PSIBLAST alignment of GI: 254780206 and protein with PDB id: 2czg

gi|88192722|pdb|2CZG|A Chain A, Crystal Structure Of Probable Phosphoribosylglycinamide Formyl Transferase (Ph0318) From Pyrococcus Horikoshii Ot3 Length = 433
>gi|88192723|pdb|2CZG|B Chain B, Crystal Structure Of Probable Phosphoribosylglycinamide Formyl Transferase (Ph0318) From Pyrococcus Horikoshii Ot3 Length = 433
 Score = 56.4 bits (134), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 24/172 (13%), Positives = 64/172 (37%), Gaps = 10/172 (5%)

Query: 2   RVLLIGSG--GREHAL-AWKIAQSPLLSELWS--IPGNPGIAQHAQCVAIDIQNHSAIIH 56
           ++LL+GSG  G+E A+ A ++     +  +        P +    +    ++ +   +  
Sbjct: 21  KILLLGSGELGKEIAIEAQRL----GVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWS 76

Query: 57  FCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP 116
             + +  D ++   E   ++ + +     G+ V   ++        +   +    +  +P
Sbjct: 77  VVEREKPDAIIPEIEAINLDALFE-FEKDGYFVVPNARATWIAMHRERLRETLVKEAKVP 135

Query: 117 TATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR 168
           T+ Y + +   +  +  +    P   KA    +GKG       ++   A + 
Sbjct: 136 TSRYMYATTLDELYEACEKIGYPCHTKAIMSSSGKGSYFVKGPEDIPKAWEE 187