BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780206|ref|YP_003064619.1| phosphoribosylamine--glycine
ligase [Candidatus Liberibacter asiaticus str. psy62]
         (424 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|319789917|ref|YP_004151550.1| phosphoribosylamine/glycine ligase [Thermovibrio ammonificans HB-1]
 gi|317114419|gb|ADU96909.1| phosphoribosylamine/glycine ligase [Thermovibrio ammonificans HB-1]
          Length = 426

 Score =  367 bits (943), Expect = 1e-99,   Method: Composition-based stats.
 Identities = 208/423 (49%), Positives = 286/423 (67%), Gaps = 8/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHALAWK+AQSP + +++  PGNPGIA+  +CV I   +  A+  F Q 
Sbjct: 1   MKVLVVGGGGREHALAWKLAQSPEVEKVYGAPGNPGIAKVGECVPISPTDVKALAEFAQR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I+L VVGPE PLV GI+D     G KVFGPS+ AA+LE SK FAK+   + G+PTA +
Sbjct: 61  EGIELTVVGPEAPLVAGITDEFQKKGLKVFGPSKEAARLEGSKVFAKEIMRELGVPTAPF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
             F DP KAK++++ K  PIVVKADGL AGKGVVVA TV+EA        + + F +  +
Sbjct: 121 WVFEDPNKAKEFIKEKGAPIVVKADGLAAGKGVVVAQTVEEALEAVERIMVQKVFGEAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE L+G EVS+  + DG+  IP   A+DHK + DGD GPNTGGMGA SPA  MS+E
Sbjct: 181 RIVVEECLKGEEVSYLVVTDGERYIPLEPAQDHKAVFDGDRGPNTGGMGAYSPAPVMSKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V +++I P ++GM++   PF+GVL+AGLMITE GP ++E+NVRFGDPE Q +M RL
Sbjct: 241 LEAEVQKRVIEPILKGMRERGTPFRGVLYAGLMITESGPQVLEFNVRFGDPEAQTLMRRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           ESD+ ++  S   G L    + W  E ++ VV+A+KGYP +Y  G +I+ + +       
Sbjct: 301 ESDLAQVCLSAAEGRL-VEELRWSPETSICVVLASKGYPGKYEKGKVITGVEEAEKEPSV 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT + N  L  NGGRVL+ TALGK I E+RE  Y  +E I ++  ++R DIGL+ 
Sbjct: 360 VVFHAGTKLENGKLVTNGGRVLNVTALGKDIVEARERVYRAIEKIHFEGMHYRRDIGLKA 419

Query: 414 KER 416
            +R
Sbjct: 420 VKR 422


>gi|239831286|ref|ZP_04679615.1| phosphoribosylamine--glycine ligase [Ochrobactrum intermedium LMG
           3301]
 gi|239823553|gb|EEQ95121.1| phosphoribosylamine--glycine ligase [Ochrobactrum intermedium LMG
           3301]
          Length = 438

 Score =  364 bits (934), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 224/423 (52%), Positives = 294/423 (69%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+ V I   +H A+I F ++
Sbjct: 12  MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIATVAELVDISADDHKALIAFAKD 71

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV G+SD +   G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 72  KKIDLVVVGPEAPLVAGLSDEMRTEGIRVFGPSKAAAQLEGSKGFTKDLCARFDIPTGAY 131

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+DEA  A+D C    F    + 
Sbjct: 132 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLDEALDAVDACFEGAFGSAGAE 191

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+QE+
Sbjct: 192 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTQEI 251

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               ++++I PT+ GM +   PF G+LF GLMI + GP LIEYN RFGDPECQ +MMRL 
Sbjct: 252 VERTMRELIEPTMRGMAEIGAPFSGILFLGLMIGKDGPKLIEYNTRFGDPECQVLMMRLN 311

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD+L ++N+ V G L    + WK + ALTVV+A +GYP     G++I  + +       +
Sbjct: 312 SDLLALINAAVDGKLDEVSLGWKDQPALTVVMAAEGYPSNVKKGSVIRGLDKLEGIDGVK 371

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  + N+ ANGGRVL+ TA+  T+ E++  AY  V+ IDW  G++R DIG +  
Sbjct: 372 VFHAGTAQKDGNIIANGGRVLNVTAIAGTVAEAQARAYEAVKRIDWPEGFYRSDIGWRAV 431

Query: 415 ERN 417
           ER 
Sbjct: 432 ERE 434


>gi|159184405|ref|NP_353670.2| phosphoribosylamine--glycine ligase [Agrobacterium tumefaciens str.
           C58]
 gi|25091083|sp|Q8UHN3|PUR2_AGRT5 RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|159139718|gb|AAK86455.2| phosphoribosylamine--glycine ligase [Agrobacterium tumefaciens str.
           C58]
          Length = 423

 Score =  362 bits (930), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 230/421 (54%), Positives = 295/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSPL+  L++ PGNPGIA HA  V++D+++H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPLIDALYAAPGNPGIADHATLVSLDVEDHAAVIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VV+GPE PLV G++D L AAG   FGPS+ AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVIGPEAPLVAGLADDLRAAGIATFGPSKAAAQLEGSKGFTKDLCARYDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + F     AK YV+ +  PIV+KADGL AGKGV VA T  EA +AID CF        + 
Sbjct: 121 ERFKAAEPAKDYVRAQGAPIVIKADGLAAGKGVTVAMTEAEALAAIDDCFDGAFGTAGTE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +L+G E SFF L DGKTA+   TA+DHKR+ DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEAFLDGEEASFFCLSDGKTALALATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPAM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM K+ NPF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTISGMAKDGNPFSGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L IL +   G L      W+ + ALTVV+A+KGYP  Y   T I+ IP+ +   ++F
Sbjct: 301 SDLLPILYATATGTLDKVQAEWRDDAALTVVLASKGYPGAYDKNTPIAHIPEASEEAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ +  L A GGRVL+ TA G+ +TE++  AY + + ++W++G+ R DIG Q   R
Sbjct: 361 HAGTALKDGKLVATGGRVLNVTAFGRNVTEAQARAYALADKVEWENGFCRRDIGWQAIAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|153007874|ref|YP_001369089.1| phosphoribosylamine--glycine ligase [Ochrobactrum anthropi ATCC
           49188]
 gi|151559762|gb|ABS13260.1| phosphoribosylamine--glycine ligase [Ochrobactrum anthropi ATCC
           49188]
          Length = 429

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 222/429 (51%), Positives = 298/429 (69%), Gaps = 6/429 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVLLIGSGGREHALAWK++ SP L++L+  PGNPGIA  A+ V I + +H A+I F ++
Sbjct: 1   MRVLLIGSGGREHALAWKLSASPSLTKLYCAPGNPGIATIAELVDIGVDDHQALIAFAKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV G+SD + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KKIDLVVVGPEAPLVAGLSDEMRAEGIRVFGPSKAAAQLEGSKGFTKDLCARFDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGV+VA T+DEA  A+D C    F    + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVIVAMTLDEALDAVDACFEGAFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               ++++I PT+ GM +   PF G+LF GLMI + GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VERTMRELIEPTMRGMAEIGAPFSGILFLGLMIGKDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD+L ++N+ V G L    ++WK + ALTVV+A +GYP     G++I  + +       +
Sbjct: 301 SDLLALINAAVDGKLDEVSLDWKNQPALTVVMAAEGYPSNVKKGSVIRDLDKLEGIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA  + ++ A+GGRVL+ TA+  T+ E++  AY  V+ IDW  G++R DIG +  
Sbjct: 361 LFHAGTAEKDGSIVASGGRVLNITAIADTVAEAQARAYEAVKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERNVKYRNK 423
           ER  +   K
Sbjct: 421 ERETQADKK 429


>gi|190890598|ref|YP_001977140.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli CIAT
           652]
 gi|218517166|ref|ZP_03514006.1| phosphoribosylamine--glycine ligase [Rhizobium etli 8C-3]
 gi|190695877|gb|ACE89962.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli CIAT
           652]
          Length = 423

 Score =  361 bits (927), Expect = 9e-98,   Method: Composition-based stats.
 Identities = 234/421 (55%), Positives = 298/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLLSE ++ PGNPGIA+HA  V I+I +H A+  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLSEFYAAPGNPGIAEHAVLVPINIDDHEAVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF        + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDG+ A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGRHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM +  +PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTIRGMAESGHPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L     +W  + ALTVV+A+KGYP  Y   T I  +PQ     ++F
Sbjct: 301 SDLLPLLLAAANGTLDQVSADWSDDPALTVVMASKGYPGAYEKNTPILSLPQAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+R+ AY +++ + W +G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTATGGTVAEARDRAYALLDKVRWDNGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|222147723|ref|YP_002548680.1| phosphoribosylamine--glycine ligase [Agrobacterium vitis S4]
 gi|221734711|gb|ACM35674.1| phosphoribosylamine--glycine ligase [Agrobacterium vitis S4]
          Length = 426

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 233/421 (55%), Positives = 300/421 (71%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWK+AQSPL+   ++ PGNPGIA+HA+ V ++I +HSA+I FC++
Sbjct: 1   MNILLIGSGGREHALAWKLAQSPLIGAFYAAPGNPGIAEHAELVNVNIDDHSAVIAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K +D VVVGPE PLV G++DAL AAG  VFGPS  AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KAVDFVVVGPEAPLVAGLADALRAAGLTVFGPSAAAAQLEGSKGFTKDVCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK YV+ +  PIV+KADGL AGKGV VA T+DEA SAID CF        + 
Sbjct: 121 QRFNNAPKAKAYVRQQGAPIVIKADGLAAGKGVTVAMTLDEALSAIDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +L+G E SFF LCDGKT +P  TA+DHKR+ DGD GPNTGGMGA SPA  M+ ++
Sbjct: 181 VVVEAFLDGEEASFFCLCDGKTLLPLATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTSDM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTLREIIEPTMRGMAELGMPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L++C  G L      W  + ALTVV+A+KGYP  +   T I+ IP  +   ++F
Sbjct: 301 SDLLPLLHACASGTLDQVSAEWHDDPALTVVLASKGYPGSFTKNTPIAAIPAASDEAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ +  L A GGRVL+ATA GKT+ E++  AY +   ++W +G+ R DIG Q   R
Sbjct: 361 HAGTALKDGQLIATGGRVLNATARGKTVAEAQAKAYALARQVEWDNGFSRSDIGWQAIAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|227821053|ref|YP_002825023.1| phosphoribosylamine--glycine ligase [Sinorhizobium fredii NGR234]
 gi|227340052|gb|ACP24270.1| phosphoribosylamine--glycine ligase [Sinorhizobium fredii NGR234]
          Length = 423

 Score =  360 bits (924), Expect = 2e-97,   Method: Composition-based stats.
 Identities = 226/421 (53%), Positives = 296/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L+ L++ PGNPGIA+ A  VA+DI +H+A++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPQLTALYAAPGNPGIAEEATIVALDIDDHAAVVDFCRR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID VVVGPE PLV G++DAL AAG   FGPS  AA+LE SK F K  C KY IPT  Y
Sbjct: 61  ESIDFVVVGPEAPLVAGLADALRAAGIATFGPSAAAAQLEGSKGFTKDLCAKYAIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + F++   AK Y++ +  PIV+KADGL AGKGV VA T+DEA +A+D CF        + 
Sbjct: 121 KRFTEAEPAKAYIREQGAPIVIKADGLAAGKGVTVAMTLDEALAAVDECFSGVFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF L DGK  +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEAYLDGEEASFFCLSDGKAVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAGM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +Q+II PT+ GM +   PF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMR++
Sbjct: 241 VERTMQEIIEPTVRGMAESGYPFTGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRMK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L    I W  + ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLYAAATGTLDGKEIEWHDDAALTVVMASRGYPGSYEKNTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTAI +  L A GGRVL+ TA+G T++++++ AY  V  + W++G++R DIG +   R
Sbjct: 361 HAGTAIKDGRLVATGGRVLNVTAMGSTVSDAKDAAYAGVNGVSWENGFYRRDIGWRAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|163761031|ref|ZP_02168109.1| phosphoribosylamine--glycine ligase [Hoeflea phototrophica DFL-43]
 gi|162281812|gb|EDQ32105.1| phosphoribosylamine--glycine ligase [Hoeflea phototrophica DFL-43]
          Length = 426

 Score =  360 bits (923), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 232/422 (54%), Positives = 298/422 (70%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIAQSPLL   ++ PGNPGIA HA+   +D+ +H A+I FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAQSPLLGTFFAAPGNPGIADHAELTGLDVSDHQAVIAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID+VVVGPE PLV G++DALN AG KVFGPS  AA+LE SK F K  C + GIPTA Y
Sbjct: 61  KAIDMVVVGPEAPLVAGLADALNDAGIKVFGPSAAAAQLEGSKGFTKDLCARQGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F++  KAK YV+ + +PIV+KADGL AGKGV VA T+++A  AI+ C    + +  + 
Sbjct: 121 QCFNNAPKAKAYVRTQGVPIVIKADGLAAGKGVTVAMTLEDAFDAIEDCFEGAYGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFF LCDG+TA+PF TA+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFMTGEEASFFCLCDGQTALPFGTAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++II PT+ GM +   PF GVL+AGLMI E GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 IAQTMEQIIDPTMRGMAEMGAPFTGVLYAGLMIDETGPKLIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQL 355
            DIL +L++   G L +    W  + ALTVV+A +GYP     G+ I+ + Q      ++
Sbjct: 301 DDILVLLSAAADGGLRHVSARWSDQAALTVVMAAEGYPGTPKKGSAIAGLKQAEANGAKV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTA  +  L ANGGRVL+ TA G  +  ++ L Y  VE IDW  G++R DIG +  E
Sbjct: 361 FHAGTAQKDGQLIANGGRVLNVTAQGADVKAAQSLVYQAVEAIDWPGGFYRRDIGWRAVE 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|325294623|ref|YP_004281137.1| phosphoribosylamine--glycine ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065071|gb|ADY73078.1| Phosphoribosylamine--glycine ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 424

 Score =  359 bits (922), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 208/424 (49%), Positives = 291/424 (68%), Gaps = 8/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WK+AQSP + +++  PGNPGIAQ  +C+ I   +   + +F ++
Sbjct: 1   MKVLVVGSGGREHALVWKLAQSPKVEKVYGAPGNPGIAQVGECIDISPTDIERLANFAEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PLV GI D     G KVFGPS+ AA+LE SK+F+K+   KYG+PTA +
Sbjct: 61  EGIDLTVVGPEAPLVAGIVDEFEKRGLKVFGPSKEAARLEGSKAFSKEMMKKYGVPTADF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F DP KAK+Y++ K  PIVVKADGL AGKGVVVA +V+EA  AID+           +
Sbjct: 121 EVFDDPEKAKEYIRKKGAPIVVKADGLAAGKGVVVAKSVEEALEAIDKIMIERVFGDAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++E+ L G E S+  + DG+  IP  TA+DHK + D D GPNTGGMGA SPA  +S+E
Sbjct: 181 KVVVEDCLFGEEASYLVVTDGENFIPLATAQDHKAVFDEDKGPNTGGMGAYSPAPVLSKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V +K+I P ++GM++E +PF+G+L+AGLMIT  GP ++E+NVRFGDPE Q ++ RL
Sbjct: 241 MEKEVQEKVIKPILKGMKQEGHPFKGILYAGLMITSDGPKVLEFNVRFGDPEAQVILRRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           ++D++++  S + GNL    + W  E A+ VV+A+KGYP +Y  G  IS I +       
Sbjct: 301 KTDLVDVCLSVIEGNL-VDGLEWIDETAICVVLASKGYPGKYEKGKFISGIEEAENIDNV 359

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTAI +     NGGRVL+ TALGK I E+RE  Y+ VE I ++  ++R+DIGL+ 
Sbjct: 360 VVFHAGTAIKDGKFITNGGRVLNVTALGKDIVEARENVYNAVEKIYFEGMHYRKDIGLKA 419

Query: 414 KERN 417
            + +
Sbjct: 420 LKHS 423


>gi|317046457|ref|YP_004114105.1| phosphoribosylamine/glycine ligase [Pantoea sp. At-9b]
 gi|316948074|gb|ADU67549.1| phosphoribosylamine/glycine ligase [Pantoea sp. At-9b]
          Length = 426

 Score =  359 bits (922), Expect = 4e-97,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 271/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNVAISATDVPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q++ IDL +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  IPTA
Sbjct: 61  QQEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGDNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM+ E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQIIWPTVNGMKAEGNTYTGFLYAGLMIDKAGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++ +  +   G L      W    +L VV+A  GYP +Y  G  I  +P +   
Sbjct: 301 LRLQSDLVALCLAACDGKLDQQTSQWDPRPSLGVVLAAGGYPGDYNTGDQIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  NGGRVL  TALG+ +  +++ AY + ++I W+  + R DIG 
Sbjct: 361 DGKVFHAGTTLKDDLVVTNGGRVLCVTALGEDVAAAQQRAYELAKSISWEGSFCRHDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRK 426


>gi|225176025|ref|ZP_03730017.1| phosphoribosylamine/glycine ligase [Dethiobacter alkaliphilus AHT
           1]
 gi|225168613|gb|EEG77415.1| phosphoribosylamine/glycine ligase [Dethiobacter alkaliphilus AHT
           1]
          Length = 424

 Score =  359 bits (921), Expect = 5e-97,   Method: Composition-based stats.
 Identities = 201/424 (47%), Positives = 271/424 (63%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL++GSGGREH LAWK+ QSP + +++  PGN GIAQ A+CV I + N  A++ F  E
Sbjct: 1   MRVLIVGSGGREHVLAWKLLQSPQVQKVYCAPGNAGIAQIAECVPISVDNIEALVAFGLE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I L VVGPE PL  G+ DA  AAG + FGPS+ AA+LE SK FAK+   KY IPTA  
Sbjct: 61  HDIQLTVVGPEAPLTAGMVDAFTAAGLEAFGPSKEAAQLEGSKIFAKQIMEKYNIPTAES 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F+   KA  Y+  K  PIVVKADGL AGKGVVVA TV+EA        +D+ F    +
Sbjct: 121 RTFTSADKALAYLAEKGAPIVVKADGLAAGKGVVVATTVEEAEDAVKRIMVDKEFGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VIIEE+L+G EVS  A  DG T +P  +++DHK  +DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVIIEEFLQGEEVSVLAFTDGNTVVPMVSSQDHKAAYDGDTGPNTGGMGAYSPAPILTDQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V + ++ PT++G+++E   F+G+L+AGLMIT QGP ++E+NVRFGDPECQ ++ RL
Sbjct: 241 LLAEVEETVLRPTVDGLRQEGITFKGILYAGLMITAQGPKVLEFNVRFGDPECQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SD+  I+ S +H  LH   I W   +   VV+A+ GYP +Y  G  I  +         
Sbjct: 301 KSDLSAIMLSVIHRCLHEETIEWYDNHTACVVMASGGYPGKYTKGKEIKGLDDAATLDDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            ++HAGTA     +   GGRVL  TA G T+  + E AY  V+ I +   ++R+DIG + 
Sbjct: 361 YVYHAGTAEKGKKIVTAGGRVLGVTAWGDTLPAALEKAYAAVDKITFDGAHYRKDIGQKA 420

Query: 414 KERN 417
             R 
Sbjct: 421 LRRK 424


>gi|296132352|ref|YP_003639599.1| phosphoribosylamine/glycine ligase [Thermincola sp. JR]
 gi|296030930|gb|ADG81698.1| phosphoribosylamine/glycine ligase [Thermincola potens JR]
          Length = 422

 Score =  359 bits (920), Expect = 6e-97,   Method: Composition-based stats.
 Identities = 199/421 (47%), Positives = 279/421 (66%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHAL WKI+QSP +++++  PGN G+AQ A+CVAI +++   ++ F Q+
Sbjct: 1   MKVLVVGGGGREHALVWKISQSPKVTKVYCAPGNAGMAQIAECVAISVEDIDGLLTFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID+ VVGPE PL  G++D    AG KVFGPS++AA+LE SK  AK+  +KY IPTA Y
Sbjct: 61  EGIDMTVVGPEAPLTMGLADKFRVAGLKVFGPSRQAAELEGSKVMAKELMSKYNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
             F+D   A +Y++    P VVKADGL AGKGVVVA   + A +A+          Q   
Sbjct: 121 AKFTDAGSAIEYIKETGAPCVVKADGLAAGKGVVVARDEETAINAVRMMMEDKAFGQAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +IIEE LEG EVS  A  DGKT +P  +++DHKR+ D D GPNTGGMGA SPA   + E
Sbjct: 181 MIIIEECLEGEEVSILAFTDGKTVVPMVSSQDHKRVFDNDEGPNTGGMGAYSPAPVYTDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L+  V++KI+ PT++GM +E   ++GVL+AGLMIT+ GP ++E+NVRFGDPE QA++ RL
Sbjct: 241 LHRQVMEKILKPTVQGMAQEGRLYEGVLYAGLMITKDGPKVLEFNVRFGDPETQAVLTRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD++EI+ + +   LH  +I WK E A+ VV+A  GYP  Y  G  I+ +        +
Sbjct: 301 DSDLVEIMEAVIDKRLHEVNIRWKPEAAVCVVLAAGGYPGSYKKGDPITGLDDAAREAIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT + +  +  +GGRVL  TALG +I  + E AY  V  I + + ++R+DIG +   
Sbjct: 361 FHAGTGLQDGRIVTSGGRVLGVTALGPSIPAAIENAYKAVGKIHFDNMHYRKDIGQKALR 420

Query: 416 R 416
            
Sbjct: 421 H 421


>gi|254427148|ref|ZP_05040855.1| phosphoribosylamine--glycine ligase [Alcanivorax sp. DG881]
 gi|196193317|gb|EDX88276.1| phosphoribosylamine--glycine ligase [Alcanivorax sp. DG881]
          Length = 432

 Score =  358 bits (919), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 267/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQ+  +  ++  PGN G A+ A  + VAID+ +  A++ F 
Sbjct: 5   MKVLIIGGGGREHALAWKVAQAEQVETVFVAPGNAGTAREAKLENVAIDVLDQPALLAFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  IDL +VGPE PLV G+ D     G K FGPS+ AA+LE SK+F K F  +  IPT 
Sbjct: 65  QDNSIDLTIVGPEAPLVEGLVDTFQENGLKCFGPSKAAAQLEGSKAFTKDFLARQNIPTG 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D  +A  YV+ +  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 125 AYGNFTDMDEALTYVREQGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLDGNKFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+LEG E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 185 GHRVVVEEFLEGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             +Y  ++ ++I PT+EGM  E  P+ G L+AGLMI+ Q  P +IEYN RFGDPE Q ++
Sbjct: 245 DAVYQRIMDEVITPTVEGMAAEGMPYTGFLYAGLMISPQGAPKVIEYNCRFGDPETQPIL 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+SD+  +  + + G L  T I W     L VV+A  GYP+ Y  G +I  + Q    
Sbjct: 305 MRLQSDLAGLCLAALDGKLDQTDIQWDPRPTLGVVMAAGGYPDSYNKGDVIDGLDQADSD 364

Query: 353 -TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  +  +  +GGRVL  T +G T+ E++  AY  V+ I W+   +R DIG 
Sbjct: 365 TVKVFHAGTAEKDGQVVTSGGRVLCVTGVGDTVGEAQANAYEGVKQITWRDAQYRSDIGY 424

Query: 412 QKKERN 417
           +   R 
Sbjct: 425 RAVARE 430


>gi|306845024|ref|ZP_07477605.1| phosphoribosylamine--glycine ligase [Brucella sp. BO1]
 gi|306274656|gb|EFM56445.1| phosphoribosylamine--glycine ligase [Brucella sp. BO1]
          Length = 427

 Score =  358 bits (919), Expect = 8e-97,   Method: Composition-based stats.
 Identities = 222/423 (52%), Positives = 296/423 (69%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALIAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMLAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D C    F    + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD+L ++ + V G L    + WK E ALTVV+A +GYP     G++I  + +       +
Sbjct: 301 SDLLALITAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLESIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA+  T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITAMAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERN 417
           ER 
Sbjct: 421 ERE 423


>gi|327192807|gb|EGE59734.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli
           CNPAF512]
          Length = 423

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 233/421 (55%), Positives = 296/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLL+E ++ PGNPGIA+HA  V I+I +H A+  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLTEFYAAPGNPGIAEHAVLVPINIDDHEAVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF        + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKNALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM    +PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTIRGMAASGHPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L      W  + ALTVV+A+KGYP  Y   T I  +PQ     ++F
Sbjct: 301 SDLLPLLLAAANGMLDQVGAEWSDDPALTVVMASKGYPGAYEKNTPILSLPQAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+ + AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTATGGTVAEASDRAYALLDKVRWENGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|254718594|ref|ZP_05180405.1| phosphoribosylamine--glycine ligase [Brucella sp. 83/13]
 gi|265983570|ref|ZP_06096305.1| phosphoribosylamine-glycine ligase [Brucella sp. 83/13]
 gi|306839888|ref|ZP_07472686.1| phosphoribosylamine--glycine ligase [Brucella sp. NF 2653]
 gi|264662162|gb|EEZ32423.1| phosphoribosylamine-glycine ligase [Brucella sp. 83/13]
 gi|306405074|gb|EFM61355.1| phosphoribosylamine--glycine ligase [Brucella sp. NF 2653]
          Length = 427

