Sbjct: 1   MNVLVIGSGGREHALAFKAAQNTKVNTVFVAPGNAGTALEPKLENVAINVDDLDGLLQFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ +++L +VGPE+PLV G+ D     G  +FGP+  AA+LE SKSF K F  ++ IP+ 
Sbjct: 61  QQNNVELTIVGPEIPLVLGVVDKFREHGLAIFGPTAGAAQLEGSKSFTKDFLARHNIPSG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ F     A  Y++ K  PIV+KADGL AGKGV+VA T  EA  AI        F   
Sbjct: 121 DYQTFEQVAPALAYLKEKGAPIVIKADGLAAGKGVIVAMTEAEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DGK  +PF T++DHKR ++GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGDAGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT+EGM  E +P+ G L+AGLMI   G P +IEYN RFGDPE Q MM
Sbjct: 241 DEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDTDGTPKVIEYNCRFGDPETQPMM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E++ +     L  T I +    A+ VV+A KGYP +YP G +IS +  +   
Sbjct: 301 LRLQSDLVELIEAANRVELDKTTIEFDPRAAVGVVLAAKGYPGDYPKGDVISGLQVDYPA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    N++   GGRVL ATALG T+TE+++ AY +++ + W    +R DI  
Sbjct: 361 GEKVFHAGTKQNGNDVVTAGGRVLCATALGNTVTEAQQRAYELIKQLSWDGMEYRTDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|323144211|ref|ZP_08078846.1| phosphoribosylamine--glycine ligase [Succinatimonas hippei YIT
           12066]
 gi|322416052|gb|EFY06751.1| phosphoribosylamine--glycine ligase [Succinatimonas hippei YIT
           12066]
          Length = 427

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/427 (44%), Positives = 280/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAW+ + SPL  +++  PGNPG A+  +   V I + + + ++ F 
Sbjct: 1   MKVLVIGNGGREHALAWRASLSPLADKVFVAPGNPGTAREEKMENVNISVGDIAGLVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  IDL +VGPE PLV+G+ DA  A G  +FGPS+ AA+LE SKSF K F  ++ IPTA
Sbjct: 61  KDNKIDLTIVGPEAPLVDGVVDAFKAEGLTIFGPSKAAAQLEGSKSFTKDFLKRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            Y+ F +  KA  Y++ +  PIV+KADGL AGKGVVVA T DEA SA+     D  F   
Sbjct: 121 AYEIFDNAEKACAYIKEQGAPIVIKADGLAAGKGVVVAMTEDEAISAVHSMLDDHAFGNA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE++EG E SF  + D   A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFMEGEEASFIVMSDSINALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
           +++Y  V+ +II PT+EGM+K+  P+ G L+AGLMI + G P ++E+N RFGDPE Q +M
Sbjct: 241 KDVYDRVMNEIINPTLEGMRKDGIPYFGFLYAGLMIGKNGAPRVVEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEI-LNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG 351
           +R++SD++++ L       L    + +    A+ VV+A +GYP     G  IS + + T 
Sbjct: 301 LRMQSDLVDLCLKGAKENGLQGLEVKYDPRPAVGVVLAAEGYPASPRKGDEISGLDEKTP 360

Query: 352 T-TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             T++F AGT  V+  +  +GGRVL  TALG  I ++R+ AY ++E + +   ++R+DI 
Sbjct: 361 EGTKIFEAGTKSVDGKVVTSGGRVLCVTALGDDIKDARDRAYKLIEKVHFNGMFYRKDIA 420

Query: 411 LQKKERN 417
            +  +RN
Sbjct: 421 WRALKRN 427


>gi|325577664|ref|ZP_08147939.1| phosphoribosylamine-glycine ligase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160409|gb|EGC72535.1| phosphoribosylamine-glycine ligase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 427

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/419 (46%), Positives = 269/419 (64%), Gaps = 9/419 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIIMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 SEIHDRIMREVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RLESD++E+      G L      W  + +L +V+A +GYP +Y  G +IS +PQ+   
Sbjct: 301 LRLESDLVELCLKACEGKLDEVKSQWNPKASLGIVLAAEGYPGDYRKGDVISGLPQSAVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG
Sbjct: 361 NEKVFLAGVAEKEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWTGRFYRRDIG 419


>gi|332159927|ref|YP_004296504.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664157|gb|ADZ40801.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863077|emb|CBX73208.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica
           W22703]
          Length = 431

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 272/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLAEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAEKIQWEGAFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|291195933|gb|ADD84680.1| PurD [Bacillus amyloliquefaciens]
 gi|328552302|gb|AEB22794.1| phosphoribosylamine--glycine ligase [Bacillus amyloliquefaciens
           TA208]
 gi|328910646|gb|AEB62242.1| phosphoribosylglycinamide synthetase [Bacillus amyloliquefaciens
           LL3]
          Length = 422

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/424 (44%), Positives = 267/424 (62%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREH LAWK AQSPL   +++ PGN G+A  A  V+I+  +H+ +I F +E
Sbjct: 1   MNVLIIGKGGREHTLAWKAAQSPLTDTVYAAPGNDGMADCATLVSIEESDHAGLIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            H+ L ++GPE+PL+ GI+D    AG  VFGPS++AA +E SK FAK    KYGIPTA Y
Sbjct: 61  HHVGLTIIGPEVPLIEGIADEFEKAGLLVFGPSEQAAIIEGSKQFAKDLMKKYGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
           + F+   +AK YVQ K  PIV+KADGL AGKGV VA T +EA   +     D  F + ++
Sbjct: 121 ETFTSFEEAKAYVQQKGAPIVIKADGLAAGKGVTVAMTEEEAIECLHDFLEDEKFGEASA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           +V+IEE+L G E S  A   G+T  P   A+DHKR  DGD GPNTGGMGA SP   +S +
Sbjct: 181 SVVIEEFLAGEEFSLMAFVKGETVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPHISDD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +  + ++ I+ P  + M KE   F GVL+AGL++TE G  +IE+N RFGDPE Q ++ R+
Sbjct: 241 IVKSAVETIVKPAAKAMVKEGRSFTGVLYAGLILTENGSKVIEFNARFGDPETQVVVPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD++++L   +H    +  + WK   A++VV+A++GYPE Y  GT I  +        +
Sbjct: 301 ESDLIQVLLDLLHEK--DVDLRWKDTAAVSVVLASEGYPEGYAKGTPIGSLTSAEDGIAV 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT    +    NGGRV + TA  +T  E+R+  Y  V  +     ++R DIG++  +
Sbjct: 359 FHAGTKKDGDQFVTNGGRVANVTAFAETFEEARDKVYSAVSGLTKPGLFYRSDIGVRALK 418

