PSIBLAST alignment of GI: 254780206 and protein with PDB id: 1gso

>gi|6730014|pdb|1GSO|A Chain A, Glycinamide Ribonucleotide Synthetase (Gar-Syn) From E. Coli Length = 431
 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 3   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 62

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 63  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 122

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 123 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 182

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 183 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 242

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGD E Q +M
Sbjct: 243 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDLETQPIM 302

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 303 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 362

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 363 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 422

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 423 WRAIERE 429