 Score =  358 bits (918), Expect = 1e-96,   Method: Composition-based stats.
 Identities = 222/423 (52%), Positives = 297/423 (70%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L+  PGNPGIA  A+   I + +H+A++ F +E
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLYCAPGNPGIAAVAELADIGVDDHAALMAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPE PLV G++D + A G +VFGPS+ AA+LE SK F K  C ++ IPT  Y
Sbjct: 61  KHIDLVVVGPEAPLVAGLADEMRAEGIRVFGPSRAAAQLEGSKGFTKDLCARFNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F++  KAK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D C    F    + 
Sbjct: 121 GRFNNAPKAKAYIRQQGAPIVVKADGLAAGKGVVVAMTLQEALDAVDSCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L+G E SFF +CDGKTA+P  +A+DHKR+ DGD GPNTGGMGA +PA  M+ E+
Sbjct: 181 VVVEEFLDGEEASFFCICDGKTALPLGSAQDHKRVGDGDTGPNTGGMGAYAPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  ++++I PT+ GM +   PF G+LFAGLMIT  GP LIEYN RFGDPECQ +MMRL 
Sbjct: 241 VARTMRELIEPTMRGMAEIGAPFSGILFAGLMITSDGPKLIEYNTRFGDPECQVLMMRLN 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD+L ++N+ V G L    + WK E ALTVV+A +GYP     G++I  + +       +
Sbjct: 301 SDLLALINAAVDGRLDEVSLEWKDEPALTVVMAAEGYPANVKKGSVIRDLEKLERIDGVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           LFHAGTA+ +  + A+GGRVL+ TA+  T+ +++  AY  ++ IDW  G++R DIG +  
Sbjct: 361 LFHAGTALKDGAIVASGGRVLNITAMAATVAQAQARAYEALKLIDWPEGFYRSDIGWRAV 420

Query: 415 ERN 417
           ER 
Sbjct: 421 ERE 423


>gi|115526601|ref|YP_783512.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisA53]
 gi|115520548|gb|ABJ08532.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisA53]
          Length = 427

 Score =  357 bits (917), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 225/423 (53%), Positives = 295/423 (69%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLL+GSGGREHALAWKIA SPL+ +LW  PGN GIA+ A+C+A+D  +H A+I F ++
Sbjct: 1   MKVLLLGSGGREHALAWKIAASPLVDKLWCAPGNAGIAREAECIALDAADHDAVIAFSRQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G+ DAL  AG K FGPSQ AA+LE SKSF K+ CT+ GIPTA Y
Sbjct: 61  NAVDLVVVGPEAPLVAGLVDALTKAGIKTFGPSQGAAQLEGSKSFTKEICTEAGIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
            HF D   AK Y+Q +  PIV+KADGL AGKGVVVA T+ EA +A+D      F    + 
Sbjct: 121 GHFRDLAAAKAYLQTQGAPIVIKADGLAAGKGVVVAMTMAEADAALDMMFDGGFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF LCDG  A+P  TA+DHKR+ DGD+GPNTGGMGA SPA  M++ +
Sbjct: 181 VVIEEFMQGEEASFFVLCDGDHALPLATAQDHKRVFDGDLGPNTGGMGAYSPAPVMTEAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V+ +II PT+  M     P++GVLFAGLMIT +GP LIEYNVRFGDPECQ +M+RL+
Sbjct: 241 CAQVMDRIINPTLRAMAARGTPYKGVLFAGLMITAEGPKLIEYNVRFGDPECQVLMLRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD++  L +   G LH+  + W    ALTVV+A KGYP +Y  G++I  + +       +
Sbjct: 301 SDLVPALLAACDGELHHIDLRWSDAPALTVVMAAKGYPGDYAKGSLIEGLDEAAAIEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA G ++ +++  AY  V+ + W  G+ R DIG Q  
Sbjct: 361 IFHAGTKADGDRILANGGRVLNVTATGASVADAQRRAYQAVDRLRWPDGFCRRDIGWQAI 420

Query: 415 ERN 417
           +R 
Sbjct: 421 KRE 423


>gi|218671709|ref|ZP_03521378.1| phosphoribosylamine--glycine ligase [Rhizobium etli GR56]
          Length = 423

 Score =  357 bits (916), Expect = 2e-96,   Method: Composition-based stats.
 Identities = 229/421 (54%), Positives = 297/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLLSE ++ PGNPGIA+HA  + ++I +H A+  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLSEFYAAPGNPGIAEHAILIPVNIDDHEAVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D CF        + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDG+ A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGRHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM +  +PF GV FAGLMITE+GP LIEYNVRFGDPECQ ++MRL+
Sbjct: 241 VERTMKEIIEPTIRGMAESGHPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLLMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L     +W  + ALTVV+A+KGYP  Y   T I  +P+     ++F
Sbjct: 301 SDLLPLLLATANGTLDQVSADWSDDPALTVVMASKGYPGAYEKNTPILSLPEVGDGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+ + AY +++ + W +G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTATGGTVAEASDRAYALLDKVRWDNGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|329296838|ref|ZP_08254174.1| phosphoribosylamine/glycine ligase [Plautia stali symbiont]
          Length = 452

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 272/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNVAISATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+++IDL +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  IPTA
Sbjct: 61  QQENIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLNGEEASFIVMVDGDNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM+ E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQIIWPTVNGMKAEGNTYTGFLYAGLMIDNAGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++ +  + V G L      W    +L VV+A  GYP  Y  G  I  +P ++  
Sbjct: 301 LRLQSDLVALCLAAVDGKLDQQQSQWDPRPSLGVVLAAGGYPGNYNTGDQIHGLPLEDVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL  TALG+ +  +++ AY + ++I W   + R DIG 
Sbjct: 361 DGKVFHAGTTLKDDLVVTSGGRVLCVTALGEDVAAAQKNAYALAQHISWNGSFCRNDIGY 420

Query: 412 QKKERNV 418
           +   R V
Sbjct: 421 RAINRKV 427


>gi|220933546|ref|YP_002512445.1| Phosphoribosylamine--glycine ligase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994856|gb|ACL71458.1| Phosphoribosylamine--glycine ligase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 430

 Score =  356 bits (914), Expect = 3e-96,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A   +C  V +++ +  A++HF 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPRVQTVFVAPGNAGTALEPRCLNVEVNLSDIPALVHFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL VVGPE PLV G+ DA  AAG ++FGPS +AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  QSQGVDLTVVGPEAPLVAGVVDAFRAAGLRIFGPSSKAAQLEGSKAFSKDFLARHAIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D   A  Y++ +  PIVVKADGL AGKGV++A TV EA +A+        F + 
Sbjct: 121 AYANFTDLDAALAYIRERGAPIVVKADGLAAGKGVILAQTVAEAEAAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G E SF  + DG+  +P  +++DHK   DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVVEEFLTGEEASFICMVDGEHILPMASSQDHKARDDGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ ++++++ PT+ GM  E NP+ G L+AG+MI  +  P ++E+N RFGDPE Q +M
Sbjct: 241 PEIHARIMREVMEPTVRGMAAEGNPYTGFLYAGVMIAPDGTPKVLEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL SD++++L + +   L     +W    +L VV+A  GYP +Y  G +I  +P+ +  
Sbjct: 301 MRLRSDLVDLLEAALDARLDQVEADWDPRASLGVVLAAGGYPNDYRKGDVIIGLPEQDAP 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   +  +  NGGRVL    LG+T+ E+++ AY + + I W   Y R DIG 
Sbjct: 361 DAKVFHAGTLQQDGAVVTNGGRVLCVVGLGETVAEAQKRAYALSDRIHWDGVYCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|304312272|ref|YP_003811870.1| Phosphoribosylamine-glycine ligase [gamma proteobacterium HdN1]
 gi|301798005|emb|CBL46227.1| Phosphoribosylamine-glycine ligase [gamma proteobacterium HdN1]
          Length = 431

 Score =  356 bits (914), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IGSGGREHALAWK  QSP + +++  PGN G A+ A  + V I   +  A++ F 
Sbjct: 1   MKILIIGSGGREHALAWKAKQSPRVKQVFVAPGNAGTAREAGVENVQIAPTDVPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  IDL +VGPE PLV G+ D   AAG  +FGP+Q AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  QKNAIDLTIVGPEAPLVLGVVDQFRAAGLAIFGPTQSAAQLEGSKAFSKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ + MPIVVKADGL AGKGV++A T  EA +A+        F + 
Sbjct: 121 AYQNFTEIEPAIAYLRGQKMPIVVKADGLAAGKGVIIAQTEAEAIAAVQDMLGGNRFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DG   +P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLSGEEASFICMVDGSHVLPLATSQDHKARDEGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            ++++ V+ +II PTI GM +E +P+ G L+AGLMI  Q    ++E+N RFGDPE Q ++
Sbjct: 241 PDIHARVMAEIIYPTIRGMAEEGSPYTGFLYAGLMIDAQGHSKVLEFNCRFGDPETQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR++SD++E+  + V   L+    +W    AL VV+A  GYPE+Y  G  I  +P+ +  
Sbjct: 301 MRMQSDLVELCLAGVEQRLNKIDAHWDTRAALGVVMAAGGYPEDYSKGDAIQGLPEKDAE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++  +GGRVL  TALG T+ E+++ AY   + I W+  + R DIG 
Sbjct: 361 NCKVFHAGTRLEGDDVVTSGGRVLCVTALGDTVEEAQKTAYATTDRIHWEGAFCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|327396046|dbj|BAK13468.1| phosphoribosylamine-glycine ligase PurD [Pantoea ananatis AJ13355]
          Length = 426

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 267/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK +QSPL   ++  PGN G A     Q V I   +  A++ F 
Sbjct: 1   MKILIIGNGGREHALAWKASQSPLAETIFVAPGNAGTALEPALQNVDIAPTDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QREQIDLTIVGPEAPLVAGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTDVAPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMIDQTGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    +L +V+A  GYP  Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAACEGKLDQKDSQWDPRPSLGLVLAAGGYPGSYNNGDQIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL  TALG  +  +++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLEEDRVLTNGGRVLCVTALGDDVAAAQKRAYELAKPISWQGSFCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRK 426


>gi|262392958|ref|YP_003284812.1| phosphoribosylamine--glycine ligase [Vibrio sp. Ex25]
 gi|262336552|gb|ACY50347.1| phosphoribosylamine--glycine ligase [Vibrio sp. Ex25]
          Length = 429

 Score =  356 bits (913), Expect = 4e-96,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 276/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V ID+++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFIAPGNAGTALEPKLENVNIDVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDQKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + N+  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTENKDGNIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRSDIGY 420

Query: 412 QKKERNVKY 420
           +   R  + 
Sbjct: 421 RAIAREQEK 429


>gi|291615780|ref|YP_003518522.1| PurD [Pantoea ananatis LMG 20103]
 gi|291150810|gb|ADD75394.1| PurD [Pantoea ananatis LMG 20103]
          Length = 430

 Score =  356 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 266/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK +QSPL   ++  PGN G A     Q V I   +  A++ F 
Sbjct: 5   MKILIIGNGGREHALAWKASQSPLAETIFVAPGNAGTALEPALQNVDIAPTDIPALLAFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 65  QREQIDLTIVGPEAPLVAGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 125 EYQNFTDVAPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGDNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 245 DEIHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMIDQTGQPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    +L VV+A  GYP  Y +G  I  +P +   
Sbjct: 305 LRLQSDLVDLCLAACEGKLDQKDSQWDPRPSLGVVLAAGGYPGSYNNGDQIHGLPLEEVA 364

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL  TALG  +  +++ AY + + I W+  + R DIG 
Sbjct: 365 DGKVFHAGTRLEEDRVLTNGGRVLCVTALGDDVAAAQKRAYELAKPISWQGSFCRRDIGY 424

Query: 412 QKKERN 417
           +   R 
Sbjct: 425 RAINRK 430


>gi|322834806|ref|YP_004214833.1| phosphoribosylamine/glycine ligase [Rahnella sp. Y9602]
 gi|321170007|gb|ADW75706.1| phosphoribosylamine/glycine ligase [Rahnella sp. Y9602]
          Length = 429

 Score =  356 bits (912), Expect = 5e-96,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK +QSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKASQSPLADKVFVAPGNAGTALEPLLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +   I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  KSHDIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQEAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+++K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 DYQNFTEIEPALTYLRSKGAPIVIKADGLAAGKGVIVAMTLKEAEDAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGSNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVRGMAAENNTYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL SD++++  +   G L +    W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRLRSDLVDLCLAGAEGRLGDKTSEWDPRPSLGVVLAAGGYPADYKTGDVIHGLPLEEVP 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + +  +  NGGRVL  TALGKT+  ++  AY + ++I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTRLQDERVVTNGGRVLCVTALGKTVEAAQARAYDLAKDIHWEGSFCRKDIGY 420

Query: 412 QKKERN 417
           +  +R 
Sbjct: 421 RAIDRE 426


>gi|302608236|emb|CBW44467.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Marinobacter hydrocarbonoclasticus]
          Length = 428

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSP   +++  PGN G A+    + V +D+ +   + +F 
Sbjct: 1   MNILVIGSGGREHALAWKAAQSPQADKVFVAPGNAGTAREPNLENVDLDVMDLDGLANFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ ++ L +VGPE PLV G+ D   A G ++FGPS  AA+LE SK+F K F  +  IPTA
Sbjct: 61  EQNNVGLTIVGPEAPLVAGVVDKFEARGLRIFGPSAGAAQLEGSKAFTKDFLARQKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D  +A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 DYANFTDVDEALAYVREKGAPIVVKADGLAAGKGVIVAMTLAEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGKNVLAMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            +++  ++ ++I PT+ GM  E +P++G L+AGLMI T   P +IE+N RFGDPE Q +M
Sbjct: 241 ADVHQRIMDEVIYPTVNGMAAEGHPYKGFLYAGLMIDTSGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +R++SD++E+  + V G L      W    ++ +V+A  GYP  Y  G +IS +P   T 
Sbjct: 301 LRMKSDLVELCQAAVDGKLDACDSEWDERASVGIVLAAGGYPASYDKGDVISGLPDGETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++   GGRVL ATALG T+TE+++ AY + + I W   ++R DI  
Sbjct: 361 GEKVFHAGTKLNGDDVVTAGGRVLCATALGNTVTEAQQRAYELAKKISWNGMFYRNDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|153835063|ref|ZP_01987730.1| phosphoribosylamine--glycine ligase [Vibrio harveyi HY01]
 gi|148868459|gb|EDL67565.1| phosphoribosylamine--glycine ligase [Vibrio harveyi HY01]
          Length = 429

 Score =  355 bits (911), Expect = 7e-96,   Method: Composition-based stats.
 Identities = 192/429 (44%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 1   MNILIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK IDL +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIDLTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTDNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKERNVKY 420
           +   R  + 
Sbjct: 421 RAIAREQEK 429


>gi|293394038|ref|ZP_06638342.1| phosphoribosylamine-glycine ligase [Serratia odorifera DSM 4582]
 gi|291423478|gb|EFE96703.1| phosphoribosylamine-glycine ligase [Serratia odorifera DSM 4582]
          Length = 427

 Score =  355 bits (910), Expect = 9e-96,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  A  + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLAEKVYVAPGNAGTALEANLENVAISATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QDNDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPTQAAAQLEGSKAFTKDFLARHRIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAEAAVQDMLAGNAFGNA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVVPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V++++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DQIHQRVMEQVIWPTVRGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L      W    AL VV+A  GYP +Y  G +I  +PQ  + 
Sbjct: 301 LRLRSDLVELCLAGAEGKLDQKTSEWDDRPALGVVLAAGGYPADYRTGDVIQGLPQQASA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  +GGRVL  TALG T+ ++++ AY + E I W   + R+DIG 
Sbjct: 361 DGKVFHAGTQMAGDEVVTSGGRVLCVTALGATVAQAQQRAYQLAEGIQWPGSFCRKDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARG 426


>gi|222085071|ref|YP_002543601.1| phosphoribosylamine-glycine ligase protein [Agrobacterium
           radiobacter K84]
 gi|221722519|gb|ACM25675.1| phosphoribosylamine-glycine ligase protein [Agrobacterium
           radiobacter K84]
          Length = 423

 Score =  354 bits (909), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 233/421 (55%), Positives = 304/421 (72%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL++E ++ PGNPGIA++A   A+DI++H A++ FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEYATLAALDIEDHGAVVAFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV GI+DAL AAG  VFGPS  AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGIADALRAAGIAVFGPSTAAAQLEGSKGFTKDICARYNIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA TVDEA +A+D CF     +  + 
Sbjct: 121 QRFNNAPKAKVYIREQGAPIVVKADGLAAGKGVTVAMTVDEALAAVDDCFEGAFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE YL+G E SFF L DGK A+   TA+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVIEAYLDGEEASFFCLSDGKHALALATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGYPFSGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +C +G L      W  + AL+VV+A+KGYP  Y   T I+ +P ++   ++F
Sbjct: 301 SDLLPLLLACANGTLDQVDAEWSDDVALSVVMASKGYPGSYAKNTPIAALPADSEGAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ ++ L A GGRVL+ TA G+T++E+++ AY +   ++W++G+ R DIG Q   R
Sbjct: 361 HAGTALKDDALVATGGRVLNVTATGRTVSEAQKRAYALASKVEWENGFNRSDIGWQAIAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|307941683|ref|ZP_07657038.1| phosphoribosylamine--glycine ligase [Roseibium sp. TrichSKD4]
 gi|307775291|gb|EFO34497.1| phosphoribosylamine--glycine ligase [Roseibium sp. TrichSKD4]
          Length = 422

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 227/421 (53%), Positives = 285/421 (67%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAW ++ SPLL++L++ PGN GIA+ A+ +++D+ +H A+I FCQ 
Sbjct: 1   MNILLIGSGGREHALAWALSNSPLLTKLFAAPGNAGIAEIAELISVDVADHEAVISFCQT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PLV G+ D L AAG K FGPS+ AA+LE SKSF K  C    IPTA Y
Sbjct: 61  NAVDFVVVGPEAPLVAGLVDDLTAAGIKAFGPSKAAAQLEGSKSFTKAICDAANIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
            HF     AK YV+    PIVVKADGL AGKGVVVA T +EA +A+D C    F    + 
Sbjct: 121 GHFKTADDAKAYVEAHGAPIVVKADGLAAGKGVVVAMTKEEALAAVDACFEGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+LEG E SFF L DG+  +P  TA+DHKR +DGD GPNTGGMGA SPA  M + +
Sbjct: 181 VVLEEFLEGEETSFFVLVDGENFLPLATAQDHKRAYDGDKGPNTGGMGAYSPAPVMDEAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            S  I +II PT++ M K   PF+GVLFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VSRTIDEIIKPTVDEMAKRGTPFKGVLFAGLMITDEGPNLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQ 354
            D+L +L +   G L      W  + A+TVV+A KGYP  Y +GT I  I +        
Sbjct: 301 DDLLTLLLASADGTLDKVDARWHDDVAMTVVLAAKGYPGSYENGTQIKGIEKAADGPDVA 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT  V+  L ANGGRVL+ TA G T+ E+R+ AY  VE IDW  G+ R DIG +  
Sbjct: 361 IFHAGTKQVDGQLLANGGRVLNVTAHGTTVQEARDKAYAAVEKIDWPEGFCRTDIGWRAL 420

Query: 415 E 415
           +
Sbjct: 421 Q 421


>gi|319784734|ref|YP_004144210.1| phosphoribosylamine/glycine ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170622|gb|ADV14160.1| phosphoribosylamine/glycine ligase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 425

 Score =  354 bits (908), Expect = 1e-95,   Method: Composition-based stats.
 Identities = 237/422 (56%), Positives = 296/422 (70%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWKIA SPLL++L++ PGNPGI   A+ V +DI +H+A+  FC+E
Sbjct: 1   MNVLLLGSGGREHALAWKIAASPLLTKLYAAPGNPGIGGEAELVKLDIADHAAVTAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV GI+D L A   +VFGPS+ AA+LE SK F K  C +Y IPTATY
Sbjct: 61  KKIDLVVVGPEGPLVAGIADDLRAENIRVFGPSKAAARLEGSKGFTKDLCARYNIPTATY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             FSD   AK YV+    PIV+KADGL AGKGV VA T+ EA +A+D C    F    + 
Sbjct: 121 GRFSDLASAKAYVEKTGAPIVIKADGLAAGKGVTVAMTLSEAQAALDACFDGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFF LCDG TA+PF TA+DHKR+ DGD GPNTGGMGA SPA  M+ EL
Sbjct: 181 VVVEEFMTGEEASFFCLCDGTTALPFGTAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GVLFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VERTMREIIEPTMRGMAELGAPFSGVLFAGLMITDKGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQL 355
            D+L +LN+   G L +T + W+ E ALTVV+A +GYP     G++I  +    G   Q+
Sbjct: 301 DDLLVLLNAATDGQLAHTSVRWRDEAALTVVMAARGYPGTPEKGSVIRGVEDVAGDGVQI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTAI    L ANGGRVL+ TA G T+ E+++ AY  ++ IDW  G+ R DIG Q   
Sbjct: 361 FHAGTAINGGALVANGGRVLNVTASGATVGEAQKRAYAALDRIDWPDGFCRRDIGWQAVA 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|13476192|ref|NP_107762.1| phosphoribosylamine--glycine ligase [Mesorhizobium loti MAFF303099]
 gi|20139625|sp|Q986A5|PUR2_RHILO RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|14026952|dbj|BAB53548.1| phosphoribosylamine-glycine ligase [Mesorhizobium loti MAFF303099]
          Length = 425

 Score =  354 bits (908), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 237/422 (56%), Positives = 296/422 (70%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWKIA SPLL++L++ PGNPGI   A+ V +DI +H+A+  FCQE
Sbjct: 1   MNVLLLGSGGREHALAWKIAASPLLTKLYAAPGNPGIGAEAELVKLDITDHAAVTAFCQE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV GI+D L A   +VFGPS+ AA+LE SK F K  C +Y IPTA Y
Sbjct: 61  KKIDLVVVGPEGPLVAGIADDLRAENIRVFGPSKAAARLEGSKGFTKDLCARYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F+D   AK YV     PIV+KADGL AGKGV VA T DEA +A+D C    F    + 
Sbjct: 121 GRFNDLASAKAYVDQTGAPIVIKADGLAAGKGVTVAMTSDEARAALDACFEGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFF LCDG TA+PF TA+DHKR+ DGD+GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFMTGEEASFFCLCDGTTALPFGTAQDHKRVGDGDVGPNTGGMGAYSPAPVMTPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF G+LFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 IERTMREIIEPTMRGMAELGAPFAGILFAGLMITDKGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQL 355
            D+L +LN+ V G L +T I W+ E ALTVV+A +GYP     G++I  + Q      Q+
Sbjct: 301 DDLLVLLNAAVDGQLAHTSIRWRDEAALTVVMAARGYPGTPEKGSVIRGVEQAAGEGVQI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTAI    L ANGGRVL+ TA G T+ E+++ AY  ++ IDW  G+ R DIG Q   
Sbjct: 361 FHAGTAINGGALVANGGRVLNVTASGATVGEAQKRAYAALDRIDWPDGFCRRDIGWQAVA 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|28899672|ref|NP_799277.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838912|ref|ZP_01991579.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ3810]
 gi|260363988|ref|ZP_05776722.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus K5030]
 gi|260878141|ref|ZP_05890496.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AN-5034]
 gi|260897896|ref|ZP_05906392.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           Peru-466]
 gi|260902151|ref|ZP_05910546.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ4037]
 gi|31076888|sp|Q87KS8|PUR2_VIBPA RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|28807924|dbj|BAC61161.1| phosphoribosylamine-glycine ligase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149747620|gb|EDM58544.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ3810]
 gi|308085551|gb|EFO35246.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           Peru-466]
 gi|308090224|gb|EFO39919.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AN-5034]
 gi|308110162|gb|EFO47702.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus
           AQ4037]
 gi|308115546|gb|EFO53086.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus K5030]
 gi|328471096|gb|EGF42002.1| phosphoribosylamine--glycine ligase [Vibrio parahaemolyticus 10329]
          Length = 429

 Score =  354 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 192/429 (44%), Positives = 276/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V ID+++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFIAPGNAGTALEPKLENVNIDVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTDNQDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKERNVKY 420
           +   R  + 
Sbjct: 421 RAIAREQEK 429


>gi|222054522|ref|YP_002536884.1| phosphoribosylamine/glycine ligase [Geobacter sp. FRC-32]
 gi|221563811|gb|ACM19783.1| phosphoribosylamine/glycine ligase [Geobacter sp. FRC-32]
          Length = 422