Query: 416 RNVK 419
            +++
Sbjct: 419 ASLR 422


>gi|306812020|ref|ZP_07446228.1| phosphoribosylamine--glycine ligase [Escherichia coli NC101]
 gi|305854625|gb|EFM55061.1| phosphoribosylamine--glycine ligase [Escherichia coli NC101]
          Length = 429

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/427 (44%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q V I + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVDIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|322807191|emb|CBZ04765.1| phosphoribosylamine--glycine ligase [Clostridium botulinum H04402
           065]
          Length = 413

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/415 (42%), Positives = 278/415 (66%), Gaps = 8/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHA+AWKI ++ L+ +++  PGN   A   +C  I++ +   ++ F  +
Sbjct: 1   MKILIIGSGGREHAIAWKIGKNTLVEKIFCAPGNGCTALEQKCENINVSSDEELLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +++DL +VGPE+PL+ GI D     G  +FGP ++AA LE SK+FAK F  KY I TA Y
Sbjct: 61  RNVDLTIVGPEVPLMEGIVDLFKDKGLNIFGPDKKAALLEGSKAFAKDFMKKYNIKTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F +  KA +Y++N   P+V+KADGL AGKGVV++ + +E+ S ++       F+    
Sbjct: 121 EVFQEESKALEYLKNSEYPVVIKADGLAAGKGVVISNSFEESKSTLEEFMAKDKFKGAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S  ++ DG+T IPF +++DHK+I+DG +GPNTGGMG  +P    ++E
Sbjct: 181 KVVIEEFLEGPEASILSITDGETIIPFISSKDHKQIYDGGLGPNTGGMGVIAPNPYCTKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I+ PT++G+QKE   F G++F G+MIT++GPYL+EYN+R GDPE +A++  +
Sbjct: 241 VLEDFNENILKPTLKGIQKENLKFSGIIFFGIMITKKGPYLLEYNLRMGDPETEAVLPLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+L ++   ++  L NT+I WK  Y+  V+ A+KGYPE Y  G +I+ +  + G   +
Sbjct: 301 DSDLLNLILMSINKELKNTNIKWKKAYSTCVIAASKGYPESYEKGFLINGVENSEG---I 357

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           F AG  + +N L  NGGRVL   A+G+T+ +S   AY  +E I+++  Y+R+DIG
Sbjct: 358 FGAGVKLKDNRLLTNGGRVLCTQAIGETLEQSINTAYEKMEKINFEGIYYRKDIG 412


>gi|312144570|ref|YP_003996016.1| phosphoribosylamine/glycine ligase [Halanaerobium sp.
           'sapolanicus']
 gi|311905221|gb|ADQ15662.1| phosphoribosylamine/glycine ligase [Halanaerobium sp.
           'sapolanicus']
          Length = 424

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/423 (45%), Positives = 273/423 (64%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGRE+ALAWK+AQS  + EL+   GNPG A+  + +  +  NH  ++ F  +
Sbjct: 1   MNILLIGSGGRENALAWKLAQSNKVDELYIAAGNPGTAKFGENLDFEENNHQGLLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID+ +VGPE PL  GI D     G KVFGP++ AA+LESSK FAK    KY IPTA Y
Sbjct: 61  EKIDITIVGPEAPLAAGIVDLFKEHGIKVFGPTKDAAQLESSKVFAKNLMQKYNIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
           + FSDP  A++Y++ K +PIVVKA+GL AGKGV+VA  ++EA +A     ID  F Q   
Sbjct: 121 KSFSDPKDARKYIKEKGVPIVVKAEGLAAGKGVIVAQHLEEALNAVEKIMIDEKFGQAGE 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EEYLEG E +  + CDG++ +P   ++DHK ++DGD GPNTGGMGA +PA  + ++
Sbjct: 181 KIVVEEYLEGEEATILSFCDGESIVPMIPSQDHKPVYDGDEGPNTGGMGAYAPAPVVDKK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + S + ++I+ PT++ +QKE   F+G+++ GLMI      ++EYNVRFGDPE Q ++  L
Sbjct: 241 MMSEIKKEIMEPTLKALQKEGIDFKGIIYFGLMIKNNKAKVLEYNVRFGDPEAQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+LEI+ + ++  L +  I W  + AL VV+A+ GYP EY  G  I+ I        L
Sbjct: 301 KTDLLEIIEAVLNNKLGDLKIEWSTKKALCVVMASGGYPVEYETGKKITGIEMFEERDDL 360

Query: 356 --FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
             F AGT  VN  L  +GGRVL+ TAL    TE  E AY  VE I ++  + R DIG + 
Sbjct: 361 IVFQAGTKAVNGELFTDGGRVLAVTALADGFTEVIEKAYKGVEKIQFEDFHIRHDIGYKA 420

Query: 414 KER 416
            +R
Sbjct: 421 LQR 423


>gi|303229171|ref|ZP_07315972.1| phosphoribosylamine--glycine ligase [Veillonella atypica
           ACS-134-V-Col7a]
 gi|302516184|gb|EFL58125.1| phosphoribosylamine--glycine ligase [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 420

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/417 (45%), Positives = 269/417 (64%), Gaps = 5/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V +IG+GGREHA+AW+++ SP + +++++PG+  +   A+ V ID  +   +I F ++
Sbjct: 1   MKVCVIGNGGREHAIAWRLSISPSVEKVYAVPGSAAMKNCAELVGIDWSHTDHLIRFLKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G++DAL+ AG  VFGPS+ AA+LE SK FAK    KY IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLVAGLADALHEAGIPVFGPSKAAAQLEGSKVFAKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             FS+  +AKQ++     PIVVKADGL AGKGVVVA TV+EA +A+D       F +  S
Sbjct: 121 GVFSNVDEAKQFIAKTGAPIVVKADGLAAGKGVVVAMTVEEANAAVDDMLSGNRFGEAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE++ G E S  A  DGKT +P   ++DHKRI DGD GPNTGGMG  +PA  ++  
Sbjct: 181 TVVIEEFMAGEEASLLAFVDGKTVVPMIASQDHKRIFDGDKGPNTGGMGTYAPAPVLTDV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++ I+ P +  M KE  P+ G L+AGLMIT +GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LRDEAMKTILEPMVAAMAKEGMPYVGCLYAGLMITNEGPKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E D+ +I+ +C  G L    + WK   A  V++A+KGYPE    G +I        T+ +
Sbjct: 301 EGDLGQIMMACATGTLQPNMVKWKDSSAACVILASKGYPETSSKGDVILGELVQYDTSII 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +  ++   NGGRVL    LGK +  + + AY  V++I +K   +R+DIG +
Sbjct: 361 FHSGTKLEGDHYVTNGGRVLGVVGLGKDLRTALDRAYERVDHITFKGMQYRKDIGAK 417


>gi|218551011|ref|YP_002384802.1| phosphoribosylamine--glycine ligase [Escherichia fergusonii ATCC
           35469]
 gi|218358552|emb|CAQ91200.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia fergusonii ATCC 35469]
          Length = 429

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHLRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P     
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYHTGDVIHGLPLAEVE 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|308172538|ref|YP_003919243.1| phosphoribosylglycinamide synthetase [Bacillus amyloliquefaciens
           DSM 7]
 gi|307605402|emb|CBI41773.1| phosphoribosylglycinamide synthetase [Bacillus amyloliquefaciens
           DSM 7]
          Length = 422

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/424 (44%), Positives = 267/424 (62%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREH LAWK AQSPL   +++ PGN G+A  A  V+I+  +H+ +I F +E
Sbjct: 1   MNVLIIGKGGREHTLAWKAAQSPLTDTVYAAPGNDGMADCATLVSIEESDHAGLIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            H+ L ++GPE+PL+ GI+D    AG  VFGPS++AA +E SK FAK    KYGIPTA Y
Sbjct: 61  HHVGLTIIGPEVPLIEGIADDFEKAGLLVFGPSEQAAIIEGSKQFAKDLMKKYGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
           + F+   +AK YVQ K  PIV+KADGL AGKGV VA T +EA   +     D  F + ++
Sbjct: 121 ETFTSFEEAKAYVQQKGAPIVIKADGLAAGKGVTVAMTEEEAIECLHDFLEDEKFGEASA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           +V+IEE+L G E S  A   G+T  P   A+DHKR  DGD GPNTGGMGA SP   +S +
Sbjct: 181 SVVIEEFLAGEEFSLMAFVKGETVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPHISDD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +  + ++ I+ P  + M KE   F GVL+AGL++TE G  +IE+N RFGDPE Q ++ R+
Sbjct: 241 IVKSAVETIVKPAAKAMVKEGRSFTGVLYAGLILTENGSKVIEFNARFGDPETQVVVPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD++++L   +H    +  + WK   A++VV+A++GYPE Y  GT I  +        +
Sbjct: 301 ESDLIQVLLDLLHEK--DVDLRWKDTAAVSVVLASEGYPEGYAKGTPIGSLTSAEDGIAV 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT    +    NGGRV + TA  +T  E+R+  Y  V  +     ++R DIG++  +
Sbjct: 359 FHAGTKKDGDQFVTNGGRVANVTAFAETFEEARDKVYSAVSGLTKPGLFYRSDIGVRALK 418

Query: 416 RNVK 419
            +++
Sbjct: 419 ASLR 422


>gi|167464341|ref|ZP_02329430.1| phosphoribosylamine--glycine ligase [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381568|ref|ZP_08055542.1| phosphoribosylamine--glycine ligase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154462|gb|EFX46764.1| phosphoribosylamine--glycine ligase-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 426

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/414 (46%), Positives = 264/414 (63%), Gaps = 6/414 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL+IG GGREHAL W +++SP +++L+  PGN GIA  A+CV I+    + I  F Q+
Sbjct: 1   MRVLMIGRGGREHALLWSLSKSPKITKLFCAPGNGGIASLAECVPIEEMEFARIAEFSQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDLV V P+  LV G+ D L   G + +GP +RAA +E SK+F K    KYGIPTA Y
Sbjct: 61  EKIDLVFVSPDDSLVGGLVDYLEERGVRAYGPDRRAALIEGSKAFTKDLMHKYGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQINS 175
           + F D  +A  YV+ + +PIVVKADGL AGKGV+VA T +EA  AI     D  F Q  S
Sbjct: 121 RTFEDAEEALSYVRTQPLPIVVKADGLAAGKGVIVARTREEAEQAIRHMMIDGAFGQSGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E+S  A  DG T  P   ++DHK + DG+ GPNTGGMG  SP   + + 
Sbjct: 181 QVVIEEFLEGEEMSLLAFVDGSTVRPMVPSQDHKPVFDGNRGPNTGGMGTYSPVPHIPES 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
                ++ I+ P  + M KE  PF+GVL+AGL++TEQG   IE+N RFGDPE Q ++ RL
Sbjct: 241 AVDEAVRNILQPAADAMVKEGRPFRGVLYAGLIVTEQGVKTIEFNARFGDPETQVILPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+L+I+ + + G L +  I W  + A+ V++A++GYP  YP G IIS        T +
Sbjct: 301 ETDLLDIIEATLEGRLVDVEIRWSKQSAVCVILASEGYPGSYPKGRIISG-ADKVQETLV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
           FHAGTA+   +L   GGRVL  TALG ++ E+R+ AY     I ++  ++R DI
Sbjct: 360 FHAGTALQAGHLVTGGGRVLGITALGDSMEEARKNAYRQAGYISFEGMHYRTDI 413


>gi|22124416|ref|NP_667839.1| phosphoribosylamine--glycine ligase [Yersinia pestis KIM 10]
 gi|45442846|ref|NP_994385.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|21957200|gb|AAM84090.1|AE013651_3 phosphoribosylglycinamide synthetase [Yersinia pestis KIM 10]
 gi|45437712|gb|AAS63262.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 436