 Score =  354 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 192/422 (45%), Positives = 273/422 (64%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHAL WKIAQSPL+ +++  PGNPGI   A+ V I + +   ++ F ++
Sbjct: 1   MKILVIGSGGREHALVWKIAQSPLVEKVYCAPGNPGIGTIAENVQIKVDDLPGLLAFARK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL  GI D     GFK+FG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  EAIDLTVVGPELPLSLGIVDLFEEYGFKIFGARKNAAIIEASKAFSKDLMKKYHVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F++   A  ++    +PIVVKADGL AGKGV++A T DEA +A+        F    S
Sbjct: 121 EVFTEVGPAITFIDKVGIPIVVKADGLAAGKGVIIAQTRDEAVAAVTDMLSGNAFGTAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF A  DGK  IP  +A+DHK ++DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLKGEEASFLAFTDGKNIIPLASAQDHKAVYDGDTGPNTGGMGAYSPAPVVTPS 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   +++++  T++GM  E  P++GVL+AGLMI       +E+N RFGDPECQ ++MR+
Sbjct: 241 IHEKAMEEVMRRTVDGMAAEGRPYRGVLYAGLMIDGDSVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTGTTQ 354
           +SDI+ +L +    ++ N  I W  + A+ VV+A + YP +Y  G +I  +   N     
Sbjct: 301 KSDIVPVLMAVAEKDISNVQIEWHDKAAVCVVMAAQDYPGDYAKGDVIRGLDVANADDLF 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA+ N  L  NGGRVL  TALG T+ E+ + AY  V  I W+  ++R+DIG +  
Sbjct: 361 VFHAGTALDNGRLITNGGRVLGVTALGPTVKEAIDRAYSGVSAISWRGVHYRKDIGRKAL 420

Query: 415 ER 416
            R
Sbjct: 421 SR 422


>gi|158319593|ref|YP_001512100.1| phosphoribosylamine--glycine ligase [Alkaliphilus oremlandii
           OhILAs]
 gi|158139792|gb|ABW18104.1| phosphoribosylamine--glycine ligase [Alkaliphilus oremlandii
           OhILAs]
          Length = 416

 Score =  354 bits (907), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 176/417 (42%), Positives = 255/417 (61%), Gaps = 6/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREH +AWK+ QSPL++E++  PGN G  Q A  V I+  +   ++ F + 
Sbjct: 1   MKVLIIGSGGREHTIAWKLQQSPLVTEIFCAPGNAGTTQIATNVEINSNDMDQLVEFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PLVNGI D        + GP +  A+LE SK+FAK F  KY IPTA Y
Sbjct: 61  NAIDLTVVGPEEPLVNGIVDKFREKNLSIIGPDKNGAQLEGSKAFAKAFMDKYHIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR-----CFQQINS 175
                  +    ++  S P+VVKADGL AGKGV +  + +EA +A+              
Sbjct: 121 DEVHTLEEGIAALEKYSYPVVVKADGLAAGKGVFICESKEEAAAAMKELLEDQILGDAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E S     DGKT +P  +++DHKR  DGD GPNTGGMG  SP    +++
Sbjct: 181 DVVIEEFLSGIETSILCFVDGKTIVPMVSSQDHKRAFDGDQGPNTGGMGTYSPNYVYTED 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V ++I+ PT+ G+QKE+  ++G++F GLMIT+ GP ++EYNVRFGDPE Q ++ RL
Sbjct: 241 IEKRVEREILAPTLYGIQKEEMDYRGIVFIGLMITDHGPKVLEYNVRFGDPETQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+++I NS +HG L + +I W    A+ V++A+ GYP +Y  G  I+ + +      +
Sbjct: 301 ETDLVQIFNSIIHGKLEDMNIQWTENGAVCVILASGGYPNQYEKGLEITGLEE-MEDLLI 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH+GT +    +   GGRVL   A+ K   E+R   Y  ++ I ++  ++R DIG +
Sbjct: 360 FHSGTTMSGGKMVTAGGRVLGVVAIDKNTEEARNKVYRNIDKIKFEGSFYRRDIGTK 416


>gi|225850922|ref|YP_002731156.1| phosphoribosylamine--glycine ligase [Persephonella marina EX-H1]
 gi|225645317|gb|ACO03503.1| phosphoribosylamine--glycine ligase [Persephonella marina EX-H1]
          Length = 429

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 194/422 (45%), Positives = 273/422 (64%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G+GGREHALAWKI QSPL+ EL+   GN GI Q A+ V I   +   ++ F +E
Sbjct: 1   MKVLVVGNGGREHALAWKIKQSPLVKELYCAKGNAGIWQIARKVDISPTDIKNLVKFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI DA   AG K+FG  + +A LE+SK FAK F  KYGIPTA Y
Sbjct: 61  EKIDLTVVGPEQPLSEGIVDAFEEAGLKIFGHRRSSAILEASKVFAKNFMKKYGIPTAFY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN----ST 176
           + F +  +A ++V+    PIV+KADGL AGKGVV+A + +EA + I   F          
Sbjct: 121 ETFDNENEAVEFVKKMGTPIVIKADGLAAGKGVVIANSEEEAVNTIKDMFGGRFGEASKR 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IEE+L G E S+ A+  G   +P  T++DHKR+ D D GPNTGGMGA SPA  ++ E+
Sbjct: 181 IVIEEFLTGEEASYIAMVKGDKLVPMATSQDHKRVFDNDKGPNTGGMGAYSPAPLVTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              +++KI+ PT+ GMQ E     G L+AGLMI E+G  ++E+NVR GDPE Q +M RL+
Sbjct: 241 EKEILEKIMYPTLRGMQSEGRELCGFLYAGLMIGEKGINVLEFNVRMGDPETQPIMRRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTTQ 354
           SD++E +   + G + +    W  +Y++ VV+A+ GYP +Y  G +I+ I   +      
Sbjct: 301 SDLVEHIMDILEGRIESVKPEWSEDYSIGVVMASAGYPGKYEKGKVITGIEDAEKDPDIV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT I + NL  +GGRVL+ TA GKT+TE++E  Y  VE I ++  ++R DIG +  
Sbjct: 361 VFHAGTDIKDGNLVTSGGRVLTVTATGKTLTEAKEKVYRAVEKIHFEGAHYRRDIGDKGI 420

Query: 415 ER 416
           +R
Sbjct: 421 KR 422


>gi|120556358|ref|YP_960709.1| phosphoribosylamine--glycine ligase [Marinobacter aquaeolei VT8]
 gi|120326207|gb|ABM20522.1| phosphoribosylamine--glycine ligase [Marinobacter aquaeolei VT8]
          Length = 428

 Score =  353 bits (906), Expect = 2e-95,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK +QSP   +++  PGN G A+    + V +D+ +   + +F 
Sbjct: 1   MNILVIGSGGREHALAWKASQSPQADKVFVAPGNAGTAREPNLENVDLDVMDLDGLANFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ ++ L +VGPE PLV G+ D   A G ++FGPS  AA+LE SK+F K F  +  IPTA
Sbjct: 61  EQNNVGLTIVGPEAPLVAGVVDKFEARGLRIFGPSAGAAQLEGSKAFTKDFLARQKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D  +A  YV+ K  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 DYANFTDVDQALAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGKNVLAMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  +++++I PT+ GM  E +P++G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 ADVHQRIMEEVIYPTVNGMAAEGHPYKGFLYAGLMIDASGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +R++SD++E+  + V G L      W    ++ +V+A +GYP  Y  G +IS +P+  T 
Sbjct: 301 LRMKSDLVELCQAAVDGKLDACDSEWDERASVGIVLAARGYPASYQKGDVISGLPEGETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++   GGRVL ATALG T+TE+++ AY + + I W   ++R DI  
Sbjct: 361 GEKVFHAGTRLNGDDVVTAGGRVLCATALGNTVTEAQQRAYELAKKISWNGMFYRNDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|253686630|ref|YP_003015820.1| phosphoribosylamine/glycine ligase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251753208|gb|ACT11284.1| phosphoribosylamine/glycine ligase [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 428

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 201/426 (47%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL   ++  PGN G A  A    V I   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKAAQSPLAKRVYVAPGNAGTALEAALTNVDIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGPSQ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI+       F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIEDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ +  
Sbjct: 301 LRLRSDLVELCLAACDGTLDQKDSVWDERPSLGVVLAAGGYPADYNTGDVISGLPQQDAE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAIERE 426


>gi|50119200|ref|YP_048367.1| phosphoribosylamine--glycine ligase [Pectobacterium atrosepticum
           SCRI1043]
 gi|49609726|emb|CAG73160.1| phosphoribosylamine--glycine ligase [Pectobacterium atrosepticum
           SCRI1043]
          Length = 428

 Score =  353 bits (906), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 199/426 (46%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A       V I   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKAAQSPLAKQVYVAPGNAGTALEPALTNVDISATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV +K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALTYVHSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L      W    +L VV+A  GYP++Y  G +IS +PQ +  
Sbjct: 301 LRLRSDLVELCLAGCDGTLDQKDSVWDERPSLGVVLAAGGYPDDYNTGDVISGLPQQDAE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVVEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAIERE 426


>gi|156972571|ref|YP_001443478.1| phosphoribosylamine--glycine ligase [Vibrio harveyi ATCC BAA-1116]
 gi|156524165|gb|ABU69251.1| hypothetical protein VIBHAR_00211 [Vibrio harveyi ATCC BAA-1116]
          Length = 429

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 190/429 (44%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 1   MNILIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALTYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMTSEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTNNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKERNVKY 420
           +   R  + 
Sbjct: 421 RAIAREQEK 429


>gi|261819584|ref|YP_003257690.1| phosphoribosylamine--glycine ligase [Pectobacterium wasabiae
           WPP163]
 gi|261603597|gb|ACX86083.1| phosphoribosylamine/glycine ligase [Pectobacterium wasabiae WPP163]
          Length = 428

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 199/426 (46%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A       V I   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKAAQSPLAKQVYVAPGNAGTALEPALTNVDIAATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ +  
Sbjct: 301 LRLRSDLVELCLAGCDGTLDQKDSVWDERPSLGVVLAAGGYPSDYNTGDVISGLPQQDAE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAIERE 426


>gi|209548141|ref|YP_002280058.1| phosphoribosylamine--glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533897|gb|ACI53832.1| phosphoribosylamine/glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 427

 Score =  353 bits (905), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 228/421 (54%), Positives = 299/421 (71%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL++E ++ PGNPGIA+HA  V ++I++H A+  FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEHAMLVPVNIEDHEAVAAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLVVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK Y++++ +PIVVKADGL AGKGV VA T+DEA +A+D CF        + 
Sbjct: 121 QRFNNAPKAKAYIRDQGVPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKNALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +  +PF GV FAGLMIT +GP LIEYNVRFGDPECQ MMMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITSRGPELIEYNVRFGDPECQVMMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L      W  + ALTVV+A+KGYP  Y   T I  +P+     ++F
Sbjct: 301 SDLLPLLLATANGTLDQMSAEWSDDPALTVVMASKGYPAAYEKNTPILSLPEAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E+++ AY +++ + W +G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTASGGTVAEAKDRAYALLDRVKWDNGFSRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|254471989|ref|ZP_05085390.1| phosphoribosylamine--glycine ligase [Pseudovibrio sp. JE062]
 gi|211959191|gb|EEA94390.1| phosphoribosylamine--glycine ligase [Pseudovibrio sp. JE062]
          Length = 426

 Score =  353 bits (905), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 218/423 (51%), Positives = 291/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAW +A+SP+L+EL+  PGN GI Q A+C+A+D+ +H ++I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWSLAKSPVLNELFVAPGNAGIEQFAKCIALDLTDHRSVIEFCRL 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I+ VV+GPE PLV+G+SD+L  AG +VFGPS  AA+LE SK F K  C +  +PTA Y
Sbjct: 61  HDINFVVIGPEAPLVDGLSDSLTHAGLRVFGPSSAAAQLEGSKGFTKDMCARANVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F +   AK Y++ +  PIVVKADGL AGKGV++A    EA  A+D C    F    + 
Sbjct: 121 GRFDNADAAKTYIREQGAPIVVKADGLAAGKGVIIAMNEQEALDAVDSCFDGAFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+LEG E SFF L DG  A+P  TA+DHKR  DGD GPNTGGMGA SPA  M++E+
Sbjct: 181 VVVEEFLEGEEASFFVLSDGVNALPLATAQDHKRAFDGDEGPNTGGMGAYSPAPVMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+++II PTI  M+ +  PF+GVL+AGLMIT+ GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 MDRVMKEIIHPTIADMKAQGCPFKGVLYAGLMITKDGPKLIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
           +D+L IL  C  G L      W ++ A+TVV+A+KGYP  Y   T I  + +       +
Sbjct: 301 TDLLPILLGCAEGTLDLVDAEWHSDPAVTVVMASKGYPGSYEKLTEIKGLVEAAADPDVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT + +  L +NGGRVL+ TA   T++++R  AY  +E IDW  G++R+DIG +  
Sbjct: 361 IFHAGTVVADEKLLSNGGRVLNITARAATVSQARAKAYAAIEKIDWPEGFYRKDIGWRAV 420

Query: 415 ERN 417
           ER 
Sbjct: 421 ERE 423


>gi|271498815|ref|YP_003331840.1| phosphoribosylamine/glycine ligase [Dickeya dadantii Ech586]
 gi|270342370|gb|ACZ75135.1| phosphoribosylamine/glycine ligase [Dickeya dadantii Ech586]
          Length = 429

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 189/428 (44%), Positives = 274/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENVNIAATDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  IPTA
Sbjct: 61  RQNAIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A +Y++ K  PIV+KADGL AGKGV+VA T++EA +A         F   
Sbjct: 121 EYQNFTEIEPALEYIRRKGAPIVIKADGLAAGKGVIVAMTLEEAENAATDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDQDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ +II PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMISPDGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+SD++E+  +     L     +W A  +L VV+A  GYP +Y  G +IS +P     
Sbjct: 301 LRLKSDLVELCLAACDDKLDEKTSDWDARPSLGVVLAAGGYPGDYRTGDVISGLPTQEAT 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++  NGGRVL  TALG ++ ++++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTKLNGDDVVTNGGRVLCVTALGHSVADAQQRAYELAKPIHWEGSFCRSDIGY 420

Query: 412 QKKERNVK 419
           +   R  K
Sbjct: 421 RAIAREQK 428


>gi|260460337|ref|ZP_05808589.1| phosphoribosylamine/glycine ligase [Mesorhizobium opportunistum
           WSM2075]
 gi|259033982|gb|EEW35241.1| phosphoribosylamine/glycine ligase [Mesorhizobium opportunistum
           WSM2075]
          Length = 425

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 233/425 (54%), Positives = 292/425 (68%), Gaps = 5/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWKIA SPLL++L++ PGNPGI   A+   +DI +H+AI  FC+E
Sbjct: 1   MNVLLLGSGGREHALAWKIAASPLLTKLYAAPGNPGIGSEAELAKLDITDHAAIAVFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV GI+D L A   +VFGPS+ AA+LE SK F K  C +Y IPTA Y
Sbjct: 61  KKIDLVVVGPEGPLVAGIADDLRAENIRVFGPSKAAARLEGSKGFTKDLCARYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F D   AK YV+    PIV+KADGL AGKGV VA T+DEA +A+D C    F    + 
Sbjct: 121 GRFGDLASAKAYVEKTGAPIVIKADGLAAGKGVTVAMTLDEARAALDSCFDGSFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFF LCDG TA+PF TA+DHKR+ DGD+GPNTGGMGA SPA  M+ E 
Sbjct: 181 VVIEEFMTGEEASFFCLCDGTTALPFGTAQDHKRVGDGDVGPNTGGMGAYSPAPVMTPET 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM     PF G+LFAGLMIT++GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VERTMREIIQPTMRGMANLGAPFAGILFAGLMITDKGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT-TQL 355
            D+L +LN+   G L +T + W+ + ALTVV+A +GYP     G++I  +        Q+
Sbjct: 301 DDLLVLLNAATDGQLAHTSVRWRDQAALTVVMAARGYPGTPEKGSVIRGVEDAAADGVQI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTAI    L ANGGRVL+ TA G T+ E++  AY  ++ IDW  G+ R DIG Q   
Sbjct: 361 FHAGTAINGGALVANGGRVLNVTATGATVGEAQARAYAALDRIDWPDGFCRRDIGWQAVA 420

Query: 416 RNVKY 420
           R   +
Sbjct: 421 REQAH 425


>gi|91228712|ref|ZP_01262625.1| phosphoribosylamine--glycine ligase [Vibrio alginolyticus 12G01]
 gi|91187738|gb|EAS74057.1| phosphoribosylamine--glycine ligase [Vibrio alginolyticus 12G01]
          Length = 429

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V ID+++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFIAPGNAGTALEPKLENVNIDVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTGNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQISWDGMFHRNDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|167039185|ref|YP_001662170.1| phosphoribosylamine--glycine ligase [Thermoanaerobacter sp. X514]
 gi|256750843|ref|ZP_05491727.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300913220|ref|ZP_07130537.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter sp. X561]
 gi|307723766|ref|YP_003903517.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter sp. X513]
 gi|166853425|gb|ABY91834.1| phosphoribosylamine--glycine ligase [Thermoanaerobacter sp. X514]
 gi|256750178|gb|EEU63198.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889905|gb|EFK85050.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter sp. X561]
 gi|307580827|gb|ADN54226.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter sp. X513]
          Length = 419

 Score =  352 bits (904), Expect = 4e-95,   Method: Composition-based stats.
 Identities = 167/415 (40%), Positives = 255/415 (61%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+  K++QSP + +++  PGN GI   A+CV I I +   +  F  +
Sbjct: 1   MKVLVIGGGGREHAIVHKLSQSPKVDKIYCAPGNAGIGLLAECVDIKIGDIEKLKEFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +IDL VVGPE+PLV GI D    AG K+FGP++ AA +E SK F K   +KY IPT  +
Sbjct: 61  NNIDLTVVGPEMPLVQGIVDEFEKAGLKIFGPNKNAAAIEGSKYFTKHLLSKYNIPTGRF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F    +A ++++    P+V+KADGL  GKGV +     EA          R F     
Sbjct: 121 KAFDKYQEAMKFLKETWYPVVMKADGLAQGKGVFIVKDFIEAKEALDLMMKKRIFGASGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VIIEE L G E S FA  DG+  +P  +A D+K++++GD GPNTGGMG+ +P   + +E
Sbjct: 181 IVIIEEMLFGKEASVFAFTDGENILPMVSAMDYKKVYEGDKGPNTGGMGSIAPNPYLEKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               V++ I+ P ++ +QKE   ++GVL+AGLM+T++GP ++E+N RFGDPE Q ++  L
Sbjct: 241 TLKEVMESILKPVVKALQKEGIVYKGVLYAGLMLTKEGPKVLEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D++ I+ + + G L    I W+ + A+  V  + GYP EY  G  I+ + +      +
Sbjct: 301 KTDLINIIEATIEGKLDKIQIEWEDKKAVCAVAVSNGYPGEYQTGFEITGLEKVKE-AFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +HAGTA+ +  +  +GGRVL+ T +G +  E+RE  Y  +E I ++  Y+R+DI 
Sbjct: 360 YHAGTALKDGKIVTSGGRVLAVTTIGDSYEEAREKVYREIEKISFEGMYYRKDIA 414


>gi|225848224|ref|YP_002728387.1| phosphoribosylamine--glycine ligase [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644569|gb|ACN99619.1| phosphoribosylamine--glycine ligase [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 427

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 189/430 (43%), Positives = 272/430 (63%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL++G+GGREHAL WK+ QSPL+ E++   GN GI + A  V I   +   ++ F +E
Sbjct: 1   MRVLVVGNGGREHALVWKVKQSPLVKEVYCASGNAGIGKIATRVNISPTDIYNLVRFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K+IDL +VGPE PL  GI+D   A G K+FG  + AA LE+SK FAK F  KY +PTA +
Sbjct: 61  KNIDLTIVGPEQPLSEGITDRFEAEGLKIFGHKKAAAVLEASKVFAKNFMKKYSVPTAKF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           + F +  +A +++++   PIV+KADGL AGKGVVVA T +EA  A+       F   +  
Sbjct: 121 ESFDNEKEAIEFIKSVGAPIVIKADGLAAGKGVVVAKTEEEAFQAVKDMFAGKFGPASKR 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E S+         +P  T++DHKR  D D GPNTGGMGA SP   ++ ++
Sbjct: 181 VVIEEFLEGEEASYICFVKDDKFLPMPTSQDHKRAFDNDEGPNTGGMGAYSPTSLITPQI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              + ++IILPT++GM  E  P  G L+AGLMI  +G  ++E+NVR GDPE Q +M RL+
Sbjct: 241 EKEIQERIILPTLKGMINEGRPMSGFLYAGLMIGPKGINVLEFNVRMGDPETQPIMRRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD++E +   + G++ N    W  +YA+ VV+A+KGYP+ Y  G  I+ I +        
Sbjct: 301 SDLVEHILQILEGDIDNVKPQWIEDYAIGVVMASKGYPDSYQKGFEITGIDEAEKDPDVV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  +  NGGRVL+ TA GK I ++RE  Y  VE I ++  ++R+DIG ++ 
Sbjct: 361 VFHAGTEEKDGKVITNGGRVLTVTATGKDINQAREKVYAAVEKIHFEGAFYRKDIGFREV 420

Query: 415 ERNVKYRNKS 424
            R   ++NK+
Sbjct: 421 NR---FKNKA 427


>gi|323144211|ref|ZP_08078846.1| phosphoribosylamine--glycine ligase [Succinatimonas hippei YIT
           12066]
 gi|322416052|gb|EFY06751.1| phosphoribosylamine--glycine ligase [Succinatimonas hippei YIT
           12066]
          Length = 427

 Score =  352 bits (904), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 188/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAW+ + SPL  +++  PGNPG A+    + V I + + + ++ F 
Sbjct: 1   MKVLVIGNGGREHALAWRASLSPLADKVFVAPGNPGTAREEKMENVNISVGDIAGLVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  IDL +VGPE PLV+G+ DA  A G  +FGPS+ AA+LE SKSF K F  ++ IPTA
Sbjct: 61  KDNKIDLTIVGPEAPLVDGVVDAFKAEGLTIFGPSKAAAQLEGSKSFTKDFLKRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y+ F +  KA  Y++ +  PIV+KADGL AGKGVVVA T DEA SA+        F   
Sbjct: 121 AYEIFDNAEKACAYIKEQGAPIVIKADGLAAGKGVVVAMTEDEAISAVHSMLDDHAFGNA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE++EG E SF  + D   A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFMEGEEASFIVMSDSINALPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           +++Y  V+ +II PT+EGM+K+  P+ G L+AGLMI     P ++E+N RFGDPE Q +M
Sbjct: 241 KDVYDRVMNEIINPTLEGMRKDGIPYFGFLYAGLMIGKNGAPRVVEFNCRFGDPETQPIM 300

Query: 293 MRLESDILE-ILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-T 350
           +R++SD+++  L       L    + +    A+ VV+A +GYP     G  IS + +   
Sbjct: 301 LRMQSDLVDLCLKGAKENGLQGLEVKYDPRPAVGVVLAAEGYPASPRKGDEISGLDEKTP 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             T++F AGT  V+  +  +GGRVL  TALG  I ++R+ AY ++E + +   ++R+DI 
Sbjct: 361 EGTKIFEAGTKSVDGKVVTSGGRVLCVTALGDDIKDARDRAYKLIEKVHFNGMFYRKDIA 420

Query: 411 LQKKERN 417
            +  +RN
Sbjct: 421 WRALKRN 427


>gi|261856916|ref|YP_003264199.1| phosphoribosylamine/glycine ligase [Halothiobacillus neapolitanus
           c2]
 gi|261837385|gb|ACX97152.1| phosphoribosylamine/glycine ligase [Halothiobacillus neapolitanus
           c2]
          Length = 428

 Score =  352 bits (903), Expect = 5e-95,   Method: Composition-based stats.
 Identities = 187/424 (44%), Positives = 271/424 (63%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSP +S+++  PGNPG A  ++C  + I   N + ++ F 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPRVSKVFVAPGNPGTATESKCENVSIAATNIAELLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + IDL VVGPE PLV GI D+   AG  +FGPS++AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  GREQIDLTVVGPEAPLVLGIVDSFRDAGLPIFGPSKQAAQLEGSKAFSKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQIN 174
            Y+ F++   A  YV+    PIVVKADGL AGKGV+VA +V EA +AI+      F +  
Sbjct: 121 MYRVFTEAAPAIDYVREHGAPIVVKADGLAAGKGVIVAQSVAEAEAAINDMLGGQFGEAG 180

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           + V++E +L G E SF  + DG   +P  T++DHK    GD GPNTGGMGA SP   ++ 
Sbjct: 181 ARVVVESFLSGEEASFIVMVDGGNILPMATSQDHKARDSGDTGPNTGGMGAYSPTPVVTP 240