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/426 (44%), Positives = 274/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 9   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 68

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 69  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 128

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T +EA +A++       F   
Sbjct: 129 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDA 188

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 189 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 248

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 249 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 308

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 309 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 368

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N+ +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 369 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 428

Query: 411 LQKKER 416
            +   R
Sbjct: 429 YRAIAR 434


>gi|331006289|ref|ZP_08329606.1| Phosphoribosylamine-glycine ligase [gamma proteobacterium IMCC1989]
 gi|330419910|gb|EGG94259.1| Phosphoribosylamine-glycine ligase [gamma proteobacterium IMCC1989]
          Length = 430

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/425 (45%), Positives = 267/425 (62%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK AQS  + +++  PGN G A  +  + +AID     A+  F 
Sbjct: 1   MNVLVIGSGGREHALAWKAAQSAGVEKVFVAPGNAGTALEEKLENIAIDTMAFEALADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              ++ L +VGPE PLV G+ D   +   K FGPSQ AA+LE SKSF K F  ++ IPT 
Sbjct: 61  AANNVGLTIVGPEAPLVEGVVDYFQSRQLKCFGPSQGAAQLEGSKSFTKDFLERHNIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ F+D   A  Y+Q K  PIV+KADGL AGKGV+VA T+ +A  A+        F   
Sbjct: 121 DYQTFTDESLALAYLQEKGAPIVIKADGLAAGKGVIVAETLGQAEDAVKDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DGK ++   T++DHKR  +GD+GPNTGGMGA SPA  ++
Sbjct: 181 GCKVVIEEFLVGEEASFIVMVDGKNSLAMATSQDHKRASNGDLGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E N + G L+AGLMI E G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHQRIMKEVIEPTVAGMAAEGNDYTGFLYAGLMIAEDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD+  +  S + G L      W +  A+ VV+A  GYP  Y  G +IS +P ++  
Sbjct: 301 LRLQSDLASLCLSALDGKLDQCTTKWDSRPAVGVVLAAGGYPNSYRKGDVISGLPTEDNM 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           ++++FHAGT + N  +  NGGRVL ATALG  +TE++  AY +   I W   Y+R+DI  
Sbjct: 361 SSKVFHAGTVMNNEQVQTNGGRVLCATALGNNVTEAQANAYKLTHAIAWDDVYYRDDIAY 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAIER 425


>gi|303253251|ref|ZP_07339400.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248196|ref|ZP_07530224.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|302647933|gb|EFL78140.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855373|gb|EFM87548.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 428

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEDIKNVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPPQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++    + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQVLKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAVAR 425


>gi|299066209|emb|CBJ37393.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Ralstonia
           solanacearum CMR15]
          Length = 422

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/422 (44%), Positives = 265/422 (62%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V+++GSGGREHALAWK+A+SP +  ++  PGN G A   +   + I +   +  F + 
Sbjct: 1   MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNVPITDPEVLAAFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   VVGPE PL  GI D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVHFTVVGPEAPLAAGIVDLFRAKGLRIFGPTRAAAQLESSKDFAKAFMHRHGIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQ-----QINS 175
           Q F +  +A  YV  +  PIV+KADGL AGKGVVVA T++EA  AID            +
Sbjct: 121 QTFGNAAEAHAYVDREGAPIVIKADGLAAGKGVVVAMTLEEAHGAIDMMLADNRLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  +CDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVVCDGKDVVAMATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPTI GM+K+  P+ G L+AGLMI   G P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVLREIILPTIRGMEKDGIPYTGFLYAGLMIDADGIPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           +++D+ ++L+  + G L    ++W    AL VV+A   YP+    G +I+ IP+ T  + 
Sbjct: 301 MKTDLFDVLDRAIDGKLDGMELDWDRRTALGVVMAAHNYPDTPRKGDVITGIPKETEDSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT NGGRVL    L  T+  ++  AY  VE I +    +R+DIG +  
Sbjct: 361 TFHAGTTLKDGTLTTNGGRVLCVVGLADTVKAAQRAAYGAVEQIRFDGAQYRKDIGHRAI 420

Query: 415 ER 416
            R
Sbjct: 421 RR 422


>gi|119468078|ref|ZP_01611204.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Alteromonadales bacterium TW-7]
 gi|119448071|gb|EAW29335.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Alteromonadales bacterium TW-7]
          Length = 427

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/425 (45%), Positives = 272/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQ+  ++ ++  PGN G A   +   VAI++++   ++ F 
Sbjct: 1   MNVLVIGSGGREHALAFKAAQNSKVNTVFVAPGNAGTALEPKLENVAINVEDLDGLLKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ +++L +VGPE+PLV G+ D        +FGP+  AA+LE SKSF K F  ++ IPTA
Sbjct: 61  QQNNVELTIVGPEVPLVLGVVDKFREHDMAIFGPTAGAAQLEGSKSFTKDFLARHDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ F     A  Y++ K  PIV+KADGL AGKGV+VA T  EA  AI        F   
Sbjct: 121 DYQTFEQIDPALAYLKEKGAPIVIKADGLAAGKGVIVAMTHQEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DGK  +PF T++DHKR ++GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGDAGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT+EGM  E +P+ G L+AGLMI   G P +IEYN RFGDPE Q MM
Sbjct: 241 NEIHQRIMDEVITPTVEGMASEGHPYTGFLYAGLMIDSSGTPKVIEYNCRFGDPETQPMM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E++ +     L  T I +    A+ VV+A KGYP +YP G  IS +  N   
Sbjct: 301 LRLQSDLVELIEAANREELDKTTIEFDPRAAVGVVLAAKGYPGDYPKGDAISGLKVNYPA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    +++   GGRVL ATALG ++TE+++ AY +V+ I W    +R DI  
Sbjct: 361 DEKVFHAGTKQSGDDVVTAGGRVLCATALGNSVTEAQQRAYELVKQISWDGMEYRTDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|145636982|ref|ZP_01792646.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittHH]
 gi|145269840|gb|EDK09779.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittHH]
          Length = 429

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/428 (45%), Positives = 274/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P++   
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDLRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNVK 419
           +  ER ++
Sbjct: 421 RAVERELQ 428


>gi|299769485|ref|YP_003731511.1| phosphoribosylamine--glycine ligase [Acinetobacter sp. DR1]
 gi|298699573|gb|ADI90138.1| phosphoribosylamine--glycine ligase [Acinetobacter sp. DR1]
          Length = 427

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 283/425 (66%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAI--DIQNHSAIIHFC 58
           M +L++GSGGREHALAWKIAQ   +++++  PGN G A   +CV +  DI ++SAII F 
Sbjct: 1   MNILVLGSGGREHALAWKIAQDTNVTQVFVAPGNAGTATEDKCVNVQLDILDNSAIIAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E ++DL++VGPE PLVNG+ DA   AG K++GP+Q AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  KENNVDLIIVGPEAPLVNGVVDAAREAGLKIWGPTQYAAQLEGSKAFAKHFLKRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y  F++   AK YV+    PIV+KADGL AGKGV+VA T +EA +AID       F   
Sbjct: 121 FYDVFTEVDAAKAYVEKNGAPIVIKADGLAAGKGVIVAMTNEEAFAAIDDMLAGNKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IE++L G E SF  + DGK  +P  T++DHKRI +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEQFLAGEEASFICMIDGKNILPMATSQDHKRIFEGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ +I+ PT++GM  + + + G L+AGLMI EQG P +IE+N RFGDPE Q +M
Sbjct: 241 SDIFERVMTEIMRPTVDGMAADGHVYTGFLYAGLMIDEQGQPRVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+S ++E++ + + GNL      W    ++ +V+A +GYP+    G +IS I Q+   
Sbjct: 301 MRLKSSLVELVEAGIAGNLPK-EAEWDERKSIGIVLAAEGYPDSVRKGDVISGIGQSPED 359

Query: 353 TQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           T++FHAGTA   + ++  +GGRVL  TALG ++ E++  A  +   + +    +R DIG 
Sbjct: 360 TKIFHAGTATREDGHIVTSGGRVLCVTALGDSVLEAQINALEVCGQVTFTGMQYRNDIGY 419

Query: 412 QKKER 416
           +   R
Sbjct: 420 RAIAR 424


>gi|256026321|ref|ZP_05440186.1| phosphoribosylamine--glycine ligase [Escherichia sp. 4_1_40B]
          Length = 429

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 277/426 (65%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK  QSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAVQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +QG P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKER 416
            +  ER
Sbjct: 421 WRAIER 426


>gi|162418161|ref|YP_001605069.1| phosphoribosylamine--glycine ligase [Yersinia pestis Angola]
 gi|162350976|gb|ABX84924.1| phosphoribosylamine--glycine ligase [Yersinia pestis Angola]
          Length = 428

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/426 (44%), Positives = 273/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A       +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T +EA +A++       F   
Sbjct: 121 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGGNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N+ +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|153938611|ref|YP_001392155.1| phosphoribosylamine--glycine ligase [Clostridium botulinum F str.
           Langeland]
 gi|152934507|gb|ABS40005.1| phosphoribosylamine--glycine ligase [Clostridium botulinum F str.
           Langeland]
 gi|295320160|gb|ADG00538.1| phosphoribosylamine--glycine ligase [Clostridium botulinum F str.
           230613]
          Length = 413

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/415 (42%), Positives = 279/415 (67%), Gaps = 8/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHA+AWKI ++ L+ +++  PGN   A   +C  I++ +   ++ F  +
Sbjct: 1   MKILIIGSGGREHAIAWKIGKNTLVEKIFCAPGNGCTALEHKCENINVSSDEELLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            ++DL +VGPE+PL++GI D     G  +FGP ++AA LE SK+FAK F  KY I TA Y
Sbjct: 61  NNVDLTIVGPEVPLMDGIVDLFKDKGLNIFGPDKKAALLEGSKAFAKDFMKKYNIKTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F +  KA +Y++N   P+V+KADGL AGKGVV++ + +E+ S ++       F+    
Sbjct: 121 EVFEEESKALEYLKNSEHPVVIKADGLAAGKGVVISNSFEESKSTLEEFMAKDKFKGAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S  ++ DG+T IPF +++DHK+I+DG +GPNTGGMG  +P    ++E
Sbjct: 181 KVVIEEFLEGPEASILSITDGETIIPFISSKDHKQIYDGGLGPNTGGMGVIAPNPYCTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I+ PT++G+QKE   F G++F G+MIT++GPYL+EYN+R GDPE +A++  +
Sbjct: 241 VLKDFNENILKPTLKGLQKENLKFSGIIFFGIMITKKGPYLLEYNLRMGDPETEAVLPLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD+L+++   ++  L +T+I WK  Y+  V+ A+KGYPE Y  G +I+ +  + G   +
Sbjct: 301 ESDLLDLILMSINKELKSTNIKWKKAYSTCVIAASKGYPESYEKGFLINGVENSEG---I 357

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           F AG  + +N L  NGGRVL   A+G+T+ +S   AY  +E I+++  Y+R+DIG
Sbjct: 358 FGAGVKLKDNRLLTNGGRVLCTQAIGETLEQSINTAYEKMEKINFEGIYYRKDIG 412


>gi|242241104|ref|YP_002989285.1| phosphoribosylamine--glycine ligase [Dickeya dadantii Ech703]
 gi|242133161|gb|ACS87463.1| phosphoribosylamine/glycine ligase [Dickeya dadantii Ech703]
          Length = 428

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 276/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + + I   +  A+++F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENIHIPATDIPALLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LQNDIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A         F   
Sbjct: 121 EYQNFTEIEPALAYIRRKGAPIVIKADGLAAGKGVIVAMTLEEAENAATDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDNDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+++II PT+ GM  E N + G L+AGLMI+ +G P +IE+N RFGDPE Q +M
Sbjct: 241 DDIHQRVMEQIIWPTVRGMASEGNIYTGFLYAGLMISAEGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL SD++E+  +   G L     +W    +L +V+A  GYP EY  G +IS +P Q+  
Sbjct: 301 LRLRSDLVELCLAACDGKLDEKTSDWDERPSLGIVLAAGGYPAEYRTGDVISGLPTQDMA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++  NGGRVL  TALG ++ ++++ AY +   I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLNGDDVVTNGGRVLCVTALGNSVAQAQQRAYELANPIKWQGSFCRTDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIDR 425