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMM 293
           ++   V++ II PT++GM  +  P+ G L+AGLMI ++  P ++E+N RFGDPE Q +MM
Sbjct: 241 QIADIVMETIIEPTVKGMALDGIPYTGFLYAGLMIDDEGRPSVLEFNCRFGDPETQPIMM 300

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT 353
           RL+SD++++L + + G+L      W  + A+ VV+A  GYP +   G +I  +       
Sbjct: 301 RLDSDLVDLLQAGIAGSLDEVQCQWNQQTAIGVVIAAHGYPADVRTGDVIRGLDAIPNNV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++F AGT     N+   GGRVL  TALG T+ +++  AY  V+ ID+  G++R+DIG + 
Sbjct: 361 KVFQAGTRSDGANIVTAGGRVLCVTALGDTVRDAQAAAYAGVKTIDFDGGFYRDDIGWRA 420

Query: 414 KERN 417
             R 
Sbjct: 421 AARE 424


>gi|110834877|ref|YP_693736.1| phosphoribosylamine-glycine ligase [Alcanivorax borkumensis SK2]
 gi|110647988|emb|CAL17464.1| phosphoribosylamine-glycine ligase [Alcanivorax borkumensis SK2]
          Length = 432

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 263/426 (61%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQ+  +  ++  PGN G A+ A  + VA+D+ +   ++ F 
Sbjct: 5   MKVLIIGGGGREHALAWKVAQAEQVETVFVAPGNAGTAREAKLENVALDVLDQPGLLAFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  IDL +VGPE PLV G+ D     G K FGP++ AA+LE SK+F K F  +  IPT 
Sbjct: 65  KDNSIDLTIVGPEAPLVEGLVDTFQENGLKCFGPNKAAAQLEGSKAFTKDFLARQNIPTG 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D  +A  YV+ +  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 125 AYGNFTDMDEALAYVREQGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLDGNKFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+LEG E SF  + DGK  +P  T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 185 GHRVVVEEFLEGEEASFIVMVDGKNVLPMATSQDHKRAGDGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
             +Y  ++ ++I PT+EGM  E  P+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 245 DAVYKRIMDEVITPTVEGMAAEGMPYTGFLYAGLMINPDGAPKVIEYNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+SD+  +  + + G L    I W     L VV+A  GYP+ Y  G  I  + Q    
Sbjct: 305 MRLQSDLAALCLAALEGKLDQAEIQWDPRPTLGVVMAAGGYPDSYDKGDAIKGLDQADSD 364

Query: 353 -TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  +  +  +GGRVL  T +G T+ E++  AY  V+ I W++  +R DIG 
Sbjct: 365 TVKVFHAGTAEQDGQVVTSGGRVLCITGVGDTVGEAQANAYEGVKQITWRNAQYRSDIGY 424

Query: 412 QKKERN 417
           +   R 
Sbjct: 425 RAVARE 430


>gi|304399316|ref|ZP_07381181.1| phosphoribosylamine/glycine ligase [Pantoea sp. aB]
 gi|304353172|gb|EFM17554.1| phosphoribosylamine/glycine ligase [Pantoea sp. aB]
          Length = 426

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 266/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q +AI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNIAISATDVPALLEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QREKIDLTIVGPEAPLVIGVVDAFRKAGLAIFGPTQAAAQLEGSKAFTKDFLARHQIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 AYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+LEG E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMIDHTGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    AL VV+A  GYP +Y  G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAACDGKLDQKTSQWDPRPALGVVLAAGGYPGDYAQGDQIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL  TALG  +  +++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLEEDRVLTNGGRVLCVTALGDDVAAAQKRAYELTKPISWQGSFCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRK 426


>gi|254780206|ref|YP_003064619.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039883|gb|ACT56679.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 424

 Score =  352 bits (903), Expect = 6e-95,   Method: Composition-based stats.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE
Sbjct: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY
Sbjct: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE
Sbjct: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV
Sbjct: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL
Sbjct: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT 360
           EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT
Sbjct: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT 360

Query: 361 AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKY 420
           AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKY
Sbjct: 361 AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERNVKY 420

Query: 421 RNKS 424
           RNKS
Sbjct: 421 RNKS 424


>gi|227115026|ref|ZP_03828682.1| phosphoribosylamine--glycine ligase [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 428

 Score =  352 bits (902), Expect = 7e-95,   Method: Composition-based stats.
 Identities = 197/426 (46%), Positives = 274/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK +QSPL   ++  PGN G A       V I   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKASQSPLAKRVYVAPGNAGTALEPALTNVDIAATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HIDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPTQGAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ +  
Sbjct: 301 LRLRSDLVELCLAACDGTLDQKDSVWDERPSLGVVLAAGGYPADYNTGDVISGLPQQDAE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   N+  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAIERE 426


>gi|75676736|ref|YP_319157.1| phosphoribosylamine--glycine ligase [Nitrobacter winogradskyi
           Nb-255]
 gi|74421606|gb|ABA05805.1| phosphoribosylamine--glycine ligase [Nitrobacter winogradskyi
           Nb-255]
          Length = 426

 Score =  352 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 229/423 (54%), Positives = 291/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A+CVA+DI +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAGSPLVTKLWCAPGNAGIAREAECVALDIADHAAVIGFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGP + AA+LESSK F K  C   G+PTA Y
Sbjct: 61  SKVDLVVVGPEAPLAAGIVDDLAAAGIKAFGPGKAAAQLESSKGFTKDLCRDNGVPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           + F D   AK Y+     PIV+KADGL AGKGVVVA T+DEA +A+D      F    + 
Sbjct: 121 ERFRDAGAAKDYIHAHGAPIVIKADGLAAGKGVVVAMTLDEALAAVDMMFEGGFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L G E SFFALCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFLRGEEASFFALCDGEHAMPLATAQDHKRAFDGDEGPNTGGMGAYSPAPVMTDEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II+PT+  M+++  PF+GVLFAGLMITEQGP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CRRTMDEIIVPTLRAMREKGAPFKGVLFAGLMITEQGPKLIEYNVRFGDPECQVLMLRMR 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TGTTQ 354
            DI+  L +   G L++  + W  + ALTVV+A KGYP  Y  GT I  I +    G  +
Sbjct: 301 GDIVPALFAACDGQLNHFSMRWFPDPALTVVMAAKGYPGSYAKGTRIDGIDEAAKAGGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + A+GGRVL+  ALG T+ E++  AY  V+ I W  G+ R DIGL+  
Sbjct: 361 IFHAGTKEEDGRILASGGRVLNVCALGNTVAEAQARAYEAVDRITWPEGFCRRDIGLRAV 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|192359687|ref|YP_001983207.1| phosphoribosylamine--glycine ligase [Cellvibrio japonicus Ueda107]
 gi|190685852|gb|ACE83530.1| phosphoribosylamine--glycine ligase [Cellvibrio japonicus Ueda107]
          Length = 445

 Score =  352 bits (902), Expect = 8e-95,   Method: Composition-based stats.
 Identities = 192/426 (45%), Positives = 277/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQS  + +++  PGN G A     + VAID+ + +A+ +F 
Sbjct: 18  MNILIIGSGGREHALAWKAAQSAQVDKVFVAPGNAGTALEPRLENVAIDVLDFAALANFA 77

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ H+ L +VGPE+PLV G+ D   A     FGPS+ AA+LE SK+F K F  ++ IPTA
Sbjct: 78  EQNHVGLTIVGPEVPLVAGVVDYFQARHLLCFGPSKGAAQLEGSKAFTKDFLARHKIPTA 137

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F +   A  Y++ K  PIVVKADGL AGKGV+VA T+++A +A+        F   
Sbjct: 138 DYQNFVEVEPALAYLREKGAPIVVKADGLAAGKGVIVAETLEQAEAAVRDMLSGNAFGDA 197

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 198 GCRVVIEEFLSGEEASFIVMVDGNNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 257

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             ++  +++++I PT++GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 258 AAVHERIMREVIYPTVQGMAAEGNTYVGFLYAGLMIDASGAPKVIEYNCRFGDPETQPIM 317

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +RL+SD++ +  + + G+L NT  +W +  ++ VV+A  GYP+ Y  G IIS +P     
Sbjct: 318 LRLQSDLVALCLAALKGDLGNTTADWDSRASVGVVLAAGGYPDAYAKGDIISGLPTVDLA 377

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +     NGGRVL ATALG T++E+++ AY + + I WK  ++R+DI  
Sbjct: 378 GEKVFHAGTALKDGQTVTNGGRVLCATALGNTVSEAQQRAYTLAQQISWKDMFYRKDIAY 437

Query: 412 QKKERN 417
           +   R 
Sbjct: 438 RAIARE 443


>gi|308188922|ref|YP_003933053.1| phosphoribosylamine--glycine ligase [Pantoea vagans C9-1]
 gi|308059432|gb|ADO11604.1| phosphoribosylamine--glycine ligase [Pantoea vagans C9-1]
          Length = 426

 Score =  351 bits (901), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 266/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLAETVFVAPGNAGTALEPALQNVAIGATDIPALLEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QREKIDLTIVGPEAPLVIGVVDAFREAGLAIFGPTQAAAQLEGSKAFTKDFLARHQIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 AYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMIDHTGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    AL VV+A  GYP +Y  G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAACDGKLDQKTSQWDPRPALGVVLAAGGYPGDYAQGDQIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL  TALG  +  +++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLEEDRVLTNGGRVLCVTALGDDVAAAQKRAYELTKPISWQGSFCRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRK 426


>gi|68249475|ref|YP_248587.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae
           86-028NP]
 gi|68057674|gb|AAX87927.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae
           86-028NP]
          Length = 429

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 191/429 (44%), Positives = 270/429 (62%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPAKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALTYLREKGTPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVIT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E + + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGSVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDPRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNVKY 420
           +  ER    
Sbjct: 421 RAVEREQAK 429


>gi|326390911|ref|ZP_08212462.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993059|gb|EGD51500.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 419

 Score =  351 bits (901), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 165/415 (39%), Positives = 256/415 (61%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+  K++QSP + +++  PGN GI   A+CV I + +   +  F  +
Sbjct: 1   MKVLVIGGGGREHAIVHKLSQSPKVDKIYCAPGNAGIGLLAECVDIKVGDIEKLKEFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE+PLV GI D    AG K+FGP++ AA +E SK F K+  +KY IPT  +
Sbjct: 61  NDIDLTVVGPEMPLVQGIVDEFEKAGLKIFGPNKGAAAVEGSKYFTKQLLSKYNIPTGRF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F    +A ++++    P+V+KADGL  GKGV +     EA          R F     
Sbjct: 121 KAFDKYQEALKFLKETWYPVVMKADGLAQGKGVFIVKDFIEAKEALDLMMKKRIFGASGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VIIEE L G E S FA  DG+  +P  +A D+K+I++GD GPNTGGMG+ +P   + +E
Sbjct: 181 IVIIEEMLFGKEASVFAFTDGENILPMVSAMDYKKIYEGDKGPNTGGMGSIAPNPYLEEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               V++ I+ P ++ +QKE   ++GVL+AGLM+T++GP ++E+N RFGDPE Q ++  L
Sbjct: 241 TLKEVMESILKPVVKALQKEGIVYKGVLYAGLMLTKEGPKVLEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+++I+ + + G L    I W+ + A+  V  + GYP EY  G  I+ + +      +
Sbjct: 301 KTDLIDIMEATIEGKLDKIQIEWEDKKAVCAVAVSNGYPGEYQTGFEITGLEKVKE-AFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +HAGT + +  +  +GGRVL+ T++G +  E+RE  Y  ++ I ++  Y+R+DI 
Sbjct: 360 YHAGTVLKDGKIVTSGGRVLAVTSIGDSYEEAREKVYREIKKIRFEGMYYRKDIA 414


>gi|152972867|ref|YP_001338013.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238892481|ref|YP_002917215.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262043754|ref|ZP_06016857.1| phosphoribosylamine-glycine ligase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|150957716|gb|ABR79746.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|238544797|dbj|BAH61148.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259038878|gb|EEW40046.1| phosphoribosylamine-glycine ligase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 431

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQNVAIGVTDIPALLRFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+++IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDENIDLTIVGPEAPLVIGVVDAFRAAGLNIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R++SD++E+  +   G L      W    +L VVVA  GYP  Y  G  I  +PQ    
Sbjct: 301 LRMKSDLVELCLAACAGKLDEKTSEWDDRASLGVVVAAGGYPGSYNTGDEIYGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG ++ ++++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLSDDQRVVTNGGRVLCVTALGDSVAQAQQRAYQLLTDIRWDGSFSRSDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|163782561|ref|ZP_02177558.1| phosphoribosylamine-glycine ligase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882134|gb|EDP75641.1| phosphoribosylamine-glycine ligase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 423

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 177/422 (41%), Positives = 263/422 (62%), Gaps = 9/422 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G+GGREHA+AWK+ QSPL+S+L+   GN GI + A+ V I      A+  F  +
Sbjct: 1   MKVLVVGNGGREHAIAWKLRQSPLISKLYCAQGNAGIWKIAERVDIPPTEVEALADFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID  VVGPE PLV GI D     G K+FGPSQ A++LE SK+FAK F  K+G+PTA Y
Sbjct: 61  EGIDFTVVGPEAPLVKGIVDEFEKRGLKIFGPSQEASQLEGSKAFAKNFMEKHGVPTAHY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
             F +  +A +Y+++   PIV+KADGL AGKG VV+ ++D A   ++             
Sbjct: 121 SVFDNFDRAVRYLKDVGTPIVIKADGLAAGKGAVVSFSLDHALHTLEGFMKKSALGGAGR 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S+  + +G   +P  T++DHKR+ DGD GPNTGGMGA SP   + + 
Sbjct: 181 RVVIEEFLEGEEASYIVMVNGDRYVPLPTSQDHKRLLDGDRGPNTGGMGAYSPTPVIDKY 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   + +++I  T++G+++E   F+G L+AGLMIT +GP ++E+NVR GDPE Q ++MR+
Sbjct: 241 MEGRIREEVIERTLKGLKEEGIYFRGFLYAGLMITSEGPKVLEFNVRLGDPEAQPILMRV 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TT 353
           ++D L  L     G      I     ++L VV+A+KGYPE+   G +I  + +       
Sbjct: 301 KNDFLRTLLEFYEG--KEVSIEEDHRWSLDVVLASKGYPEKPEKGKVIEGLEEVEDLSDV 358

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT + +  +  NGGRVL+  A G T+ E+++ AY  V  I ++   +R+DIG + 
Sbjct: 359 VVFHAGTTLKDGKVVTNGGRVLNVCAYGDTLKEAKDRAYKAVSRIRFEGMQYRKDIGDKA 418

Query: 414 KE 415
             
Sbjct: 419 FR 420


>gi|145628186|ref|ZP_01783987.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae
           22.1-21]
 gi|144979961|gb|EDJ89620.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae
           22.1-21]
          Length = 429

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 270/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPAKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALVYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E + + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGSVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDPRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|119946825|ref|YP_944505.1| phosphoribosylamine--glycine ligase [Psychromonas ingrahamii 37]
 gi|119865429|gb|ABM04906.1| phosphoribosylamine--glycine ligase [Psychromonas ingrahamii 37]
          Length = 429

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 190/429 (44%), Positives = 273/429 (63%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ+  +  ++  PGN G A  A+   VAID+++   ++ F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQNKQVKNIFVAPGNAGTALEAKVTNVAIDVEDIDGLVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  ++L +VGPE PLV G+ DA   AG   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENRVELTIVGPEAPLVIGVVDAFTDAGLACFGPTKGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T+ +A  AI        F   
Sbjct: 121 WYQNFTEIEPAIAYVREKGAPIVIKADGLAAGKGVIVAMTLADAEEAIHDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGENIVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  ++  +I PT++GM  E N + G L+AGLMI  +  P +IEYN RFGDPE Q ++
Sbjct: 241 PEMHQRIMDLVINPTVKGMAAEGNSYSGFLYAGLMIMADGTPKVIEYNCRFGDPETQPLL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R++SD++ +  + V+G L +    +    A+ +V+A  GYP EY  G +I  +P     
Sbjct: 301 LRMKSDLVTLCLAGVNGELADMTAEFDQRAAIGIVLAAGGYPNEYKKGLVIEGLPDQEME 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FH GT  V+  +  NGGRVL ATALG T+TE+++ AY + + I W   ++R DI  
Sbjct: 361 GLKVFHGGTKEVDGQIVTNGGRVLCATALGNTVTEAQQKAYALAKTISWDGMFYRHDIAH 420

Query: 412 QKKERNVKY 420
           +   R  K 
Sbjct: 421 RAIAREQKK 429


>gi|145632261|ref|ZP_01787996.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae 3655]
 gi|144987168|gb|EDJ93698.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae 3655]
          Length = 428

 Score =  351 bits (900), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 271/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL+ +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLVDKVFVAPGNAGTALEQKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ D    AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVVGVVDTFRKAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAENAVHDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSQVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM +E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMREVIYPTVNGMAEEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W  + +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVTSRWDPQASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVLRE 426


>gi|241203325|ref|YP_002974421.1| phosphoribosylamine--glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857215|gb|ACS54882.1| phosphoribosylamine/glycine ligase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 425

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 230/422 (54%), Positives = 300/422 (71%), Gaps = 4/422 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL+SE ++ PGNPGIA+HA  V +DI++H A++ FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMSEFYAAPGNPGIAEHAVLVPVDIEDHEAVVAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK Y++ + +PIVVKADGL AGKGV VA T+DEA +A+D CF        + 
Sbjct: 121 QRFNNGPKAKAYIRAEGVPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +  +PF GV FAGLMIT++GP LIEYNVRFGDPECQ MMMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITKKGPELIEYNVRFGDPECQVMMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L      W  + ALTVV+A+KGYP  Y   T I  +P      ++F
Sbjct: 301 SDLLPLLLATANGTLDQVKAEWNEDPALTVVMASKGYPGAYDKNTPILSLPDAGKGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E++  AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTASGGTVAEAKSRAYALLDRVRWENGFCRRDIGWRAIER 420

Query: 417 NV 418
            +
Sbjct: 421 EM 422


>gi|16272828|ref|NP_439049.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae Rd
           KW20]
 gi|260579979|ref|ZP_05847809.1| phosphoribosylamine-glycine ligase [Haemophilus influenzae RdAW]
 gi|1172752|sp|P43845|PUR2_HAEIN RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|1573905|gb|AAC22545.1| phosphoribosylamine--glycine ligase (purD) [Haemophilus influenzae
           Rd KW20]
 gi|260093263|gb|EEW77196.1| phosphoribosylamine-glycine ligase [Haemophilus influenzae RdAW]
          Length = 429

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 271/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPAKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALTYLREKGTPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  +++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMASSQDHKRVGENDTGLNTGGMGAYSPAPVIT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDLRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|118444451|ref|YP_878491.1| phosphoribosylformylglycinamidine synthase [Clostridium novyi NT]
 gi|118134907|gb|ABK61951.1| phosphoribosylformylglycinamidine synthase [Clostridium novyi NT]
          Length = 1664

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 183/421 (43%), Positives = 270/421 (64%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHA+ WK++QS L+ +++  PGN G A+  +C  I ++   ++++F ++
Sbjct: 1   MKVLVIGSGGREHAIVWKVSQSALVDKIYCAPGNGGTAKEDKCENISLEGIDSLLNFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++IDL +VGPE PLV GI D    +  K+FGPS+ AAKLE SKSF+K+F  KYG+ TA Y
Sbjct: 61  ENIDLTIVGPEAPLVEGIVDKFKESDLKIFGPSKEAAKLEGSKSFSKEFMKKYGVKTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F D   A +Y++  + P V+KADGL AGKGVV+  T DEA        +   F+    
Sbjct: 121 EVFEDIKSATEYLETCNYPTVIKADGLAAGKGVVICKTRDEAKKALEDFMLHDIFKGAGL 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E S  ++ DG+T IPF +++DHK+I DGD GPNTGGMG   P    + E
Sbjct: 181 KVVIEEFLEGVEASILSVTDGETIIPFISSKDHKQIFDGDKGPNTGGMGVIVPNFYCTDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + +   ++I+ PT+EG++KE   + G +F G+MIT+ G YL+EYNVR GDPE Q ++  +
Sbjct: 241 VLNEFNEEILKPTLEGIKKENMDYTGTIFFGIMITKNGVYLLEYNVRMGDPETQGVLTLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD  E++   +   L +  I WK  +   V   +KGYP  Y  G  I  + ++   +++
Sbjct: 301 ESDYTELMLKAIDRKLCDYEIKWKDGHVCCVTAVSKGYPGSYEKGFEIKGLEKS--DSKV 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           F AG    N  L  NGGRVL+  A GKT+ ++++ AY  +E ID++  Y+R DIG +K +
Sbjct: 359 FIAGAKEENGKLLTNGGRVLNVVAFGKTLNDAKKKAYKDIEKIDFEGMYYRHDIGNKKVK 418

Query: 416 R 416
           R
Sbjct: 419 R 419


>gi|262273287|ref|ZP_06051102.1| phosphoribosylamine--glycine ligase [Grimontia hollisae CIP 101886]
 gi|262222660|gb|EEY73970.1| phosphoribosylamine--glycine ligase [Grimontia hollisae CIP 101886]
          Length = 429

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 196/426 (46%), Positives = 280/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+AQS  ++ ++  PGN G A     + VAI +++ +A++ F 
Sbjct: 1   MDVLVIGNGGREHALAWKVAQSEKVNTVYVAPGNAGTALEPKLENVAIGVEDITALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK IDL +VGPE PLV G+ DA   AG  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKSIDLTIVGPEAPLVIGVVDAFQEAGLPIFGPTAAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+ K  PIVVKADGL AGKGV+VA T++EA +AI        F + 
Sbjct: 121 EYQNFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAENAIRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E +P+ G L+AGLM+  +  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHDRVMNEVIFPTVRGMAAEGHPYTGFLYAGLMVMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++E+  + + G L      W    ++ VV+A  GYP  Y  G +IS +P     
Sbjct: 301 LRLQSDLVELCEAAIAGRLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPMAELN 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  + N+   GGRVL ATA+G+T++E+++ AY +   I W   ++R DIG 
Sbjct: 361 AAKVFHAGTAERDGNVVTAGGRVLCATAMGETVSEAQKRAYELASQISWDGMFYRNDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|37681327|ref|NP_935936.1| phosphoribosylamine--glycine ligase [Vibrio vulnificus YJ016]
 gi|37200078|dbj|BAC95907.1| phosphoribosylamine-glycine ligase [Vibrio vulnificus YJ016]
          Length = 444

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 16  MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 75

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 76  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 135

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 136 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 195

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 196 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 255

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 256 PEIHNRVMQEVIFPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 315

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 316 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 375

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 376 GEKVFHAGTENKGGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWDGMFHRNDIGY 435

Query: 412 QKKERN 417
           +   R 
Sbjct: 436 RAIARE 441


>gi|145638292|ref|ZP_01793902.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittII]
 gi|145272621|gb|EDK12528.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittII]
 gi|309751444|gb|ADO81428.1| Phosphoribosylamine-glycine ligase [Haemophilus influenzae R2866]
          Length = 429

 Score =  351 bits (899), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 268/427 (62%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP + AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPIKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PTI GM  E   + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTINGMAAEGYVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDTRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|299134219|ref|ZP_07027412.1| phosphoribosylamine/glycine ligase [Afipia sp. 1NLS2]
 gi|298590966|gb|EFI51168.1| phosphoribosylamine/glycine ligase [Afipia sp. 1NLS2]
          Length = 421

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 220/419 (52%), Positives = 286/419 (68%), Gaps = 2/419 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA S  L++LW  PGN GIA+ A+C+A+D+ +H+A++ FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAASAELAKLWCAPGNAGIAREAECIALDVADHAAVVAFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGPS+ A++LESSK F K  C    IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAAAGIKAFGPSKAASQLESSKGFTKDLCKANNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           + F D   AK YV  +  PIVVKADGL AGKGVVVA T+ EA +A+D  F    +  +IE
Sbjct: 121 ERFKDAAAAKAYVHAQGAPIVVKADGLAAGKGVVVAMTLAEADAALDALFSSAGAEAVIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E++EG E SFF LCDG  A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+  + +  
Sbjct: 181 EFMEGEEASFFVLCDGDHALPLATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTDAMIART 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+  M+ +  P++GVLFAGLMIT +GP LIEYNVRFGDPE Q +MMR+ SD++
Sbjct: 241 MDEIIRPTLRAMKDKGMPYKGVLFAGLMITAEGPKLIEYNVRFGDPETQVLMMRMMSDLV 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TGTTQLFHA 358
             L + V G L +  + W  + ALTVV+A KGYP +Y  G++IS + +       ++FHA
Sbjct: 301 PALMAAVDGELQHFDLRWYPQSALTVVMAAKGYPGDYIKGSVISGLDEAGSLEGVEIFHA 360

Query: 359 GTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           GT      + ANGGRVL+ TA+G  + ++++ AY  V+ I W  G+ R DIG Q  +R 
Sbjct: 361 GTKSDGARILANGGRVLNVTAIGDNVGQAQQRAYQAVDRIQWPEGFCRRDIGWQAIKRE 419


>gi|302390048|ref|YP_003825869.1| phosphoribosylamine--glycine ligase [Thermosediminibacter oceani
           DSM 16646]
 gi|302200676|gb|ADL08246.1| phosphoribosylamine--glycine ligase [Thermosediminibacter oceani
           DSM 16646]
          Length = 417

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 197/416 (47%), Positives = 274/416 (65%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHAL WKIAQSP + +++ +PGN GIA  AQCV I  ++   +  F Q+
Sbjct: 1   MKVLVVGGGGREHALVWKIAQSPRVKKIFCLPGNAGIAALAQCVDIKAEDVKGLAGFAQK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PLV GI D     G ++FGPS+ AA++E SK FAK+   KYGIPTA Y
Sbjct: 61  QGIDLTVVGPEAPLVAGIVDEFEKRGLRIFGPSKAAARIEGSKVFAKELMKKYGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F DP +A +Y++    P+V+KA+GL AGKGV+VA   +EA         D  F     
Sbjct: 121 RVFDDPEEAGRYIREAETPLVIKAEGLAAGKGVMVAREREEALDAVKSIMKDGIFGDSGR 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG EV+  A CDG TA+P   +RD+KR +D D GPNTGGMGA SPA   + +
Sbjct: 181 RVVIEEFLEGREVTVLAFCDGVTAVPMECSRDYKRAYDKDRGPNTGGMGAVSPAHYYTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V + II  T+E M+ E  PF+GVL+AGLM+T +GP ++E+N RFGDPE Q ++ RL
Sbjct: 241 VSEYVNKNIIQKTLEAMRLEGIPFKGVLYAGLMLTSKGPKVLEFNCRFGDPETQVVVPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQ 354
           ++D+++++ + + G L   +INW  E A+ VV+A+ GYP +Y  G  I+ I         
Sbjct: 301 KTDLVDVIEAVIEGRLSECNINWTGEKAVCVVLASAGYPGDYEKGKEIAGIEDAEGEGAM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +FHAGTA+ +  +   GGRVL  TALG+T  E+RE+AY  V  I +   ++R+DIG
Sbjct: 361 VFHAGTALKDGKIITAGGRVLGVTALGRTEEEAREIAYRAVSRIRFDGMHYRKDIG 416


>gi|209886358|ref|YP_002290215.1| phosphoribosylamine--glycine ligase [Oligotropha carboxidovorans
           OM5]
 gi|209874554|gb|ACI94350.1| phosphoribosylamine--glycine ligase [Oligotropha carboxidovorans
           OM5]
          Length = 421

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 222/419 (52%), Positives = 286/419 (68%), Gaps = 2/419 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA S  L++LW  PGN GIA+ A+C+A+D+ +H A+I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAASTELTKLWCAPGNAGIARDAECIALDVADHEAVIAFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L A   K FGP++ A++LESSK F K  C  + IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAAHDIKAFGPTRAASQLESSKGFTKDLCRAHNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           + F D   AK YV+ K  PIVVKADGL AGKGVVVAAT+ EA +AID  F    +  ++E
Sbjct: 121 ERFKDADSAKAYVRAKGAPIVVKADGLAAGKGVVVAATLAEAEAAIDALFASAGAEAVVE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E+L+G E SFF LCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+  + +  
Sbjct: 181 EFLQGEEASFFVLCDGEHALPLATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTDAMVART 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           + +II PT+  M++   P++GVLFAGLM+T QGP LIEYNVRFGDPE Q +MMRL SD++
Sbjct: 241 MDEIIRPTLRAMKERGMPYKGVLFAGLMVTPQGPKLIEYNVRFGDPETQVLMMRLMSDLV 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQLFHA 358
             L + V G L +  + W  + ALTVV+A +GYP  Y  G++IS +   +     ++FHA
Sbjct: 301 PALVAAVDGELAHFDLRWYPQPALTVVMAAQGYPGNYIKGSLISGLDDASRVEGVEIFHA 360

Query: 359 GTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           GT      + ANGGRVL+ TA GKT+ E++  AY  ++ I W  G+ R DIG Q  +R 
Sbjct: 361 GTRADGTRVLANGGRVLNVTATGKTVGEAQRRAYQAIDQIKWPEGFCRRDIGWQAIKRE 419


>gi|56749649|sp|Q7MGT4|PUR2_VIBVY RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
          Length = 429

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 1   MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIFPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTENKGGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWDGMFHRNDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|260581716|ref|ZP_05849513.1| phosphoribosylamine-glycine ligase [Haemophilus influenzae NT127]
 gi|260095309|gb|EEW79200.1| phosphoribosylamine-glycine ligase [Haemophilus influenzae NT127]
          Length = 429

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 272/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ D    AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDTFRKAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAENAVHDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK      T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSQVVIEEFLDGEEASFIVMVDGKNVESMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+YS +++++I PT+ GM +E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIYSRIMREVIYPTVNGMAEEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W  + +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVTSRWDPQASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|154251075|ref|YP_001411899.1| phosphoribosylamine--glycine ligase [Parvibaculum lavamentivorans
           DS-1]
 gi|154155025|gb|ABS62242.1| phosphoribosylamine--glycine ligase [Parvibaculum lavamentivorans
           DS-1]
          Length = 427

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 219/423 (51%), Positives = 274/423 (64%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L+IGSGGREHAL W I +SPL   L+  PGN GIA  A+CV++   +  AI+ F +E
Sbjct: 1   MNILVIGSGGREHALCWAIRKSPLCDVLYCAPGNGGIAGVAECVSLSPNDFDAIVAFVRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I  VVVGPE PLVNG+ D L+A G K FGPS  AA+LE SK F K  C ++GIPTA Y
Sbjct: 61  KKIGFVVVGPEDPLVNGLVDRLDAEGIKSFGPSAAAARLEGSKGFTKDLCAEFGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDR----CFQQINST 176
             F D   AK +V  K  PIVVKADGL AGKGV VA T  EA +AID      F    + 
Sbjct: 121 GRFQDAAAAKSFVAAKGAPIVVKADGLAAGKGVTVAMTEAEAAAAIDEIFSGRFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+LEG E SFFALCDG   +   TA+DHKR+ D D GPNTGGMGA SPA  M+ EL
Sbjct: 181 VVVEEFLEGEEASFFALCDGNYVLALATAQDHKRVFDNDQGPNTGGMGAYSPAPVMTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            S  +++I+ PT+  M+    PF+GVL+AGLMIT +GP LIEYN RFGDPE Q +MMRL 
Sbjct: 241 SSRAMKEIVEPTVAAMRARGTPFKGVLYAGLMITAEGPKLIEYNARFGDPETQVLMMRLA 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTTQ 354
           SD+L +L +   G L +   +WK E ALTVV+A +GYP +Y   T I  + +       +
Sbjct: 301 SDVLPLLIASHDGTLADAECHWKDEVALTVVMAAEGYPGDYKKNTEIKGLAEAGAIDGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + A GGRVL+ TA GK+  E++  AY  V  IDW  G+ R DIG +  
Sbjct: 361 IFHAGTKAEDGKIYATGGRVLNVTASGKSTAEAQARAYRAVAKIDWPQGFCRRDIGYRAI 420

Query: 415 ERN 417
           ER 
Sbjct: 421 ERE 423


>gi|116250721|ref|YP_766559.1| phosphoribosylamine--glycine ligase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115255369|emb|CAK06444.1| putative phosphoribosylamine--glycine ligase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 425

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 226/421 (53%), Positives = 296/421 (70%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPL++E ++ PGNPGIA+HA  VA++I++H A+  FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLMTEFYAAPGNPGIAEHAVLVALNIEDHEAVAAFCKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G+ D L A G  VFGPS  AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLVDRLRADGLAVFGPSAAAAQLEGSKGFTKDICARYDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+D+A +A+D CF        + 
Sbjct: 121 QRFNNGPKAKSYIRAQGAPIVVKADGLAAGKGVTVAMTLDDALAAVDDCFEGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK  +P  TA+DHKR+ +GDIG NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKHVLPLATAQDHKRVGEGDIGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +  +PF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTMRGMAESGHPFSGVFFAGLMITRKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  +G L     +W  + ALTVV+A+KGYP  Y   T I  +P      ++F
Sbjct: 301 SDLLPLLLATANGTLDQVSADWSDDPALTVVMASKGYPGAYEKNTPILSLPDAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E++  AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGLKDGALVATGGRVLNVTASGGTVAEAKSRAYALLDRVRWENGFCRRDIGWRAIER 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|307266303|ref|ZP_07547843.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306918681|gb|EFN48915.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 419

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 163/415 (39%), Positives = 253/415 (60%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+  K++QSP + +++  PGN GI   A+CV I + +   +  F  +
Sbjct: 1   MKVLVIGGGGREHAIVHKLSQSPKVDKIYCAPGNAGIGLLAECVDIKVGDIEKLKEFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +IDL VVGPE+PLV GI D     G K+FGP++ AA +E SK F K+  +KY I T  +
Sbjct: 61  NNIDLTVVGPEMPLVQGIVDEFEKVGLKIFGPNKSAAAIEGSKYFTKQLLSKYNILTGRF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F    +A ++++    P V+KADGL  GKGV +     EA          R F     
Sbjct: 121 KAFDKYQEALKFLKETWYPAVMKADGLAQGKGVFIVKDFIEAKEALDLMMKKRIFGASGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +IIEE L G E S FA  DG+  +P  +A D+K+I++GD GPNTGGMG+ +P   + +E
Sbjct: 181 IIIIEEMLFGKEASVFAFTDGENILPMVSAMDYKKIYEGDKGPNTGGMGSIAPNPYLEEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               V++ I+ P ++ +QKE   ++GVL+AGLM+T++GP ++E+N RFGDPE Q ++  L
Sbjct: 241 TLKEVMESILKPMVKALQKEGIVYKGVLYAGLMLTKEGPKVLEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+++I+ + + G L    I W+ + A   V  + GYP EY  G  I+ + +      +
Sbjct: 301 KTDLIDIMEATIEGKLDKIQIEWEDKKAACAVAVSNGYPGEYQTGFEITGLEKVKE-AFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +HAGT + +  +  +GGRVL+ T++G +  E+RE  Y  ++ I +K  Y+R+DI 
Sbjct: 360 YHAGTVLKDGKIVTSGGRVLAVTSIGDSYEEAREKVYREIKKISFKGMYYRKDIA 414


>gi|322515407|ref|ZP_08068399.1| phosphoribosylamine-glycine ligase [Actinobacillus ureae ATCC
           25976]
 gi|322118562|gb|EFX90794.1| phosphoribosylamine-glycine ligase [Actinobacillus ureae ATCC
           25976]
          Length = 428

 Score =  350 bits (898), Expect = 2e-94,   Method: Composition-based stats.
 Identities = 197/426 (46%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A     + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F T++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLTRHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDSGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           + ++  V+ +II PT++GM  E  P+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 KAIHQRVMDEIIYPTVQGMASENTPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++E+      G L +    W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVELCLKACEGKLDSVQSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++  +++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFAAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|167038103|ref|YP_001665681.1| phosphoribosylamine--glycine ligase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|320116509|ref|YP_004186668.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166856937|gb|ABY95345.1| phosphoribosylamine--glycine ligase [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|319929600|gb|ADV80285.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 419

 Score =  350 bits (898), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 167/415 (40%), Positives = 256/415 (61%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+  K++QSP + +++  PGN GI   A+CV I I +   +  F  +
Sbjct: 1   MKVLVIGGGGREHAIVHKLSQSPKVDKIYCAPGNAGIGLLAECVDIKIGDIEKLKEFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +IDL VVGPE+PLV GI D    AG K+FGP++ AA +E SK F K   +KY IPT  +
Sbjct: 61  NNIDLTVVGPEMPLVQGIVDEFEKAGLKIFGPNKNAAAIEGSKYFTKHLLSKYNIPTGRF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F    +A ++++    P+V+KADGL  GKGV +     EA          R F     
Sbjct: 121 KAFDKYQEAMKFLKETWYPVVMKADGLAQGKGVFIVKDFIEAKEALDLMMKKRIFGASGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VIIEE L G E S FA  DG+  +P  +A D+K++++GD GPNTGGMG+ +P   + +E
Sbjct: 181 IVIIEEMLFGKEASVFAFTDGENILPMVSAMDYKKVYEGDKGPNTGGMGSIAPNPYLEKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               V++ I+ P ++ +QKE   ++GVL+AGLM+T++GP ++E+N RFGDPE Q ++  L
Sbjct: 241 TLKEVMESILKPVVKALQKEGIVYKGVLYAGLMLTKEGPKVLEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D++ I+ + + G L    I W+ + A+  V  + GYP EY  G  I+ + +      +
Sbjct: 301 KTDLINIIEATIEGKLDKIQIEWEDKKAVCAVAVSNGYPGEYQTGFEITGLEKVKE-AFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +HAGT + +  +T +GGRVL+ T++G +  E+RE  Y  ++ I +K  Y+R+DI 
Sbjct: 360 YHAGTVLKDGKITTSGGRVLAVTSIGDSYEEAREKVYREIKKISFKGMYYRKDIA 414


>gi|307129004|ref|YP_003881020.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Dickeya dadantii 3937]
 gi|306526533|gb|ADM96463.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Dickeya dadantii 3937]
          Length = 429

 Score =  350 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 277/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENVNIAATDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  IPTA
Sbjct: 61  RQNTIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A         F   
Sbjct: 121 EYQNFTEIEPALAYIRRKGAPIVIKADGLAAGKGVIVAMTLEEAENAATDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++E+  +   G L     +W A  +L VV+A  GYP +Y +G +IS +P Q+  
Sbjct: 301 LRLKSDLVELCLAACDGKLDEKTSDWDARPSLGVVLAAGGYPADYRNGDVISGLPTQDAT 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++  NGGRVL  TALG ++ E+++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLNGDDVVTNGGRVLCVTALGHSVAEAQQRAYELAKPISWEGSFCRSDIGY 420

Query: 412 QKKERNVKY 420
           +   R  K 
Sbjct: 421 RAIAREQKI 429


>gi|27364629|ref|NP_760157.1| phosphoribosylamine--glycine ligase [Vibrio vulnificus CMCP6]
 gi|31076952|sp|Q8DD07|PUR2_VIBVU RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|27360774|gb|AAO09684.1| Phosphoribosylamine--glycine ligase [Vibrio vulnificus CMCP6]
          Length = 429

 Score =  350 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 1   MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIFPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W+  + R DIG 
Sbjct: 361 GEKVFHAGTENKEGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWEGMFHRNDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|301154809|emb|CBW14272.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Haemophilus parainfluenzae T3T1]
          Length = 429

 Score =  350 bits (897), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  ++++ PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFAAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHDRIMREVIYPTVNGMAAEGNVYTGFLYAGLMIMSNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RLESD++E+      G L      W  + +L +V+A +GYP +Y  G +IS +PQ    
Sbjct: 301 LRLESDLIELCLKACEGKLDEVKSQWNPKASLGIVLAAEGYPGDYRKGDVISGLPQSAVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ ++++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEKEGKLVTNGGRVLCVTALGESVFDAQQKALKLAEQIQWTGRFYRRDIGY 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAVERE 426


>gi|118590710|ref|ZP_01548111.1| phosphoribosylamine--glycine ligase [Stappia aggregata IAM 12614]
 gi|118436686|gb|EAV43326.1| phosphoribosylamine--glycine ligase [Stappia aggregata IAM 12614]
          Length = 425

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 222/424 (52%), Positives = 286/424 (67%), Gaps = 5/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++LLIGSGGREHALAW +A+SP L++L++ PGN GIA+ A+   ++  +H A+I FC++
Sbjct: 1   MKLLLIGSGGREHALAWALAKSPKLTKLYAAPGNAGIAEVAELCNLNTTDHQAVIGFCRD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV G+ D L AAG K FGPS+ AA+LE SK+F K  C +  IPTA Y
Sbjct: 61  HEIDLVVVGPEAPLVAGLVDDLEAAGIKAFGPSKAAAQLEGSKAFTKGVCDEADIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F     A  YV+ +  PIVVKADGL AGKGVVVA T+ EA  A+  C    F +  + 
Sbjct: 121 GRFDTAEDALTYVRKQGAPIVVKADGLAAGKGVVVAMTLKEAEDAVTACFEGSFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E SFF L DG  A+P  TA+DHKR +DGD GPNTGGMGA SPA  ++  L
Sbjct: 181 VVIEEFLEGEEASFFVLSDGTNALPLATAQDHKRAYDGDEGPNTGGMGAYSPAPVLTDAL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V++ II PTI  + K   PF+GVL+AGLMI + GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 IADVMRTIIEPTIATLAKRGTPFKGVLYAGLMIGKNGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTGTTQL 355
           SD+L++L + V G L     +W+ E ALTVV+A KGYP  Y  GT I  +    T    +
Sbjct: 301 SDLLDLLLASVEGRLDQMTADWRDEAALTVVMAAKGYPGSYDKGTEIRGLDTAATDDVAV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT      + ANGGRVL+ TA+G T+ E+++ AY  + +IDW  G+ R DIG +   
Sbjct: 361 FHAGTKRNGTQILANGGRVLNVTAVGATVHEAQQRAYERIRDIDWPEGFCRSDIGWRAIA 420

Query: 416 RNVK 419
           R  +
Sbjct: 421 RESE 424


>gi|251791420|ref|YP_003006141.1| phosphoribosylamine--glycine ligase [Dickeya zeae Ech1591]
 gi|247540041|gb|ACT08662.1| phosphoribosylamine/glycine ligase [Dickeya zeae Ech1591]
          Length = 429

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 190/428 (44%), Positives = 274/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENVNITATDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  +  IPTA
Sbjct: 61  RQNAIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARQHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A         F   
Sbjct: 121 EYQNFTEIEPALDYIRRKGAPIVIKADGLAAGKGVIVAMTLEEAENAATDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDQDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ +II PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+SD++E+  +   G L     +W A  +L VV+A  GYP +Y  G +IS +P     
Sbjct: 301 LRLKSDLVELCLAACDGKLDEKTSDWDARPSLGVVLAAGGYPGDYRTGDVISGLPTQEAT 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++  NGGRVL  TALG ++ ++++ AY + + I W+  + R DIG 
Sbjct: 361 DGKVFHAGTKLNGDDVMTNGGRVLCVTALGHSVADAQQRAYELAKPISWEGSFCRSDIGY 420

Query: 412 QKKERNVK 419
           +   R  K
Sbjct: 421 RAIAREQK 428


>gi|86356532|ref|YP_468424.1| phosphoribosylamine--glycine ligase [Rhizobium etli CFN 42]
 gi|86280634|gb|ABC89697.1| phosphoribosylamine-glycine ligase protein [Rhizobium etli CFN 42]
          Length = 427

 Score =  349 bits (896), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 234/428 (54%), Positives = 299/428 (69%), Gaps = 5/428 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+AQSPLLSE ++ PGNPGIA+HA    ++I +H  +  FC+E
Sbjct: 1   MKVLLIGSGGREHALAWKLAQSPLLSEFYAAPGNPGIAEHAVLAPLNIDDHETVAAFCRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVVGPE PLV G++D L A G  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  KAIDLVVVGPEAPLVAGLADRLRADGLAVFGPSAGAAQLEGSKGFTKDICARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F++  KAK Y++ +  PIVVKADGL AGKGV VA T+DEA +A+D C    +    + 
Sbjct: 121 QRFNNAPKAKAYIRAQGAPIVVKADGLAAGKGVTVAMTLDEALAAVDDCFEGAYGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YLEG E SFF LCDGK A+P  TA+DHKR+ +GD G NTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLEGEEASFFCLCDGKHALPLATAQDHKRVGEGDTGVNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTIRGMAESGYPFSGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +  HG L      W  + ALTVV+A+KGYP  Y   T I  +P+     ++F
Sbjct: 301 SDLLPLLLATAHGTLDQVSAEWSDDPALTVVMASKGYPGAYEKNTPIEFLPEAGEGEKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA G T+ E++  AY +++ + W++G+ R DIG +  ER
Sbjct: 361 HAGTGMKDGVLVATGGRVLNVTASGGTVAEAKGRAYALLDRVRWENGFCRRDIGWRATER 420

Query: 417 NVKYRNKS 424
             K  +K+
Sbjct: 421 E-KASDKA 427


>gi|311696119|gb|ADP98992.1| phosphoribosylamine-glycine ligase [marine bacterium HP15]
          Length = 428

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 268/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSP    ++  PGN G A+    + V ID+ +   + +F 
Sbjct: 1   MNILVIGSGGREHALAWKAAQSPKADRVFVAPGNAGTARETGLENVDIDVMDLDGLANFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              H+ L +VGPE PLV GI D     G +VFGPS  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  ATNHVGLTIVGPEAPLVAGIVDKFEQRGLRVFGPSAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D  +A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 GYGNFTDVDEALAYVRQQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG+  +   T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGENVLAMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  ++ ++I PT+ GM  E +P++G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 ADVHQRIMDEVIYPTVRGMAAEGHPYKGFLYAGLMIDNSGTPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +R++SD++E+ ++ + G L      W    ++ +V+A  GYP  Y  G  IS +P   T 
Sbjct: 301 LRMKSDLVELCDAAIDGKLDQCDSEWDDRASVGIVLAAGGYPGSYNKGDAISGLPDTETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  NGGRVL ATALG T+TE+++ AY +   I W   ++R+DI  
Sbjct: 361 GEKVFHAGTRLNGDQVVTNGGRVLCATALGNTVTEAQKRAYELASRIQWDGAFYRKDIAF 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|149376842|ref|ZP_01894598.1| phosphoribosylamine--glycine ligase [Marinobacter algicola DG893]
 gi|149358849|gb|EDM47317.1| phosphoribosylamine--glycine ligase [Marinobacter algicola DG893]
          Length = 428

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 274/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSP    ++  PGN G A+    + + ID+ + + +  F 
Sbjct: 1   MNILVIGSGGREHALAWKAAQSPDADRVFVAPGNAGTAREPGLENINIDVMDLNGLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              H+ L +VGPE PLV+GI D     G +VFGPS  AA+LE SK+F K F  +  IPTA
Sbjct: 61  AANHVGLTIVGPEAPLVDGIVDLFEERGLRVFGPSAGAAQLEGSKAFTKDFLDRQDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D  +A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTDVDQALDYVRKQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           Q+++  ++ ++I PT+ GM  E +P++G L+AGLMI  E  P +IE+N RFGDPE Q +M
Sbjct: 241 QDVHKRIMDEVIYPTVRGMAAEGHPYKGFLYAGLMIDGEGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +R++SD++E+  + ++G L     +W    ++ +V+A  GYP  Y  G +IS +P+  T 
Sbjct: 301 LRMKSDLVELCGAAIYGKLDQCRSDWDERASVGIVLAAGGYPGSYNKGDVISGLPESETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +    +  NGGRVL ATALG T+TE+++ AY +   I W   ++R+DI  
Sbjct: 361 GEKVFHAGTRLNGEQVVTNGGRVLCATALGNTVTEAQKRAYEVAARISWDGAFYRKDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|320155023|ref|YP_004187402.1| phosphoribosylamine--glycine ligase [Vibrio vulnificus MO6-24/O]
 gi|319930335|gb|ADV85199.1| phosphoribosylamine-glycine ligase [Vibrio vulnificus MO6-24/O]
          Length = 429

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 196/426 (46%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F+D   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTENKGGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWDGMFHRNDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|206580118|ref|YP_002241054.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae 342]
 gi|288937699|ref|YP_003441758.1| phosphoribosylamine/glycine ligase [Klebsiella variicola At-22]
 gi|290513207|ref|ZP_06552568.1| phosphoribosylamine-glycine ligase [Klebsiella sp. 1_1_55]
 gi|206569176|gb|ACI10952.1| phosphoribosylamine--glycine ligase [Klebsiella pneumoniae 342]
 gi|288892408|gb|ADC60726.1| phosphoribosylamine/glycine ligase [Klebsiella variicola At-22]
 gi|289774304|gb|EFD82311.1| phosphoribosylamine-glycine ligase [Klebsiella sp. 1_1_55]
          Length = 431

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 280/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQNVAIGVTDIPALLRFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+++IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDENIDLTIVGPEAPLVIGVVDAFRAAGLTIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +R++SD++++  +   G L      W    +L VVVA  GYP  Y  G  I  +PQ    
Sbjct: 301 LRMKSDLVDLCLAACAGKLDEKTSEWDDRASLGVVVAAGGYPGNYNTGDEIFGLPQQEAA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG+T+ ++++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDQRVVTNGGRVLCVTALGETVAQAQQRAYQLLTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|110633076|ref|YP_673284.1| phosphoribosylamine--glycine ligase [Mesorhizobium sp. BNC1]
 gi|110284060|gb|ABG62119.1| phosphoribosylamine--glycine ligase [Chelativorans sp. BNC1]
          Length = 426