>gi|295691203|ref|YP_003594896.1| phosphoribosylamine/glycine ligase [Caulobacter segnis ATCC 21756]
 gi|295433106|gb|ADG12278.1| phosphoribosylamine/glycine ligase [Caulobacter segnis ATCC 21756]
          Length = 427

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 202/417 (48%), Positives = 270/417 (64%), Gaps = 7/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           + +LL+GSGGREHALAWKIAQSPL   L + PGNPGI + A+  A+   +   ++   QE
Sbjct: 4   LTILLVGSGGREHALAWKIAQSPLCGRLVAAPGNPGIGKVAELKAVKATDADGLVALAQE 63

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
              DLVVVGPE  L  G++D L   G   FG SQRAA+LE+SK+F K FC ++G+PTA Y
Sbjct: 64  IGADLVVVGPESALEVGLADKLAQVGIPCFGGSQRAAQLETSKAFTKDFCQRHGLPTAAY 123

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI----DRCFQQINST 176
             F +   A  ++     P V+KADGL AGKGVV+AAT  EA +A+       F    + 
Sbjct: 124 GVFENAASAGAFLDTLEAPFVIKADGLAAGKGVVIAATRAEADAAVLDMLGGRFGSAGAR 183

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E S FA+CDGKTA+ F  A+DHKR +DGD GPNTGGMG  SP   ++Q L
Sbjct: 184 VVIEEFMHGEEASLFAVCDGKTAVLFGAAQDHKRAYDGDEGPNTGGMGTYSPPPVLTQAL 243

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
                +++I+PT+EGM  E NP+ GVL+AGLM+T  GP L+EYN RFGDPECQ +M+RL+
Sbjct: 244 IDQAWRELIVPTVEGMAAEGNPYVGVLYAGLMLTSTGPKLVEYNARFGDPECQTLMLRLQ 303

Query: 297 SDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TGTTQ 354
           SDI+ IL +   G L +     W+ E A+ VV+A +GYP+    G  I     +  G   
Sbjct: 304 SDIVPILLAAAKGELASAEPPKWRDEAAICVVLAAEGYPDSPKTGGRIQGADADFGGEVV 363

Query: 355 LFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGT       L A+GGRVL+  ALG T++E+R+LAY  + +I  + G++R DIG
Sbjct: 364 VFHAGTTREFEGRLVASGGRVLNVCALGVTLSEARDLAYAALGSISLEGGFYRRDIG 420


>gi|304399316|ref|ZP_07381181.1| phosphoribosylamine/glycine ligase [Pantoea sp. aB]
 gi|304353172|gb|EFM17554.1| phosphoribosylamine/glycine ligase [Pantoea sp. aB]
          Length = 426

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 267/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q +AI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNIAISATDVPALLEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QREKIDLTIVGPEAPLVIGVVDAFRKAGLAIFGPTQAAAQLEGSKAFTKDFLARHQIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 AYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+LEG E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMIDHTGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    AL VV+A  GYP +Y  G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAACDGKLDQKTSQWDPRPALGVVLAAGGYPGDYAQGDQIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL  TALG  +  +++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLEEDRVLTNGGRVLCVTALGDDVAAAQKRAYELTKPISWQGSFCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRK 426


>gi|262279578|ref|ZP_06057363.1| phosphoribosylamine-glycine ligase [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259929|gb|EEY78662.1| phosphoribosylamine-glycine ligase [Acinetobacter calcoaceticus
           RUH2202]
          Length = 427

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 283/425 (66%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L++GSGGREHALAWKIAQ   +++++  PGN G A   +C  V +DI ++ AII F 
Sbjct: 1   MNILVLGSGGREHALAWKIAQDTNVTQVFVAPGNAGTATEDKCLNVQLDILDNPAIIAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E ++DL++VGPE PLVNG+ DA   AG K++GP+Q AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  KENNVDLIIVGPEAPLVNGVVDAAREAGLKIWGPTQYAAQLEGSKAFAKHFLKRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y  F++   AK YV+    PIV+KADGL AGKGV+VA T +EA +AID       F   
Sbjct: 121 FYDVFTEVDAAKAYVEKNGAPIVIKADGLAAGKGVIVAMTNEEAFAAIDDMLAGNKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IE++L G E SF  + DGK  +P  T++DHKRI +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEQFLAGEEASFICMIDGKNILPMATSQDHKRIFEGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ +I+ PT+EGM  + + + G L+AGLMI EQG P +IE+N RFGDPE Q +M
Sbjct: 241 SDIFERVMSEIMHPTVEGMAADGHVYTGFLYAGLMIDEQGQPRVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+S ++E++ + + GNL      W    ++ +V+A +GYP+    G +IS I Q+   
Sbjct: 301 MRLKSSLVELVEAGIAGNLPK-EAEWDERKSIGIVLAAEGYPDSVRKGDVISGIGQSPED 359

Query: 353 TQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           T++FHAGTA   + ++  +GGRVL  TALG ++ E++  A  +   +++    +R DIG 
Sbjct: 360 TKIFHAGTATREDGHIVTSGGRVLCVTALGDSVLEAQINALEVCGQVNFTGMQYRSDIGY 419

Query: 412 QKKER 416
           +   R
Sbjct: 420 RAIAR 424


>gi|119946825|ref|YP_944505.1| phosphoribosylamine--glycine ligase [Psychromonas ingrahamii 37]
 gi|119865429|gb|ABM04906.1| phosphoribosylamine--glycine ligase [Psychromonas ingrahamii 37]
          Length = 429