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 230/424 (54%), Positives = 304/424 (71%), Gaps = 5/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWK+A SPLL +L++ PGNPGIA+HA+CV++DI++H A+I FC++
Sbjct: 1   MKVLLIGSGGREHALAWKLAASPLLEKLFAAPGNPGIAEHAECVSLDIRDHEAVIGFCRD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I  VVVGPE PLV G++D L AAG  VFGP+  AA+LE SK F K  C +Y IPTA Y
Sbjct: 61  HGIGFVVVGPEAPLVAGLADDLIAAGIPVFGPTASAARLEGSKGFTKDLCARYDIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F D   AK Y++   +PIV+KADGL AGKGV +A T +EA +A+D C    F    + 
Sbjct: 121 ARFQDAAHAKDYIRKVGVPIVIKADGLAAGKGVTIAVTEEEAFAAVDDCFSGVFGDSGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE L G E SFF LCDGKTA+PF TA+DHKR+ +GD GPNTGGMGA SPA  M+ ++
Sbjct: 181 VVVEELLVGEEASFFCLCDGKTALPFGTAQDHKRVGEGDTGPNTGGMGAYSPAPVMTSDM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            S V+++II PT++GM++  +PF GVL+AGLMIT++GP LIEYNVRFGDPECQ +M+ L+
Sbjct: 241 VSQVMREIIEPTLKGMEEMGSPFVGVLYAGLMITKEGPKLIEYNVRFGDPECQVLMLLLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTGTTQL 355
            D+L ++   V G L +  + W+ + ALTVV+A  GYP     G+II  +        ++
Sbjct: 301 DDLLALMKGAVDGQLAHMSVRWRDDAALTVVMAANGYPGTPEKGSIIGGLNAAAAEGAEI 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTA+ +  L ANGGRVL+ TALG+T+TE+ + AY  V+ IDW  G+ R DIG +  E
Sbjct: 361 FHAGTALKDGALVANGGRVLNVTALGRTVTEAGDKAYRAVDRIDWPEGFCRRDIGWRAIE 420

Query: 416 RNVK 419
           R  +
Sbjct: 421 RESR 424


>gi|259906950|ref|YP_002647306.1| Phosphoribosylamine-glycine ligase [Erwinia pyrifoliae Ep1/96]
 gi|224962572|emb|CAX54027.1| Phosphoribosylamine-glycine ligase [Erwinia pyrifoliae Ep1/96]
 gi|283476744|emb|CAY72579.1| phosphoribosylamine-glycine ligase [Erwinia pyrifoliae DSM 12163]
          Length = 426

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 274/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +   +++F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALQNVAISPTDIQGLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + IDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LNEKIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRKKGAPIVIKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVRGMAAEGNVYTGFLYAGLMINKSGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V+GNL      W   ++L VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAAVNGNLDQKDSVWDPRHSLGVVLAAGGYPGDYVNGQPIQGLPSEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL  TALG+ +  +++ AY + + I W   + R DIG 
Sbjct: 361 DGKVFHAGTTLQDDRVVTSGGRVLCVTALGEDVAAAQQRAYQLAKPISWHGSFCRTDIGY 420

Query: 412 QKKERN 417
           +  +R 
Sbjct: 421 RAIDRK 426


>gi|290476982|ref|YP_003469893.1| phosphoribosylglycinamide synthetase [Xenorhabdus bovienii SS-2004]
 gi|289176326|emb|CBJ83131.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Xenorhabdus
           bovienii SS-2004]
          Length = 427

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 197/425 (46%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  A  + + I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEANLENIDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q +HI L +VGPE PLV GI DA   AG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSQHIGLTIVGPETPLVIGIVDAFQQAGLTIFGPTKAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++    PIV+KADGL AGKGVVVA T++EA +A+        F   
Sbjct: 121 AYQNFTEIEPALTYLKKMGAPIVIKADGLAAGKGVVVAMTMEEAQNAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGKNVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V++K+I PT+EGM  E + + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMEKVIYPTVEGMAAEGHTYTGFLYAGLMIDKQGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           MRL SD++E+  +   G L      W    AL VV++  GYP  Y  G +IS + Q T  
Sbjct: 301 MRLRSDLVELCLAGAQGQLSGKTSEWDTRPALGVVLSAGGYPANYVKGDVISGLNQETDT 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  + ++   GGRVL  TALG  I E+++ AY   E I W+  ++R+DIG 
Sbjct: 361 DEKVFHAGTAFKDKDVVTAGGRVLCVTALGDDIAEAQKKAYLRAEKIGWQGCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|161505337|ref|YP_001572449.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160866684|gb|ABX23307.1| hypothetical protein SARI_03482 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 433

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +  ++  PGN G A       VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPKVKTVFVAPGNAGTALEPTLQNVAISVTDIPALLSFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHNIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  +   G L      W    +L VV+A  GYP +Y  G  I  +P +   
Sbjct: 305 LRLKSDLVDLCLAACDGRLDEKTSEWDDRASLGVVMAAGGYPGDYRTGDEIHGLPLEEVA 364

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 365 DGKVFHAGTTLSNDDRVLTSGGRVLCATALGDTVAEAQQRAYALMTDIHWDDCFCRNDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERK 431


>gi|308272718|emb|CBX29322.1| Phosphoribosylamine--glycine ligase [uncultured Desulfobacterium
           sp.]
          Length = 590

 Score =  349 bits (896), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 189/423 (44%), Positives = 270/423 (63%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHAL WKIAQSP + +++  PGN GIA  A+CV I   +  +++ F ++
Sbjct: 1   MKILVVGSGGREHALVWKIAQSPKVKKIFCAPGNAGIASLAECVPISSDDIKSLLEFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I L +VGPE PL NGI+D   AAG K+FG S +A++LESSK F+K+   KYGIPTA  
Sbjct: 61  ENIALTIVGPEAPLSNGITDLFEAAGLKIFGSSGKASELESSKCFSKELMIKYGIPTAAG 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + FS+  +A  Y++    P VVKADGL AGKGVVV +T  EA  A+D             
Sbjct: 121 KIFSNYKQAANYIRKTKAPCVVKADGLAAGKGVVVCSTEKEALDALDDIMVKRSFGDAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE L G E SF A  DGKT +P  +++DHK I D D GPNTGGMGA SPA  + + 
Sbjct: 181 RVVIEELLAGEEASFIAFTDGKTVLPLPSSQDHKAIFDNDKGPNTGGMGAYSPAPVVDKY 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++  +++++++PT+  M  E   ++GVL+AGLMI      ++E+N RFGDPE QA+++R+
Sbjct: 241 MHKKIMEEVMVPTVRAMAAEGRYYKGVLYAGLMIDHDRIRVLEFNCRFGDPEAQALLVRI 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SDI+ I+ + +   L+   I      +L VV+A+ GYP  Y  G  I  +   +    T
Sbjct: 301 KSDIVPIMEAVIEEKLNECTIEIDQRASLCVVMASGGYPGAYKKGIPIKGLEDASRIKDT 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTAI + ++ ANGGRVL  TALG T++ S + AY  V  I+W    +R DI  + 
Sbjct: 361 IVFHAGTAIKDGSVVANGGRVLGVTALGDTVSASIDKAYRAVLKINWDGVQYRTDIAQKA 420

Query: 414 KER 416
            +R
Sbjct: 421 VKR 423


>gi|269959586|ref|ZP_06173967.1| phosphoribosylamine--glycine ligase [Vibrio harveyi 1DA3]
 gi|269835644|gb|EEZ89722.1| phosphoribosylamine--glycine ligase [Vibrio harveyi 1DA3]
          Length = 429

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 191/429 (44%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHAL WK AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 1   MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTQAAAQLEGSKAFTKDFLARHRIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR+ESD++++  + +   L      W    ++ +V+A  GYP  Y  G +IS +PQ    
Sbjct: 301 MRMESDLVDLCLAAIDEKLDQAESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG +++E+++ AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTDNKDGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQICWDGMFHRNDIGY 420

Query: 412 QKKERNVKY 420
           +   R  + 
Sbjct: 421 RAIAREQEK 429


>gi|330005101|ref|ZP_08305111.1| phosphoribosylamine--glycine ligase [Klebsiella sp. MS 92-3]
 gi|328536434|gb|EGF62787.1| phosphoribosylamine--glycine ligase [Klebsiella sp. MS 92-3]
          Length = 431

 Score =  349 bits (895), Expect = 4e-94,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVYVAPGNAGTALEPSLQTVAIGVTDIPALLRFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q++ IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDEKIDLTIVGPEAPLVIGVVDAFRAAGLNIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R++SD++E+  +   G L      W    +L VVVA  GYP  Y  G  I  +PQ    
Sbjct: 301 LRMKSDLVELCLAACAGKLDEKTSEWDDRASLGVVVAAGGYPGSYNTGDEIYGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  NGGRVL  TALG ++ ++++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLSDDQRVVTNGGRVLCVTALGDSVAQAQQRAYQLLTDIRWDGSFSRSDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|237807315|ref|YP_002891755.1| phosphoribosylamine/glycine ligase [Tolumonas auensis DSM 9187]
 gi|237499576|gb|ACQ92169.1| phosphoribosylamine/glycine ligase [Tolumonas auensis DSM 9187]
          Length = 428

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 203/428 (47%), Positives = 282/428 (65%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK AQSPL  +++  PGN G A+ A  + V I   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKAAQSPLADKVFVAPGNTGSAREAKVENVNISATDVPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++++I L +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KQQNIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F   
Sbjct: 121 DYQNFTEIEPALAYLKEKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKRI DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRIGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           QE++  V+Q +I PT++GM  E NP+ G L+AGLMI  Q  P +IE+N RFGDPE Q +M
Sbjct: 241 QEVHDKVMQLVIWPTVQGMAAEGNPYTGFLYAGLMIDPQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +R+ SD++E+  +   G L     ++    A+ +V+A  GYP E   G +IS +P +   
Sbjct: 301 LRMRSDLVELCLAACAGELDQKTADYDPRPAVGIVLAAAGYPAEVQKGDVISGLPTSEPD 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           T ++FHAGTA  + N+   GGRVL ATALG T+ E+++ AY + E I W   Y+R+DI  
Sbjct: 361 TAKVFHAGTAEQDGNIITAGGRVLCATALGATVAEAQKNAYALAETISWNGIYYRKDIAW 420

Query: 412 QKKERNVK 419
           +   R  K
Sbjct: 421 RAIAREQK 428


>gi|150395696|ref|YP_001326163.1| phosphoribosylamine--glycine ligase [Sinorhizobium medicae WSM419]
 gi|150027211|gb|ABR59328.1| phosphoribosylamine--glycine ligase [Sinorhizobium medicae WSM419]
          Length = 423

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 229/421 (54%), Positives = 294/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L+ L++ PGNPGIA+ A  VA+D+ NH A++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTTLYAAPGNPGIAEEAAIVALDVGNHVAVVDFCRS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV G++D L  AG  VFGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDLVVVGPEAPLVAGLADVLIGAGIPVFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + FSD   A+ YV+ +  PIV+KADGL AGKGV VA  ++EA +A+D CF          
Sbjct: 121 KRFSDAESARAYVREQGAPIVIKADGLAAGKGVTVAMNLEEALAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK  +P  +A+DHKR+ DGD GPNTGGMGA SPA  MS E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKNVLPLGSAQDHKRVGDGDTGPNTGGMGAYSPAPVMSPEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMREIIQPTVRGMSENGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L      W+ + ALTVV+A +GYP  Y   T I  +P+ + TT++F
Sbjct: 301 SDLLPLLYAAATGTLEGMKAEWRDDVALTVVMAARGYPGSYEKDTPIDALPEASATTKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGT + +  L A GGRVL+ TA GK+++ +++ AY  V N+ W++G+ R DIG +   R
Sbjct: 361 HAGTTMKDGRLVATGGRVLNVTATGKSVSVAKDAAYAAVRNVTWENGFHRNDIGWRAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|325577664|ref|ZP_08147939.1| phosphoribosylamine-glycine ligase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160409|gb|EGC72535.1| phosphoribosylamine-glycine ligase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 427

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 269/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIIMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 SEIHDRIMREVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RLESD++E+      G L      W  + +L +V+A +GYP +Y  G +IS +PQ    
Sbjct: 301 LRLESDLVELCLKACEGKLDEVKSQWNPKASLGIVLAAEGYPGDYRKGDVISGLPQSAVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEKEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWTGRFYRRDIGH 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|256821473|ref|YP_003145436.1| phosphoribosylamine/glycine ligase [Kangiella koreensis DSM 16069]
 gi|256795012|gb|ACV25668.1| phosphoribosylamine/glycine ligase [Kangiella koreensis DSM 16069]
          Length = 427

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 191/428 (44%), Positives = 278/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQS  +  ++  PGN GIA+  +   VA+  ++   +I F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQSANVETVFVAPGNAGIAREDKVQTVAVGAEDIDGLIAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ +++L +VGPE PLV G+ DA   AG K FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KDNNVELTIVGPEAPLVIGVVDAFTEAGLKCFGPTKGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   AK YV+    PIV+KADGL AGKGV++A T+++A  AID       F   
Sbjct: 121 AYQNFTEIEPAKAYVREMGTPIVIKADGLAAGKGVIIAETIEQADEAIDDMLAGNKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L+G E SF  + DGK  +P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVVEEFLKGEEASFIVMVDGKNILPLATSQDHKARDNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  ++Q++I+PT+EGM  E +P+ G L+AG+MI  +  P ++EYN RFGDPE Q +M
Sbjct: 241 PKMHDRIMQQVIIPTVEGMAAEGHPYTGFLYAGVMIDADGVPKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
            RL+SD+ E+  + + G L +T   W +  A+ VV+A  GYPE Y  G +I  +   +  
Sbjct: 301 SRLQSDLAELCLAALDGKLDSTTAEWDSRAAVGVVLAAGGYPESYNKGDVIHGLDSIS-G 359

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            ++FHAGTA  +  +  NGGRVL   ALG ++TE++  AY  V+ I+W + Y+R DIG +
Sbjct: 360 AKVFHAGTAEKDGQIVTNGGRVLCVVALGDSVTEAQAKAYEGVKQINWDNVYYRTDIGHR 419

Query: 413 KKERNVKY 420
              R    
Sbjct: 420 AIAREQAK 427


>gi|218779902|ref|YP_002431220.1| phosphoribosylamine/glycine ligase [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761286|gb|ACL03752.1| phosphoribosylamine/glycine ligase [Desulfatibacillum alkenivorans
           AK-01]
          Length = 589

 Score =  349 bits (895), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 187/423 (44%), Positives = 263/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHAL WK++QSP + +++  PGN GIA+ A+CV I  ++   ++ F +E
Sbjct: 1   MKVLVIGSGGREHALVWKLSQSPKVEKIYCAPGNAGIAESAECVPIGAEDIPKLLAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I L VVGPE PL  GI D    AG  VFG S+ AA+LE SKSFAK   TKYGIPTA  
Sbjct: 61  NAIGLTVVGPEAPLTEGIVDKFEKAGLMVFGASKAAARLEGSKSFAKSLMTKYGIPTAIG 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F+D  KAK Y++     +VVKADGL AGKGV+V     +A         ++ F     
Sbjct: 121 KTFTDIEKAKAYIEEVGGKVVVKADGLAAGKGVMVCTNKKQALEAVNLVMEEKAFGDAGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE L G E SF A  DGKT +P  +++DHK I+DGD GPNTGGMGA SPA  +   
Sbjct: 181 KMVIEELLVGEEASFLAFTDGKTVLPLPSSQDHKAIYDGDKGPNTGGMGAYSPAPVVDAY 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++  ++ +++ PT++ M  E  P++GVL+AGLMI      ++E+N RFGDPECQ ++MRL
Sbjct: 241 MHDKIMNEVMKPTVKAMAAEGAPYKGVLYAGLMIDGDDIKVLEFNARFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           ++D++EI+ +     L   ++       + +V+A+KGYP  Y  G  IS +         
Sbjct: 301 KTDLVEIMEAVSKEELDKVNLEIDPRATVCIVLASKGYPGSYDKGMPISGLDAVKRMKDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA+ +  + A+GGRVL  TALG+TI ++ + AY   + I W   Y R+DIG + 
Sbjct: 361 FVFHAGTALQDEKIVASGGRVLGVTALGETIDKAIDKAYKAADKIKWTGVYKRKDIGQKA 420

Query: 414 KER 416
              
Sbjct: 421 SRH 423


>gi|229509299|ref|ZP_04398782.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|229606439|ref|YP_002877087.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MJ-1236]
 gi|229353614|gb|EEO18551.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|229369094|gb|ACQ59517.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MJ-1236]
          Length = 442

 Score =  349 bits (895), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 274/429 (63%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKVFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 434 RAIAREQAK 442


>gi|149190647|ref|ZP_01868915.1| phosphoribosylamine--glycine ligase [Vibrio shilonii AK1]
 gi|148835530|gb|EDL52499.1| phosphoribosylamine--glycine ligase [Vibrio shilonii AK1]
          Length = 429

 Score =  349 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A     + VAID+++   ++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKVAQNPNVETVFVAPGNAGSALEPKLENVAIDVEDIQGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++K+I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KDKNIELTIVGPEAPLVIGVVDAFQEAGLAIFGPTQAAAQLEGSKAFTKDFLARHAIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE+++ +++++I PT+ GM  E NP+ G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHNRIMEEVIYPTVRGMASEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR++SD++E+  + +   L      W    ++ +V+A  GYP  Y  G +IS +P     
Sbjct: 301 MRMQSDMVELCQAAIDKKLDQVESKWDPRASIGIVLAAGGYPASYNKGDVISGLPTTEVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  + N+  NGGRVL ATALG T++E++  AY + + I W   + R DIG 
Sbjct: 361 GEKVFHAGTADKDGNVVTNGGRVLCATALGNTVSEAQARAYELTKKISWDGMFHRNDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|229506928|ref|ZP_04396436.1| phosphoribosylamine--glycine ligase [Vibrio cholerae BX 330286]
 gi|229516245|ref|ZP_04405693.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC9]
 gi|229346671|gb|EEO11641.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC9]
 gi|229356033|gb|EEO20952.1| phosphoribosylamine--glycine ligase [Vibrio cholerae BX 330286]
          Length = 442

 Score =  349 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 434 RAIAREQAK 442


>gi|86748986|ref|YP_485482.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           HaA2]
 gi|86572014|gb|ABD06571.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           HaA2]
          Length = 442

 Score =  349 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 227/427 (53%), Positives = 290/427 (67%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++L+  PGN GIA+ A CVA+D+ +H+A+I FC+ 
Sbjct: 16  MNILLLGSGGREHALAWKIAASPLVTKLFCAPGNAGIAREATCVALDVTDHAAVIDFCKA 75

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I+LVVVGPE PL  GI D L  AG K FGP+Q+AA+LE SK F K  C  + IPTA Y
Sbjct: 76  NAIELVVVGPEAPLAAGIVDDLAGAGIKAFGPTQKAAQLEGSKGFTKDLCKAHDIPTAAY 135

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + FSDP  AK Y++ +  PIVVKADGL AGKGVVVA T+ EA  A+D  F          
Sbjct: 136 ERFSDPADAKAYIRVQGAPIVVKADGLAAGKGVVVAMTLAEAEDAVDMMFGGALGDAGIE 195

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E+++ G E SFF LCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+  +
Sbjct: 196 VVVEDFMIGEEASFFVLCDGEHALPLATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTDAI 255

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT++ M+    PF+GVLFAGLMITE GP LIEYNVRFGDPECQ +MMR+ 
Sbjct: 256 CKQAMERIIGPTLKAMKAMGAPFKGVLFAGLMITEDGPQLIEYNVRFGDPECQVLMMRMM 315

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SDI+  L +CV G L +  + W  E ALTVV+A KGYP  Y  GT I+ + +       Q
Sbjct: 316 SDIVPALLACVDGQLAHLTLRWFDEPALTVVMAAKGYPGGYEKGTRIAGLDRAEQIPGVQ 375

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA  KT+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 376 IFHAGTVASGDWVLANGGRVLAVTASAKTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 435

Query: 415 ERNVKYR 421
            R  + +
Sbjct: 436 ARERRKK 442


>gi|227328383|ref|ZP_03832407.1| phosphoribosylamine--glycine ligase [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 428

 Score =  349 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 196/426 (46%), Positives = 273/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK +QSPL   ++  PGN G A       V I   +  A++ F 
Sbjct: 1   MNILVIGNGGREHALAWKASQSPLAKRVYVAPGNAGTALEPALTNVDIAATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE HI L +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QENHIGLTIVGPETPLVIGVVDAFQSAGLKIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L      W    +L VV+A  GYP +Y  G +IS +PQ +  
Sbjct: 301 LRLRSDLVELCLAACDGTLDQKDSVWDERPSLGVVLAAGGYPADYNTGDVISGLPQQDAE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   ++  NGGRVL  TALG T+ E+++ AY +   I W+  + R+DIG 
Sbjct: 361 DGKVFHAGTKLNGIDVVTNGGRVLCVTALGNTVAEAQQRAYEIAAGIQWQGVFCRKDIGY 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAIERE 426


>gi|229512727|ref|ZP_04402195.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TMA 21]
 gi|229350237|gb|EEO15189.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TMA 21]
          Length = 442

 Score =  349 bits (894), Expect = 6e-94,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQSAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 434 RAIAREQAK 442


>gi|52425351|ref|YP_088488.1| phosphoribosylamine--glycine ligase [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307403|gb|AAU37903.1| PurD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 429

 Score =  349 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL S+++  PGN G A+ +  + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLASKVFVAPGNAGTARESAVENVDISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ ++ L +VGPE PLV G+ DA   AG  +FGP Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDNNVGLTIVGPEAPLVVGVVDAFEQAGLTIFGPCQSAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE++  V+++II PT+ GM  E N ++G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 QEIHQRVMEQIIYPTVRGMAAENNVYKGFLYAGLMIDKNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MR++SD++E+      G L      W  + AL +V+A +GYP +Y  G  IS IP Q + 
Sbjct: 301 MRMQSDLVELCLKACKGELDQIKSEWDPQAALGIVLAAEGYPGDYRKGDEISGIPVQASQ 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG ++  +++ A  + E ++W   ++R DIG 
Sbjct: 361 DEKVFLAGVAEKEGKLVTNGGRVLCVTALGNSVLSAQQKALKLAEQVNWTGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|225873624|ref|YP_002755083.1| phosphoribosylamine--glycine ligase [Acidobacterium capsulatum ATCC
           51196]
 gi|225794509|gb|ACO34599.1| phosphoribosylamine--glycine ligase [Acidobacterium capsulatum ATCC
           51196]
          Length = 425

 Score =  349 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 177/424 (41%), Positives = 264/424 (62%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG+GGREHAL W +AQSP ++E+   PGN GIAQ A+CV  D +N   ++     
Sbjct: 1   MKVLVIGAGGREHALCWALAQSPRVTEVVCAPGNGGIAQVARCVPADQRNLDEMLQVVAT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +   LVVVGPELPL  G+ D L   G + FGP+Q AA LE+SK +AK+F  ++ IPTA +
Sbjct: 61  EGPGLVVVGPELPLSLGLVDELERRGIRAFGPTQAAAMLETSKGYAKRFMQRHQIPTAHF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
              +   +A   +    +P+V+KADGL AGKGV++  +  EA +        +    + +
Sbjct: 121 AVCTAEQQALDSLDLFHLPVVIKADGLAAGKGVLICESKAEAKAAITGLFSGKLLGTVET 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           ++++EE+L G E+SF  L DGK A P   A+DHKRI +GD G NTGGMG  S    + ++
Sbjct: 181 SIVVEEFLTGEEISFLVLSDGKHASPLVPAQDHKRIGEGDTGLNTGGMGVYSTDEMIDEQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   ++ +I+ PT++GM  E  PF+G+L+ GLM+T +GP ++EYN RFGDPE QA++MRL
Sbjct: 241 MREWIMHRIVQPTLDGMAAEDAPFRGMLYCGLMMTARGPMVLEYNTRFGDPETQAILMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SD+ E L +C  G L  T + WK   +  VV ++ GYP  Y  G  I+ +         
Sbjct: 301 DSDLAEALEACAEGRLSETELRWKPGASACVVASSAGYPGSYKTGFPITGLKDAAAVPGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA+ N  +  +GGRVL  TA+G  ++E+   AY  ++ I ++  Y+R DIG + 
Sbjct: 361 EIFHAGTALSNGEIVTSGGRVLGVTAIGSDLSEALRQAYEALDRIHFEGMYFRRDIGHRA 420

Query: 414 KERN 417
            ++ 
Sbjct: 421 LKKK 424


>gi|262192522|ref|ZP_06050672.1| phosphoribosylamine--glycine ligase [Vibrio cholerae CT 5369-93]
 gi|262031567|gb|EEY50155.1| phosphoribosylamine--glycine ligase [Vibrio cholerae CT 5369-93]
          Length = 429