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/428 (44%), Positives = 274/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ+  +  ++  PGN G A  A+   VAID+++   ++ F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQNKQVKNIFVAPGNAGTALEAKVTNVAIDVEDIDGLVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  ++L +VGPE PLV G+ DA   AG   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENRVELTIVGPEAPLVIGVVDAFTDAGLACFGPTKGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T+ +A  AI        F   
Sbjct: 121 WYQNFTEIEPAIAYVREKGAPIVIKADGLAAGKGVIVAMTLADAEEAIHDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGENIVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  ++  +I PT++GM  E N + G L+AGLMI   G P +IEYN RFGDPE Q ++
Sbjct: 241 PEMHQRIMDLVINPTVKGMAAEGNSYSGFLYAGLMIMADGTPKVIEYNCRFGDPETQPLL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++ +  + V+G L +    +    A+ +V+A  GYP EY  G +I  +P Q   
Sbjct: 301 LRMKSDLVTLCLAGVNGELADMTAEFDQRAAIGIVLAAGGYPNEYKKGLVIEGLPDQEME 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FH GT  V+  +  NGGRVL ATALG T+TE+++ AY + + I W   ++R DI  
Sbjct: 361 GLKVFHGGTKEVDGQIVTNGGRVLCATALGNTVTEAQQKAYALAKTISWDGMFYRHDIAH 420

Query: 412 QKKERNVK 419
           +   R  K
Sbjct: 421 RAIAREQK 428


>gi|148380830|ref|YP_001255371.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A str.
           ATCC 3502]
 gi|153933680|ref|YP_001385136.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A str.
           ATCC 19397]
 gi|153935859|ref|YP_001388605.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A str.
           Hall]
 gi|148290314|emb|CAL84438.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A str.
           ATCC 3502]
 gi|152929724|gb|ABS35224.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A str.
           ATCC 19397]
 gi|152931773|gb|ABS37272.1| phosphoribosylamine--glycine ligase [Clostridium botulinum A str.
           Hall]
          Length = 413

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 279/415 (67%), Gaps = 8/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHA+AWKI ++ L+ +++  PGN   A   +C  I+I ++  ++ F  +
Sbjct: 1   MKILIIGSGGREHAIAWKIGKNTLVEKIFCAPGNGCTALEHKCENINISSNEELLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +++DL +VGPE+PL+ GI D     G  +FGP ++AA LE SK+FAK F  KY I TA Y
Sbjct: 61  RNVDLTIVGPEVPLMEGIVDLFKDKGLNIFGPDKKAALLEGSKAFAKDFMKKYNIKTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F +  KA +Y++N   P+V+KADGL AGKGVV++ + +E+ S ++       F+    
Sbjct: 121 EVFEEESKALEYLKNSKHPVVIKADGLAAGKGVVISNSFEESKSTLEEFMAKDKFKGAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S  ++ DG+T IPF +++DHK+I+DG +GPNTGGMG  +P    ++E
Sbjct: 181 KVVIEEFLEGPEASILSITDGETIIPFISSKDHKQIYDGGLGPNTGGMGVIAPNPYCTKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I+ PT++G+QKE   F G++F G+MIT++GPYL+EYN+R GDPE +A++  +
Sbjct: 241 VLEDFNENILKPTLKGIQKENLKFSGIIFFGIMITKKGPYLLEYNLRMGDPETEAVLPLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+L ++   ++  L NT+I WK  Y+  V+ A+KGYPE Y  G +I+ +  + G   +
Sbjct: 301 DSDLLNLILMSINKELKNTNIKWKKAYSTCVMAASKGYPESYEKGFLINGVENSEG---I 357

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           F AG  + +N L  NGGRVL   A+G+T+ +S   AY  +E I+++  Y+R+DIG
Sbjct: 358 FGAGVRLKDNRLLTNGGRVLCTQAIGETLEQSINTAYEKMEKINFEGIYYRKDIG 412


>gi|170755490|ref|YP_001782511.1| phosphoribosylamine--glycine ligase [Clostridium botulinum B1 str.
           Okra]
 gi|169120702|gb|ACA44538.1| phosphoribosylamine--glycine ligase [Clostridium botulinum B1 str.
           Okra]
          Length = 413

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/415 (42%), Positives = 278/415 (66%), Gaps = 8/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHA+AWKI ++ L+ +++  PGN   A   +C  I++ +   ++ F  +
Sbjct: 1   MKILIIGSGGREHAIAWKIGKNTLVEKIFCAPGNGCTALEHKCENINVSSDEELLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            ++DL +VGPE+PL+NGI D     G  +FGP ++AA LE SK+FAK F  KY I TA Y
Sbjct: 61  NNVDLTIVGPEVPLINGIVDLFKDKGLNIFGPDKKAALLEGSKAFAKDFMKKYNIKTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F +  KA +Y++N   P+V+KADGL AGKGVV++ + +E+ S ++       F+    
Sbjct: 121 EVFEEESKALEYLKNSEHPVVIKADGLAAGKGVVISNSFEESKSTLEEFMAKDKFKGAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S  ++ DG+T  PF +++DHK+I+DG +GPNTGGMG  +P    ++E
Sbjct: 181 KVVIEEFLEGPEASILSITDGETIRPFISSKDHKQIYDGGLGPNTGGMGVIAPNPYCTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I+ PT++G+QKE   F G++F G+MIT++GPYL+EYN+R GDPE +A++  +
Sbjct: 241 VLKDFNENILKPTLKGLQKENLKFSGIIFFGIMITKKGPYLLEYNLRMGDPETEAVLPLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD+L+++   ++  L +T+I WK  Y+  V+ A+KGYPE Y  G +I+ +  + G   +
Sbjct: 301 ESDLLDLILMSINKELKSTNIKWKKAYSTCVIAASKGYPESYEKGFLINGVENSEG---I 357

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           F AG  + +N L  NGGRVL   A+G+T+ +S   AY  +E I+++  Y+R+DIG
Sbjct: 358 FGAGVKLKDNRLLTNGGRVLCTQAIGETLEQSINTAYEKMEKINFEGIYYRKDIG 412


>gi|308188922|ref|YP_003933053.1| phosphoribosylamine--glycine ligase [Pantoea vagans C9-1]
 gi|308059432|gb|ADO11604.1| phosphoribosylamine--glycine ligase [Pantoea vagans C9-1]
          Length = 426

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 192/426 (45%), Positives = 267/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNVAIGATDIPALLEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QREKIDLTIVGPEAPLVIGVVDAFREAGLAIFGPTQAAAQLEGSKAFTKDFLARHQIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 AYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMIDHTGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    AL VV+A  GYP +Y  G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAACDGKLDQKTSQWDPRPALGVVLAAGGYPGDYAQGDQIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL  TALG  +  +++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLEEDRVLTNGGRVLCVTALGDDVAAAQKRAYELTKPISWQGSFCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRK 426