 Score =  349 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTKTQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|15804596|ref|NP_290637.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7
           EDL933]
 gi|15834182|ref|NP_312955.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           Sakai]
 gi|168752029|ref|ZP_02777051.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168758598|ref|ZP_02783605.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168764586|ref|ZP_02789593.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168771478|ref|ZP_02796485.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777381|ref|ZP_02802388.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168780391|ref|ZP_02805398.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168790366|ref|ZP_02815373.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC869]
 gi|168798360|ref|ZP_02823367.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC508]
 gi|195939631|ref|ZP_03085013.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4024]
 gi|208806688|ref|ZP_03249025.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208813417|ref|ZP_03254746.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208821233|ref|ZP_03261553.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396846|ref|YP_002273522.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4115]
 gi|217325861|ref|ZP_03441945.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254796003|ref|YP_003080840.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261227283|ref|ZP_05941564.1| phosphoribosylamine-glycine ligase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257030|ref|ZP_05949563.1| phosphoribosylamine-glycine ligase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285420|ref|YP_003502238.1| Phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           CB9615]
 gi|20139445|sp|Q8X612|PUR2_ECO57 RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|12518937|gb|AAG59202.1|AE005632_3 phosphoribosylglycinamide synthetase = GAR synthetase [Escherichia
           coli O157:H7 str. EDL933]
 gi|13364404|dbj|BAB38351.1| phosphoribosylglycinamide synthetase [Escherichia coli O157:H7 str.
           Sakai]
 gi|187767359|gb|EDU31203.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188014033|gb|EDU52155.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4113]
 gi|189001791|gb|EDU70777.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189354601|gb|EDU73020.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189359748|gb|EDU78167.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189365461|gb|EDU83877.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370161|gb|EDU88577.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC869]
 gi|189379173|gb|EDU97589.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC508]
 gi|208726489|gb|EDZ76090.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208734694|gb|EDZ83381.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208741356|gb|EDZ89038.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158246|gb|ACI35679.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209751628|gb|ACI74121.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751630|gb|ACI74122.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751632|gb|ACI74123.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751634|gb|ACI74124.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|209751636|gb|ACI74125.1| phosphoribosylglycinamide synthetase [Escherichia coli]
 gi|217322082|gb|EEC30506.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           TW14588]
 gi|254595403|gb|ACT74764.1| phosphoribosylamine-glycine ligase [Escherichia coli O157:H7 str.
           TW14359]
 gi|290765293|gb|ADD59254.1| Phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           CB9615]
 gi|320190897|gb|EFW65547.1| Phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320639096|gb|EFX08736.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           G5101]
 gi|320644490|gb|EFX13553.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H- str.
           493-89]
 gi|320649809|gb|EFX18330.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H- str.
           H 2687]
 gi|320655142|gb|EFX23098.1| phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660786|gb|EFX28240.1| phosphoribosylamine--glycine ligase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665904|gb|EFX32935.1| phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326347143|gb|EGD70873.1| Phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           1125]
 gi|326347606|gb|EGD71328.1| Phosphoribosylamine--glycine ligase [Escherichia coli O157:H7 str.
           1044]
          Length = 429

 Score =  349 bits (894), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 190/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMASEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|193067795|ref|ZP_03048761.1| phosphoribosylamine--glycine ligase [Escherichia coli E110019]
 gi|192958770|gb|EDV89207.1| phosphoribosylamine--glycine ligase [Escherichia coli E110019]
          Length = 429

 Score =  348 bits (893), Expect = 7e-94,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGLTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|237756658|ref|ZP_04585167.1| phosphoribosylamine--glycine ligase [Sulfurihydrogenibium
           yellowstonense SS-5]
 gi|237691178|gb|EEP60277.1| phosphoribosylamine--glycine ligase [Sulfurihydrogenibium
           yellowstonense SS-5]
          Length = 431

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 184/423 (43%), Positives = 260/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G+GGREHAL WKI QS L+ E++   GN GI + A+ V I   +   ++ F +E
Sbjct: 1   MKVLVVGNGGREHALVWKIKQSSLVKEVYCASGNAGIGKIAKRVNISPTDIYNLVRFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PL  GI D  N  G K+FG  + AA LE+SK FAK    KYGIPTA +
Sbjct: 61  NKIDLTVVGPEQPLSEGIVDRFNEEGLKIFGHQKSAAILEASKVFAKNLMKKYGIPTAKF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           + F     A ++++    PIV+KADGL AGKGVVVA T +EA  A+       F   +  
Sbjct: 121 ESFEKEEDAIKFIKEVGAPIVIKADGLAAGKGVVVAKTEEEAIQAVKDMFAGKFGPASKR 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E S+          P  T++DHKR +D D GPNTGGMGA SP   ++ E+
Sbjct: 181 VVIEEFLEGEEASYICFVKDDKLAPMPTSQDHKRAYDNDEGPNTGGMGAYSPCSLITPEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              + ++I+ PT++ M  E     G L+AGLMI  +G  ++E+NVR GDPE Q +M RL+
Sbjct: 241 EKEIQERIMYPTLKAMINEGRSMCGFLYAGLMIGPKGINVLEFNVRMGDPETQPIMRRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD++E +   + GN+ N    W  +YA+ VV+A+KGYP+ Y  G +I+ I +        
Sbjct: 301 SDLVEHILEILEGNIENVKPKWNPDYAIGVVMASKGYPDAYEKGKVITGIEEAEKDPDVV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT  V+  +  NGGRVL+ TA G+ I ++RE  Y  +E I ++  ++R+DIG ++ 
Sbjct: 361 VFHAGTEEVDGKIITNGGRVLTVTATGEDIFKAREKVYSAIEKIHFEGAFYRKDIGFREV 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|283836744|ref|ZP_06356485.1| phosphoribosylamine--glycine ligase [Citrobacter youngae ATCC
           29220]
 gi|291067297|gb|EFE05406.1| phosphoribosylamine--glycine ligase [Citrobacter youngae ATCC
           29220]
          Length = 429

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 194/429 (45%), Positives = 282/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAISVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +++ 
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLESST 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DAKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQQRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|283787322|ref|YP_003367187.1| phosphoribosylglycineamide synthetase [Citrobacter rodentium
           ICC168]
 gi|282950776|emb|CBG90452.1| phosphoribosylglycineamide synthetase [Citrobacter rodentium
           ICC168]
          Length = 429

 Score =  348 bits (893), Expect = 8e-94,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK A+SP +  ++  PGN G A     Q VAI   +  A+++F 
Sbjct: 1   MKVLVIGNGGREHALAWKAARSPKVETVFVAPGNAGTALEPGLQNVAISATDIPALLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QREKIDLTIVGPEAPLVTGVVDTFRAAGLKIFGPTQGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLSEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G  I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDTQKSEWDERASLGVVMAAGGYPGDYRTGDAIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG ++ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVITSGGRVLCVTALGNSVAEAQKRAYALMADIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|54310486|ref|YP_131506.1| phosphoribosylamine--glycine ligase [Photobacterium profundum SS9]
 gi|46914929|emb|CAG21704.1| putative phosphoribosylamine-glycine ligase [Photobacterium
           profundum SS9]
          Length = 429

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 196/428 (45%), Positives = 282/428 (65%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQS  ++ ++  PGNPG A     + VAI +++  A++ F 
Sbjct: 1   MKVLIIGNGGREHALAWKTAQSADVNTIFVAPGNPGTALEPKVENVAIGVEDIEALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  IDL +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENTIDLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLQEKGAPIVVKADGLAAGKGVIVAMTLQEAENAVRDMLAGNAFGKA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           Q ++  V++++I PT+ GM  E  P+ G L+AGLM+  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMKEVIYPTVRGMAAENTPYTGFLYAGLMVMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+  + +   L      W    A+ +V+A  GYP +Y  G IIS +PQ +  
Sbjct: 301 LRLQSDLVELCLAAIEQKLDTVESKWDPRAAMGIVLAAGGYPADYEKGAIISGLPQQDVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AGTA  N  +  NGGRVL ATA+G +++++++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFQAGTASNNGAIVTNGGRVLCATAMGDSVSDAQKRAYALTKQISWDGMFHRDDIGY 420

Query: 412 QKKERNVK 419
           +   R ++
Sbjct: 421 RAIARELE 428


>gi|194439792|ref|ZP_03071859.1| phosphoribosylamine--glycine ligase [Escherichia coli 101-1]
 gi|253775365|ref|YP_003038196.1| phosphoribosylamine--glycine ligase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163947|ref|YP_003047055.1| phosphoribosylamine--glycine ligase [Escherichia coli B str.
           REL606]
 gi|297520394|ref|ZP_06938780.1| phosphoribosylamine--glycine ligase [Escherichia coli OP50]
 gi|300928825|ref|ZP_07144333.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 187-1]
 gi|194421289|gb|EDX37309.1| phosphoribosylamine--glycine ligase [Escherichia coli 101-1]
 gi|242379536|emb|CAQ34352.1| phosphoribosylamine-glycine ligase [Escherichia coli BL21(DE3)]
 gi|253326409|gb|ACT31011.1| phosphoribosylamine/glycine ligase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975848|gb|ACT41519.1| phosphoribosylamine-glycine ligase [Escherichia coli B str. REL606]
 gi|253980004|gb|ACT45674.1| phosphoribosylamine-glycine ligase [Escherichia coli BL21(DE3)]
 gi|300463206|gb|EFK26699.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 187-1]
 gi|323958932|gb|EGB54607.1| phosphoribosylamine-glycine ligase [Escherichia coli H489]
 gi|323969079|gb|EGB64387.1| phosphoribosylamine-glycine ligase [Escherichia coli TA007]
          Length = 429

 Score =  348 bits (893), Expect = 9e-94,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDIFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|90413393|ref|ZP_01221386.1| phosphoribosylamine--glycine ligase [Photobacterium profundum 3TCK]
 gi|90325635|gb|EAS42104.1| phosphoribosylamine--glycine ligase [Photobacterium profundum 3TCK]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 196/428 (45%), Positives = 282/428 (65%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQS  ++ ++  PGNPG A     + VAI +++  A++ F 
Sbjct: 1   MKVLIIGNGGREHALAWKTAQSADVNTIFVAPGNPGTALEPKVENVAIGVEDIEALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  IDL +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENAIDLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEIDPALAYLQEKGAPIVVKADGLAAGKGVIVAMTLQEAENAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           Q ++  V++++I PT+ GM  E  P+ G L+AGLM+  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMEEVIYPTVRGMAAENTPYTGFLYAGLMVMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+  + +   L      W    A+ +V+A  GYP +Y  G IIS +PQ +  
Sbjct: 301 LRLQSDLVELCLAAIDQKLDTVESKWDPRAAMGIVLAAGGYPADYAKGAIISGLPQQDVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AGTA  N  +  NGGRVL ATA+G +++++++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFQAGTASNNGAIVTNGGRVLCATAMGDSVSDAQKRAYALTKQISWDGMFHRDDIGY 420

Query: 412 QKKERNVK 419
           +   R ++
Sbjct: 421 RAIARELE 428


>gi|153823370|ref|ZP_01976037.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|254851409|ref|ZP_05240759.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MO10]
 gi|255744078|ref|ZP_05418032.1| phosphoribosylamine--glycine ligase [Vibrio cholera CIRS 101]
 gi|126519111|gb|EAZ76334.1| phosphoribosylamine--glycine ligase [Vibrio cholerae B33]
 gi|254847114|gb|EET25528.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MO10]
 gi|255738343|gb|EET93734.1| phosphoribosylamine--glycine ligase [Vibrio cholera CIRS 101]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 274/429 (63%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKVFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|109896597|ref|YP_659852.1| phosphoribosylamine--glycine ligase [Pseudoalteromonas atlantica
           T6c]
 gi|109698878|gb|ABG38798.1| phosphoribosylamine--glycine ligase [Pseudoalteromonas atlantica
           T6c]
          Length = 427

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 203/426 (47%), Positives = 286/426 (67%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALA+K AQS  +S+++  PGN G A     + VAID+++ SA++ F 
Sbjct: 1   MKVLIIGGGGREHALAYKAAQSNGVSQVYVAPGNAGTALEPKLENVAIDVEDISALVTFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  I L +VGPE+PLV G+ DA  A G  +FGPS+ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KQNAIALTIVGPEVPLVLGVVDAFQAEGLAIFGPSKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q    PIV+KADGL AGKGV+VA T+DEA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLQQTGAPIVIKADGLAAGKGVIVAMTLDEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT++GM  E N + G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 DEIHRRVMDEVIYPTVQGMASEGNDYHGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+SD++E++   V G L      +    A+ VV+A  GYP+ Y  G +IS + QN   
Sbjct: 301 MRLQSDLVELVQLAVDGKLDQATAKFDPRAAVGVVLAAGGYPQAYKKGDVISGLNQNESD 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT  VN N+T NGGRVL ATALG+++TE+++ AY + ++I W   ++R+DI  
Sbjct: 361 VAKVFHAGTKDVNGNVTTNGGRVLCATALGESVTEAQQRAYELAKSISWNGMFYRDDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|323190137|gb|EFZ75415.1| phosphoribosylamine--glycine ligase [Escherichia coli RN587/1]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|15640304|ref|NP_229931.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121586357|ref|ZP_01676146.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 2740-80]
 gi|153818472|ref|ZP_01971139.1| phosphoribosylamine--glycine ligase [Vibrio cholerae NCTC 8457]
 gi|227080489|ref|YP_002809040.1| phosphoribosylamine-glycine ligase [Vibrio cholerae M66-2]
 gi|262161967|ref|ZP_06030984.1| phosphoribosylamine--glycine ligase [Vibrio cholerae INDRE 91/1]
 gi|298500910|ref|ZP_07010712.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MAK 757]
 gi|20139786|sp|Q9KV81|PUR2_VIBCH RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|9654685|gb|AAF93450.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121549477|gb|EAX59505.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 2740-80]
 gi|126510948|gb|EAZ73542.1| phosphoribosylamine--glycine ligase [Vibrio cholerae NCTC 8457]
 gi|227008377|gb|ACP04589.1| phosphoribosylamine-glycine ligase [Vibrio cholerae M66-2]
 gi|262028345|gb|EEY47001.1| phosphoribosylamine--glycine ligase [Vibrio cholerae INDRE 91/1]
 gi|297540414|gb|EFH76473.1| phosphoribosylamine-glycine ligase [Vibrio cholerae MAK 757]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIDPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|229524778|ref|ZP_04414183.1| phosphoribosylamine--glycine ligase [Vibrio cholerae bv. albensis
           VL426]
 gi|229338359|gb|EEO03376.1| phosphoribosylamine--glycine ligase [Vibrio cholerae bv. albensis
           VL426]
          Length = 442

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 199/426 (46%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPAQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKERN 417
           +   R 
Sbjct: 434 RAIARE 439


>gi|157156020|ref|YP_001465501.1| phosphoribosylamine--glycine ligase [Escherichia coli E24377A]
 gi|170021992|ref|YP_001726946.1| phosphoribosylamine--glycine ligase [Escherichia coli ATCC 8739]
 gi|191168670|ref|ZP_03030451.1| phosphoribosylamine--glycine ligase [Escherichia coli B7A]
 gi|300824614|ref|ZP_07104722.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 119-7]
 gi|300907559|ref|ZP_07125197.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 84-1]
 gi|300925875|ref|ZP_07141718.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 182-1]
 gi|301302182|ref|ZP_07208314.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 124-1]
 gi|307315021|ref|ZP_07594607.1| phosphoribosylamine/glycine ligase [Escherichia coli W]
 gi|309797710|ref|ZP_07692096.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 145-7]
 gi|331680129|ref|ZP_08380790.1| phosphoribosylamine--glycine ligase [Escherichia coli H591]
 gi|157078050|gb|ABV17758.1| phosphoribosylamine--glycine ligase [Escherichia coli E24377A]
 gi|169756920|gb|ACA79619.1| phosphoribosylamine--glycine ligase [Escherichia coli ATCC 8739]
 gi|190901310|gb|EDV61078.1| phosphoribosylamine--glycine ligase [Escherichia coli B7A]
 gi|300400726|gb|EFJ84264.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 84-1]
 gi|300418065|gb|EFK01376.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 182-1]
 gi|300522863|gb|EFK43932.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 119-7]
 gi|300842345|gb|EFK70105.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 124-1]
 gi|306905526|gb|EFN36059.1| phosphoribosylamine/glycine ligase [Escherichia coli W]
 gi|308118722|gb|EFO55984.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 145-7]
 gi|309704421|emb|CBJ03770.1| phosphoribosylglycineamide synthetase [Escherichia coli ETEC
           H10407]
 gi|315063331|gb|ADT77658.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli W]
 gi|315252726|gb|EFU32694.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 85-1]
 gi|323380605|gb|ADX52873.1| phosphoribosylamine/glycine ligase [Escherichia coli KO11]
 gi|331072284|gb|EGI43618.1| phosphoribosylamine--glycine ligase [Escherichia coli H591]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|262172620|ref|ZP_06040298.1| phosphoribosylamine--glycine ligase [Vibrio mimicus MB-451]
 gi|261893696|gb|EEY39682.1| phosphoribosylamine--glycine ligase [Vibrio mimicus MB-451]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 200/429 (46%), Positives = 279/429 (65%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI +   P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAVEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L+     W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLNQVESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   ++ +  NGGRVL ATALG T+ E+++ AY + + I+W   + R DIG 
Sbjct: 361 GQKVFHAGTETKDSQVVTNGGRVLCATALGNTVLEAQQRAYQLADQINWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|332085406|gb|EGI90576.1| phosphoribosylamine--glycine ligase [Shigella dysenteriae 155-74]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|293413441|ref|ZP_06656101.1| phosphoribosylamine-glycine ligase [Escherichia coli B354]
 gi|291468036|gb|EFF10535.1| phosphoribosylamine-glycine ligase [Escherichia coli B354]
          Length = 433

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 305 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 364

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 365 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERE 431


>gi|229521008|ref|ZP_04410429.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TM 11079-80]
 gi|229527229|ref|ZP_04416622.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 12129(1)]
 gi|229335237|gb|EEO00721.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 12129(1)]
 gi|229341893|gb|EEO06894.1| phosphoribosylamine--glycine ligase [Vibrio cholerae TM 11079-80]
          Length = 442

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 14  MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 73

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 74  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 133

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 134 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 193

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 194 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 253

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 254 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 313

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 314 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 373

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 374 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 433

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 434 RAIAREQAK 442


>gi|269103655|ref|ZP_06156352.1| phosphoribosylamine--glycine ligase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163553|gb|EEZ42049.1| phosphoribosylamine--glycine ligase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 428

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 197/426 (46%), Positives = 283/426 (66%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK+AQ+P +S+++  PGN G A   +   VAI +++ +A++ F 
Sbjct: 1   MQVLIIGNGGREHALAWKVAQNPEVSQIFVAPGNAGTALEPKVTNVAIAVEDIAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE  I+L +VGPE PLV G+ DA  AAG  +FGPSQ A++LE SK+F K F  ++ IPTA
Sbjct: 61  QELQIELTIVGPEAPLVLGVVDAFQAAGLAIFGPSQAASQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ +  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 QYQNFTEIEPALAYLRQQGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E NP+ G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIYPTVRGMAAEGNPYTGFLYAGLMIMNDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +RL+SD++E+  + + G L++    W    A+ VV+A  GYP  Y  G +I  +PQ    
Sbjct: 301 LRLQSDLVELCQAAIDGKLNHCQSQWDPRAAIGVVLAAGGYPGHYHKGDVICGLPQQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT  ++  +  NGGRVL ATA+G T+ ++++ AY + + IDW   ++REDIG 
Sbjct: 361 GEKVFHAGTCELDGQVVTNGGRVLCATAMGDTVQQAQQRAYQLAQQIDWDGMFYREDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRE 426


>gi|331675491|ref|ZP_08376240.1| phosphoribosylamine--glycine ligase [Escherichia coli TA280]
 gi|331067369|gb|EGI38775.1| phosphoribosylamine--glycine ligase [Escherichia coli TA280]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEADAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|301169607|emb|CBW29208.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Haemophilus influenzae 10810]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 269/427 (62%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVELALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK      T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEAMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDLRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|324110917|gb|EGC04909.1| phosphoribosylamine-glycine ligase [Escherichia fergusonii B253]
          Length = 429

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|148265862|ref|YP_001232568.1| phosphoribosylamine--glycine ligase [Geobacter uraniireducens Rf4]
 gi|146399362|gb|ABQ27995.1| phosphoribosylamine--glycine ligase [Geobacter uraniireducens Rf4]
          Length = 423

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 192/423 (45%), Positives = 271/423 (64%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHAL WKIAQSPL+ +++  PGNPGI   A+ V I + + S ++ F ++
Sbjct: 1   MKVLVIGSGGREHALVWKIAQSPLVEKVYCAPGNPGIGTIAENVDIKVDDLSGLLSFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPELPL  GI D     G KVFG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  EDIALTVVGPELPLSLGIVDLFEEYGLKVFGAQKNAAIIEASKAFSKDLMRKYNVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F++   A  ++    +PIV+KADGL AGKGV++A T DEA +A+        F    S
Sbjct: 121 EVFTEVEPAIAFIDRTGVPIVIKADGLAAGKGVIIAQTRDEAVAAVTDMLSGNSFGAAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF A  DGK  IP  +A+DHK ++DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLKGEEASFLAFTDGKNIIPLASAQDHKAVYDGDTGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   +Q+++  T++GM  E  P++GVL+AGLMI  +    +E+N RFGDPECQ ++MR+
Sbjct: 241 IHEKAMQEVMRRTVDGMAAEGRPYRGVLYAGLMIDGESVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TT 353
           +SDI+ IL +    ++    I W  + A+ VV+A +GYP +YP G  I  +         
Sbjct: 301 KSDIVPILLAVAEKDISRVQIEWHDKAAVCVVMAAEGYPGDYPRGDEIHGLDDAAKIQDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA+  +    NGGRVL  TALG T+ E+ + AY  V  I W+  ++R+DIG + 
Sbjct: 361 FVFHAGTALDKDKFVTNGGRVLGVTALGPTVKEAIDRAYQGVSLISWRGAHYRKDIGKKA 420

Query: 414 KER 416
             R
Sbjct: 421 LAR 423


>gi|85717178|ref|ZP_01048136.1| phosphoribosylamine--glycine ligase [Nitrobacter sp. Nb-311A]
 gi|85696011|gb|EAQ33911.1| phosphoribosylamine--glycine ligase [Nitrobacter sp. Nb-311A]
          Length = 426

 Score =  348 bits (892), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 224/423 (52%), Positives = 287/423 (67%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPLL++LW  PGN GIA+ A+CVA+++ +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIADSPLLTKLWCAPGNAGIAREAECVALNVADHAAVIAFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGP + AA+LESSK F K  C   GIP A Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAAAGVKAFGPGKAAAQLESSKGFTKDLCRDNGIPAAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           + F D   AK Y+     PIV+KADGL AGKGVVVA T+DEA +A+D      F    + 
Sbjct: 121 ERFKDAAAAKDYIHAHGAPIVIKADGLAAGKGVVVAMTLDEALAAVDMMFEGGFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++EE+L G E SFFALCDG+ A+P  TA+DHKR  DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 IVVEEFLRGEEASFFALCDGEHAMPLATAQDHKRAFDGDEGPNTGGMGAYSPAPVMTDEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II+PT+  M+++   F+GVLFAGLMITEQGP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CRRTMDEIIVPTLRAMREKGASFKGVLFAGLMITEQGPKLIEYNVRFGDPECQVLMLRMR 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DI+  L +   G L++  + W  + ALTVV+A KGYP  Y  GT I  +         +
Sbjct: 301 GDIVPALFAACDGQLNHFSLRWFPDPALTVVMAAKGYPGSYTKGTRIDGLDDAAKVEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + A GGRVL+  ALGKT+ +++  AY  V+ I W  G+ R DIGL+  
Sbjct: 361 IFHAGTKDDDGRILAVGGRVLNVCALGKTVAKAQARAYEAVDRIRWPEGFCRRDIGLRAV 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|32033890|ref|ZP_00134161.1| COG0151: Phosphoribosylamine-glycine ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208640|ref|YP_001053865.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae L20]
 gi|165976600|ref|YP_001652193.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|307250428|ref|ZP_07532375.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|126097432|gb|ABN74260.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876701|gb|ABY69749.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|306857557|gb|EFM89666.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 428

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 196/426 (46%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEDIKNVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|145636982|ref|ZP_01792646.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittHH]
 gi|145269840|gb|EDK09779.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittHH]
          Length = 429

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 271/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDLRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|322418174|ref|YP_004197397.1| phosphoribosylamine/glycine ligase [Geobacter sp. M18]
 gi|320124561|gb|ADW12121.1| phosphoribosylamine/glycine ligase [Geobacter sp. M18]
          Length = 423