>gi|114773263|ref|ZP_01450498.1| phosphoribosylamine--glycine ligase [alpha proteobacterium
           HTCC2255]
 gi|114546382|gb|EAU49291.1| phosphoribosylamine--glycine ligase [alpha proteobacterium
           HTCC2255]
          Length = 428

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/425 (46%), Positives = 272/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQ--NHSAIIHFC 58
           M+VL+IGSGGREHALAWK AQ   +++++  PGN G A  A    +DI   + + ++ F 
Sbjct: 1   MQVLVIGSGGREHALAWKAAQCADVTKVFVAPGNAGTATEANLENVDISVGDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I+L +VGPE PLV+G+ DA NAAG   FGP+  AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QNNAIELTIVGPEQPLVDGVVDAFNAAGLACFGPTAAAAQLEGSKAFTKDFLARHNIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            YQ+F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F + 
Sbjct: 121 AYQNFTEIEPAIAYVREKGAPIVVKADGLAAGKGVIVAMTLVEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK    F T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNIASFATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  ++Q++I PT+ GM  E N + G L+AGLMIT  G P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHDRIMQEVIEPTVAGMASEGNDYTGFLYAGLMITADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MRL+SD++ +      G L +T I + +  A+ VV+A  GYP  Y  G  IS +    + 
Sbjct: 301 MRLQSDLVALCLKATQGELADTVIEFDSRPAVGVVLAAGGYPGSYAKGIEISGLGTGESD 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  N ++   GGRVL ATALG+++T++++ AY + + I W   + R DI  
Sbjct: 361 DAKVFHAGTASHNGSVVTAGGRVLCATALGESVTQAQQSAYQLAKTISWDGMFHRNDIAY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|89094588|ref|ZP_01167526.1| phosphoribosylamine--glycine ligase [Oceanospirillum sp. MED92]
 gi|89081187|gb|EAR60421.1| phosphoribosylamine--glycine ligase [Oceanospirillum sp. MED92]
          Length = 427

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 272/424 (64%), Gaps = 8/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAW +A+   +++++  PGN   AQ    Q VAID+ +   +  F 
Sbjct: 1   MNVLVIGSGGREHALAWSVAKDKKVAQVFVAPGNAATAQEDKMQNVAIDVMDLEGLATFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  ++L +VGPE PLV G+ +   A G ++FGP++ AA+LE SK+F K F  +  IPTA
Sbjct: 61  KDNQVELTIVGPEAPLVEGVVNKFQAEGLRIFGPTEGAAQLEGSKAFTKDFLARQQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAID-----RCFQQI 173
            Y++F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYENFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLTEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E S+  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASYIVMVDGDNVLPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+   ++ ++I+PT+ GM+ E N + G L+AGLMI   G P +IEYN RFGDPE Q +M
Sbjct: 241 AEIDQRIMDEVIMPTVNGMKAEGNEYTGFLYAGLMIQADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+S ++++ N+ +   L +T   W    ++ VV+A  GYP  Y  G +IS   +    
Sbjct: 301 LRLKSSLVDLCNAALDKKLADTTAEWDERKSVGVVMAAGGYPGSYGKGDVISFPAECPEG 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           T++FHAGT +   N+   GGRVL  TALG+T+TE+++ AY +++ + W+  Y+R+DI  +
Sbjct: 361 TKIFHAGTKLDGENVVTAGGRVLCVTALGETVTEAQKRAYELLDKVSWEGAYFRKDIAYR 420

Query: 413 KKER 416
              R
Sbjct: 421 AIAR 424


>gi|238794944|ref|ZP_04638541.1| Phosphoribosylamine--glycine ligase [Yersinia intermedia ATCC
           29909]
 gi|238725702|gb|EEQ17259.1| Phosphoribosylamine--glycine ligase [Yersinia intermedia ATCC
           29909]
          Length = 428

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/426 (44%), Positives = 272/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A  +    +DI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLAGKIYVAPGNAGTALESGLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
               I L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LSHDIGLTIVGPEAPLVIGVVDAFRTAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E++  V++ +I PT+ GM  E N + G L+AGLMI+  G P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMESVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NN +  NGGRVL  TALG T+ ++++ AY + ENI W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNNEVVTNGGRVLCVTALGATVAQAQQNAYRLAENIQWEGAFCRKDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|260581716|ref|ZP_05849513.1| phosphoribosylamine-glycine ligase [Haemophilus influenzae NT127]
 gi|260095309|gb|EEW79200.1| phosphoribosylamine-glycine ligase [Haemophilus influenzae NT127]
          Length = 429

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/428 (45%), Positives = 275/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ D    AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDTFRKAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAENAVHDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK      T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSQVVIEEFLDGEEASFIVMVDGKNVESMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            E+YS +++++I PT+ GM +E N + G L+AGLMI   G P +IE+N RFGDPE Q +M
Sbjct: 241 PEIYSRIMREVIYPTVNGMAEEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E+      G L      W  + +L +V+A +GYP++Y  G  IS +P++   
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVTSRWDPQASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNVK 419
           +  ER ++
Sbjct: 421 RAVERELQ 428


>gi|313500802|gb|ADR62168.1| Phosphoribosylamine--glycine ligase [Pseudomonas putida BIRD-1]
          Length = 431

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/425 (44%), Positives = 275/425 (64%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            EK++DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  -EKNVDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAI-----DRCFQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T++EA +A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQG-PYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI + G P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +I+ +      
Sbjct: 300 LRLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVINGLDAAAKI 359

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +T NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTALKDGKVTTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRSDIGY 419

Query: 412 QKKER 416
           +   R
Sbjct: 420 RAIAR 424


>gi|148549900|ref|YP_001270002.1| phosphoribosylamine--glycine ligase [Pseudomonas putida F1]
 gi|148513958|gb|ABQ80818.1| phosphoribosylamine--glycine ligase [Pseudomonas putida F1]
          Length = 430

 Score =  385 b