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 187/423 (44%), Positives = 268/423 (63%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WKIAQSPL+++++  PGNPG A  A+ V I + N   ++ F ++
Sbjct: 1   MKVLVVGSGGREHALVWKIAQSPLVTKVFCAPGNPGTAALAENVDIAVDNLQGLLEFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ++L VVGPELPL  G+ D     G K FG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  EGVELTVVGPELPLSLGLVDLFEENGLKAFGARKNAAIIEASKAFSKDLMQKYDVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F++   A  ++    +PIV+KADGL AGKGV++A T DEA +A+        F    S
Sbjct: 121 GVFTEVPAAIDFIDRTGIPIVIKADGLAAGKGVIIAQTRDEAVAAVTDMLSGNAFGAAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF A  DG+  IP  +A+DHK ++DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLKGEEASFLAFTDGERIIPLASAQDHKAVYDGDKGPNTGGMGAYSPAPVVTSA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   + +++  T++GM+ E   +QGVL+AGLMI       +E+N RFGDPECQ ++MR+
Sbjct: 241 IHEKAMAEVMRRTVDGMKAEGRRYQGVLYAGLMIDGDSVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TGTT 353
           +SDI+ IL +   G+L    I W  + A+ VV+A +GYP +Y  G +IS + +       
Sbjct: 301 KSDIVPILMAVASGSLEGVEIEWHDKAAVCVVLAAEGYPADYRKGDLISGLDEAGKIEDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT      +  NGGRVL  TALG T+ E+ + AY  V+ I W   + R+DIG + 
Sbjct: 361 VVFHAGTRQSGEGIVTNGGRVLGVTALGNTVKEAIDRAYSGVKLITWPGMHHRKDIGAKA 420

Query: 414 KER 416
             R
Sbjct: 421 MNR 423


>gi|39995717|ref|NP_951668.1| phosphoribosylamine--glycine ligase [Geobacter sulfurreducens PCA]
 gi|39982481|gb|AAR33941.1| phosphoribosylamine--glycine ligase [Geobacter sulfurreducens PCA]
          Length = 423

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 188/423 (44%), Positives = 262/423 (61%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHAL WKIAQSPL+S+++  PGNPGI   A+ V++ + +   +  F  E
Sbjct: 1   MKVLVIGGGGREHALVWKIAQSPLVSKVYCAPGNPGIGLIAENVSLAVDDLDGLAAFATE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL  GI D     G  +FG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  QSIDLTVVGPELPLSLGIVDRFEEKGLLIFGARRNAAIIEASKAFSKDLMKKYQVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F++   A  ++    +PIVVKADGL AGKGV++A T +EA  A+        F    S
Sbjct: 121 DVFTEVEPAVAFIDRVGVPIVVKADGLAAGKGVIIAHTREEAVGAVMDMLSGNAFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF A  DGK  IP  +A+DHK + DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLTGEEASFLAFTDGKNIIPLASAQDHKAVFDGDTGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++  V+ +++  T++GM  E  P++GVL+AGLMI       +E+N RFGDPECQ ++MR+
Sbjct: 241 IHDKVMAEVMRRTVDGMAAEGRPYRGVLYAGLMINGDQVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SDI+ +L +   G+L    + W    A+ VV+A+ GYP +Y  G  I  +         
Sbjct: 301 KSDIVPVLLAVARGDLSGIELEWHDMAAVCVVMASGGYPADYRKGDEIRGLEDAARMEDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT+  N  +  +GGRVL  TALG T+ E+ + AY  V  I W   ++R+DIG + 
Sbjct: 361 FVFHAGTSRKNGRIVTSGGRVLGVTALGATVGEAIDRAYRGVAAISWDGVHYRKDIGAKA 420

Query: 414 KER 416
             R
Sbjct: 421 LTR 423


>gi|255282669|ref|ZP_05347224.1| phosphoribosylamine--glycine ligase [Bryantella formatexigens DSM
           14469]
 gi|255266690|gb|EET59895.1| phosphoribosylamine--glycine ligase [Bryantella formatexigens DSM
           14469]
          Length = 424

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 180/422 (42%), Positives = 260/422 (61%), Gaps = 8/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHA+AWK+AQSP + +++  PGN GI Q+A+CV I       +  F +E
Sbjct: 1   MKVLIVGSGGREHAIAWKVAQSPRVEKIYCAPGNAGIEQYAECVNIGAMEFEKLAAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL V+G + PLV G+ D     G +VFGP   AA LE SK+F+K    KY IPTA Y
Sbjct: 61  KEIDLTVIGMDDPLVGGVVDVFEKEGLRVFGPRANAAILEGSKAFSKDLMKKYHIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           ++F DP  A  Y++    PIV+KADGL  GKGV++  T++EA +      +D+ F    +
Sbjct: 121 ENFDDPQAALAYLETAKFPIVLKADGLALGKGVLICNTLEEAQAGVKTIMLDKQFGASGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE++ G EVS  +  DGKT    T+A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 181 RMVIEEFMTGREVSVLSFVDGKTIKTMTSAQDHKRAGDGDTGLNTGGMGTFSPSPFYTKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I  PT++ M  E   F+G++F GLM+T  GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 IDEFCQKYIYQPTVDAMAAEGREFKGIIFFGLMLTADGPKVLEYNARFGDPETQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTT 353
           ++DI+++  +C+ G L   ++ +    A+ VV+A+ GYP +Y  G  I  +    +    
Sbjct: 301 KTDIVDVFEACIDGTLDKVNLEFADNAAVCVVLASDGYPVKYEKGLPIRGLENFADKDGY 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT      +  NGGRVL  TA GK + E+R  AY  V  ID+ + Y+R DIG + 
Sbjct: 361 YVFHAGTKRTEAGIVTNGGRVLGVTATGKDLKEARANAYEAVNWIDFDNKYYRHDIG-KA 419

Query: 414 KE 415
            +
Sbjct: 420 ID 421


>gi|119899185|ref|YP_934398.1| phosphoribosylamine--glycine ligase [Azoarcus sp. BH72]
 gi|119671598|emb|CAL95511.1| Phosphoribosylamine--glycine ligase [Azoarcus sp. BH72]
          Length = 425

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 189/424 (44%), Positives = 270/424 (63%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHALAWK+AQSP ++ +   PGNPG A+  +   + +    A++   ++
Sbjct: 1   MKVLVIGSGGREHALAWKLAQSPRVTRVLVAPGNPGTAREPKLQNVSVTAIDALVTLARD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   VVGPE PL  G+ DA  AAG  +FGP++ AA+LESSK FAK+F  ++ IPTA Y
Sbjct: 61  EQVGFTVVGPEAPLAAGVVDAFRAAGLPIFGPTKNAAQLESSKDFAKRFLVRHNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q FSD  +A  Y++ +  PIV+KADGL AGKGVVVA T+DEA  AID            +
Sbjct: 121 QTFSDAAEAHAYIEAEGAPIVIKADGLAAGKGVVVAMTLDEAHGAIDMMLLDNKMGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+++G E SF  + DGK A+P  T++DHKR+ DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 RVVIEEFMQGEEASFIVMADGKHALPLATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II PT+ GM  +  P+ G L+AGLMI +   P ++E+N R GDPE Q +MMR
Sbjct: 241 VHARVMREIIQPTLAGMAADGLPYTGFLYAGLMIDDAGKPRVVEFNCRMGDPETQPIMMR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTT 353
           L++D+ +++ + + G L      W    AL VV+A  GYP+    G  IS +P       
Sbjct: 301 LKTDLADLVEAAIAGKLDQAETEWDRRIALGVVLAAGGYPDSPKKGDAISGLPAAALDDA 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA  +  +   GGRVL  TALG  +  +++ AY + + I ++   +R DIG + 
Sbjct: 361 HVFHAGTAEQDGAIVTAGGRVLCVTALGDNVKAAQKRAYELADAIQFEGRQFRRDIGHRA 420

Query: 414 KERN 417
             R 
Sbjct: 421 VARK 424


>gi|320179531|gb|EFW54482.1| Phosphoribosylamine--glycine ligase [Shigella boydii ATCC 9905]
          Length = 429

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKIIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|332083897|gb|EGI89110.1| phosphoribosylamine--glycine ligase [Shigella boydii 5216-82]
          Length = 429

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHK + D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKHVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|310766095|gb|ADP11045.1| Phosphoribosylamine-glycine ligase [Erwinia sp. Ejp617]
          Length = 426

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 191/425 (44%), Positives = 273/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +   +++F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALQNVAISPTDIQGLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + IDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LNEKIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYQNFTEVEPALAYVRKKGAPIVIKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVRGMAAEGNVYTGFLYAGLMINKSGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V+GNL      W    +L VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAAVNGNLDQKDSVWDPRPSLGVVLAAGGYPGDYVNGQQIHGLPVEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL  TALG+ +  +++ AY + + I W   + R DIG 
Sbjct: 361 DGKVFHAGTTLQDDRVVTSGGRVLCVTALGEDVAAAQQRAYQLAKPISWHGSFCRTDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIDR 425


>gi|311281440|ref|YP_003943671.1| phosphoribosylamine/glycine ligase [Enterobacter cloacae SCF1]
 gi|308750635|gb|ADO50387.1| phosphoribosylamine/glycine ligase [Enterobacter cloacae SCF1]
          Length = 429

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 196/427 (45%), Positives = 280/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+S ++  PGN G A     Q VAI + +   +++F 
Sbjct: 1   MKVLIIGNGGREHALAWKAAQSPLVSTVFVAPGNAGTALEPALQNVAIGVTDIPELLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTDVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT+ GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVRGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++E+  +   G L +    W    +L VV+A  GYP  Y +G  I  +P +   
Sbjct: 301 LRLQSDLVELCLAACDGKLGDKTSRWDTRASLGVVMAAGGYPGSYRNGDEIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTRLSDDDRVLTNGGRVLCVTALGNTVAEAQQRAYQLMTDIHWDGSFSRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|145634052|ref|ZP_01789763.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittAA]
 gi|145268496|gb|EDK08489.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittAA]
          Length = 429

 Score =  347 bits (891), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 274/427 (64%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKAAQSPLADKVFVTPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAENAVHDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSQVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM++E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMREVIYPTVNGMEEEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W  + +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVTSRWDPQASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|224585715|ref|YP_002639514.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224470243|gb|ACN48073.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|322717123|gb|EFZ08694.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 429

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 194/429 (45%), Positives = 280/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|260770648|ref|ZP_05879579.1| phosphoribosylamine--glycine ligase [Vibrio furnissii CIP 102972]
 gi|260614374|gb|EEX39562.1| phosphoribosylamine--glycine ligase [Vibrio furnissii CIP 102972]
          Length = 430

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 196/428 (45%), Positives = 276/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK+AQ+P +  ++  PGN G A  A+   V I +++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKVAQNPAVETVFIAPGNAGTALEAKLQNVDIAVEDVAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q ++  V+Q++I PT+ GM  E NP+ G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR++SD++E+  + + G L      W    ++ +V+A  GYP +Y  G IIS +P     
Sbjct: 301 MRMQSDLVELCLAAIDGKLDQVESKWDPRASIGIVLAAGGYPGDYAKGDIISGLPTTEVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG T++E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTTDKDGHVVTNGGRVLCATALGNTVSEAQQRAYELAKQISWHGMFHRNDIGY 420

Query: 412 QKKERNVK 419
           +   R  +
Sbjct: 421 RAIAREQE 428


>gi|315178406|gb|ADT85320.1| phosphoribosylamine--glycine ligase [Vibrio furnissii NCTC 11218]
          Length = 430

 Score =  347 bits (891), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 196/428 (45%), Positives = 276/428 (64%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           MRVL+IGSGGREHAL WK+AQ+P +  ++  PGN G A  A+   V I +++ + ++ F 
Sbjct: 1   MRVLIIGSGGREHALGWKVAQNPAVETVFIAPGNAGTALEAKLQNVDIAVEDVAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVRKQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q ++  V+Q++I PT+ GM  E NP+ G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QAIHDRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR++SD++E+  + + G L      W    ++ +V+A  GYP +Y  G IIS +P     
Sbjct: 301 MRMQSDLVELCLAAIDGKLDQVESKWDPRASIGIVLAAGGYPGDYAKGDIISGLPTTEVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT   + ++  NGGRVL ATALG T++E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTTDKDGHVVTNGGRVLCATALGNTVSEAQQRAYELAKQISWHGMFHRNDIGY 420

Query: 412 QKKERNVK 419
           +   R  +
Sbjct: 421 RAIAREQE 428


>gi|320353910|ref|YP_004195249.1| phosphoribosylamine/glycine ligase [Desulfobulbus propionicus DSM
           2032]
 gi|320122412|gb|ADW17958.1| phosphoribosylamine/glycine ligase [Desulfobulbus propionicus DSM
           2032]
          Length = 588

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 189/423 (44%), Positives = 267/423 (63%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHAL WK+ QS  +  +   PGN GI   A+CV I   + + ++ F  +
Sbjct: 1   MKVLVIGSGGREHALVWKLKQSKTVKAVVCAPGNAGIKAIAECVDIAAGDLAGLLDFAVK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL +VGPE PL  GI D     G ++FGP+ + A LE SK F K FC KY IPTA Y
Sbjct: 61  ERIDLTIVGPEEPLAKGIVDLFEENGLRIFGPNSKGAILEGSKVFTKDFCAKYRIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
             F+    AK++++   MP V+KADGL AGKGV++  T+ EA         D+ F    +
Sbjct: 121 GAFTKRGAAKKFLKTMDMPCVIKADGLAAGKGVIIVQTIAEAEQAIDLIMKDKAFGAAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE+L+G E SF A  DG T +P  +++DHK I +GD+GPNTGGMGA SPA  M+  
Sbjct: 181 QVVVEEFLQGEEASFIAFTDGTTVLPLPSSQDHKAIFEGDLGPNTGGMGAYSPAPVMTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V+++I+LPTI GM  E  P++G+L+AGLMI      ++E+N RFGDPECQ ++MRL
Sbjct: 241 LTTRVMEEIMLPTIRGMASEGRPYKGMLYAGLMIDGDRINVLEFNCRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
            +D++EI+N C+ G L    ++      + VV+A++GYP +Y  G  I+ + Q    G  
Sbjct: 301 NNDLVEIINGCIDGTLDRIQLDIDPRPTVCVVMASEGYPGKYVTGKTIAGLAQAAKVGGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA     +  +GGRVL  TA+G TI E+ + AY  V+ I W+  Y+R DIG + 
Sbjct: 361 EVFHAGTATKGRQVITSGGRVLGVTAIGATIKEALDRAYQAVDLIKWEGCYFRRDIGHRA 420

Query: 414 KER 416
             R
Sbjct: 421 LAR 423


>gi|168264569|ref|ZP_02686542.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205346981|gb|EDZ33612.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMADIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|153826744|ref|ZP_01979411.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MZO-2]
 gi|297581739|ref|ZP_06943661.1| phosphoribosylamine-glycine ligase [Vibrio cholerae RC385]
 gi|149739459|gb|EDM53697.1| phosphoribosylamine--glycine ligase [Vibrio cholerae MZO-2]
 gi|297534146|gb|EFH72985.1| phosphoribosylamine-glycine ligase [Vibrio cholerae RC385]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|306812020|ref|ZP_07446228.1| phosphoribosylamine--glycine ligase [Escherichia coli NC101]
 gi|305854625|gb|EFM55061.1| phosphoribosylamine--glycine ligase [Escherichia coli NC101]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q V I + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVDIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|168823111|ref|ZP_02835111.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205340587|gb|EDZ27351.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|320088605|emb|CBY98364.1| phosphoribosylamine-glycine ligase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 281/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A+++F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A+ GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIASGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|329894593|ref|ZP_08270399.1| Phosphoribosylamine--glycine ligase [gamma proteobacterium
           IMCC3088]
 gi|328922947|gb|EGG30275.1| Phosphoribosylamine--glycine ligase [gamma proteobacterium
           IMCC3088]
          Length = 423

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 190/423 (44%), Positives = 262/423 (61%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQS  +  ++  PGN G  + A    VAID  +  A+  F 
Sbjct: 1   MNVLIIGSGGREHALAYKAAQSESVETVFVAPGNAGTEREAGLVNVAIDPLDFDALAAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            E  + L +VGPE PLV GI D     G   FGPSQ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  IENGVGLTIVGPEAPLVAGIVDDFTQRGLPCFGPSQAAAQLEGSKAFTKAFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
           +YQ F++   A  Y+  +  PIVVKADGL AGKGV+VA T  EA  A+        F   
Sbjct: 121 SYQTFTEVEPAVGYITAQGAPIVVKADGLAAGKGVIVATTEQEAIDAVTDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE L G E SF  +CDGK A+P  +++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GCRVVIEECLLGEEASFIVVCDGKNAVPMASSQDHKRVGEGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT++GM  E   + G L+AGLMI TE  P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHDRIMAEVIYPTLKGMASEGADYTGFLYAGLMIDTEGTPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL+SD++ +  + + G L    + W    ++ VV+A  GYP +YP G +IS + Q ++ 
Sbjct: 301 MRLKSDLIALCQAALAGELDGRDVEWDPRPSMGVVLAAGGYPADYPKGDVISGLEQADSE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    N++  NGGRVL  TALG  +  +++  Y  ++ I W+   +R DIG 
Sbjct: 361 DVKVFHAGTKSNGNDVVTNGGRVLCVTALGSDLQAAQQNCYDAIKAISWEGMNYRRDIGW 420

Query: 412 QKK 414
           +  
Sbjct: 421 RAL 423


>gi|193066412|ref|ZP_03047459.1| phosphoribosylamine--glycine ligase [Escherichia coli E22]
 gi|194429955|ref|ZP_03062464.1| phosphoribosylamine--glycine ligase [Escherichia coli B171]
 gi|209921485|ref|YP_002295569.1| phosphoribosylamine--glycine ligase [Escherichia coli SE11]
 gi|218556560|ref|YP_002389474.1| phosphoribosylamine--glycine ligase [Escherichia coli IAI1]
 gi|260846805|ref|YP_003224583.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O103:H2 str. 12009]
 gi|293474313|ref|ZP_06664722.1| phosphoribosylamine-glycine ligase [Escherichia coli B088]
 gi|300819817|ref|ZP_07100004.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 107-1]
 gi|192925936|gb|EDV80583.1| phosphoribosylamine--glycine ligase [Escherichia coli E22]
 gi|194411984|gb|EDX28297.1| phosphoribosylamine--glycine ligase [Escherichia coli B171]
 gi|209914744|dbj|BAG79818.1| phosphoribosylglycinamide synthase [Escherichia coli SE11]
 gi|218363329|emb|CAR00979.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli IAI1]
 gi|257761952|dbj|BAI33449.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O103:H2 str. 12009]
 gi|291321343|gb|EFE60784.1| phosphoribosylamine-glycine ligase [Escherichia coli B088]
 gi|300527638|gb|EFK48700.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 107-1]
 gi|323161302|gb|EFZ47211.1| phosphoribosylamine--glycine ligase [Escherichia coli E128010]
 gi|323943606|gb|EGB39714.1| phosphoribosylamine-glycine ligase [Escherichia coli H120]
 gi|324017341|gb|EGB86560.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 117-3]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|284048613|ref|YP_003398952.1| phosphoribosylamine/glycine ligase [Acidaminococcus fermentans DSM
           20731]
 gi|283952834|gb|ADB47637.1| phosphoribosylamine/glycine ligase [Acidaminococcus fermentans DSM
           20731]
          Length = 427

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 182/428 (42%), Positives = 265/428 (61%), Gaps = 8/428 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREH L WK+AQS  +++L++ PGNPG+   A+CV +DI +   +  + ++
Sbjct: 1   MQVLVIGGGGREHTLVWKLAQSKKVTKLYAAPGNPGMKDLAECVDLDIADLDGLADWAEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PLV GI D   A G  +FGPS +AA++E SK F+K+   KYG+PTA +
Sbjct: 61  HAIDLTVVGPEAPLVAGIVDVFKARGLTIFGPSAKAAEIEGSKIFSKELMEKYGVPTAFF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN-----S 175
           +   +   A+ +V+ K  PIV+KADGL AGKGVVVA T DEA +A+D            +
Sbjct: 121 KVCDNLADARAFVEEKGAPIVIKADGLAAGKGVVVAMTRDEALAALDEMMGAHKFGSAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE++EG E S  A  DGKT +P   A+DHKR++DGD GPNTGGMGA  PA  M+  
Sbjct: 181 RVVIEEFMEGEEASLLAFTDGKTIVPMLAAQDHKRVNDGDQGPNTGGMGAYCPAPVMTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    +++++ P ++ + KE  P+ G L+AGLMI      ++E+N RFGDPE Q ++  L
Sbjct: 241 LKEKTVKEVLRPIVDALAKEGRPYSGCLYAGLMIKGDSVKVVEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SD+ EI+ +C +G L    + W  + A+ VV+A+ GYP  Y  G  I+ +         
Sbjct: 301 KSDLAEIMVACANGTLTPDLVEWSDKAAVCVVMASGGYPASYKKGIPITGLKAANAMDNV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT   +  +  NGGRVL  TA+   I  +++ AY  V+ I +   ++R+DI  + 
Sbjct: 361 VVFHAGTREEDGKILTNGGRVLGVTAVADDIPSAQQKAYDAVDKIHFDGAHYRQDIAWRA 420

Query: 414 KERNVKYR 421
             R +K +
Sbjct: 421 L-RRLKAK 427


>gi|147673352|ref|YP_001218530.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O395]
 gi|262168019|ref|ZP_06035718.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC27]
 gi|146315235|gb|ABQ19774.1| phosphoribosylamine--glycine ligase [Vibrio cholerae O395]
 gi|227012117|gb|ACP08327.1| phosphoribosylamine-glycine ligase [Vibrio cholerae O395]
 gi|262023552|gb|EEY42254.1| phosphoribosylamine--glycine ligase [Vibrio cholerae RC27]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 276/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA +AI        F   
Sbjct: 121 AYANFTEIEPALAYVRKKGAPIVVKADGLAAGKGVIVAMTLQEAENAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|300919424|ref|ZP_07135928.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 115-1]
 gi|300413517|gb|EFJ96827.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 115-1]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   I++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTIERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|237727858|ref|ZP_04558339.1| phosphoribosylglycineamide synthetase [Citrobacter sp. 30_2]
 gi|226910415|gb|EEH96333.1| phosphoribosylglycineamide synthetase [Citrobacter sp. 30_2]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 194/429 (45%), Positives = 280/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYIGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVELCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|121727035|ref|ZP_01680226.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V52]
 gi|254225656|ref|ZP_04919263.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V51]
 gi|121630546|gb|EAX62936.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V52]
 gi|125621776|gb|EAZ50103.1| phosphoribosylamine--glycine ligase [Vibrio cholerae V51]
 gi|327483147|gb|AEA77554.1| Phosphoribosylamine--glycine ligase [Vibrio cholerae LMA3894-4]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|301019446|ref|ZP_07183619.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 69-1]
 gi|300399261|gb|EFJ82799.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 69-1]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             ++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DGVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|229844767|ref|ZP_04464906.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae 6P18H1]
 gi|229812481|gb|EEP48171.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae 6P18H1]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 270/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMVTSQDHKRVGENDTGLNTGGMGAYSPAPVIT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDLRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|262404999|ref|ZP_06081551.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC586]
 gi|262348838|gb|EEY97979.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC586]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 201/429 (46%), Positives = 276/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V+I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVSIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q T 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPSDYAKGDVISGLPTQETA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    N +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGNQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQTK 429


>gi|218707624|ref|YP_002415143.1| phosphoribosylamine--glycine ligase [Escherichia coli UMN026]
 gi|293407622|ref|ZP_06651540.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1412]
 gi|298383370|ref|ZP_06992962.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1302]
 gi|300897580|ref|ZP_07115989.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 198-1]
 gi|331665662|ref|ZP_08366558.1| phosphoribosylamine--glycine ligase [Escherichia coli TA143]
 gi|218434721|emb|CAR15653.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli UMN026]
 gi|291425390|gb|EFE98430.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1412]
 gi|298276249|gb|EFI17770.1| phosphoribosylamine-glycine ligase [Escherichia coli FVEC1302]
 gi|300358656|gb|EFJ74526.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 198-1]
 gi|331057180|gb|EGI29172.1| phosphoribosylamine--glycine ligase [Escherichia coli TA143]
          Length = 429

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + ++  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLTDDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|15964611|ref|NP_384964.1| phosphoribosylamine--glycine ligase [Sinorhizobium meliloti 1021]
 gi|20139566|sp|Q92RL0|PUR2_RHIME RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|15073789|emb|CAC45430.1| Probable phosphoribosylamine--glycine ligase [Sinorhizobium
           meliloti 1021]
          Length = 423

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 226/421 (53%), Positives = 292/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L++L++ PGNPGIA+ A  V +  +NH  ++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VVVGPE PLV G+ D L AA    FGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDFVVVGPEAPLVAGLGDVLRAADIPTFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   AK Y++ +  PIV+KADGL AGKGV VA ++DEA +A+D CF          
Sbjct: 121 RRFTDAEPAKAYIREEGAPIVIKADGLAAGKGVTVAMSLDEAFAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK+ +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKSVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 VERTMKEIIEPTVRGMAESGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L      W+ E ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLYAAATGTLEGMKAEWRDEAALTVVMASRGYPGAYEKDTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+    L A GGRVL+ TA GKT+ E+++ AY  V ++ W++G++R DIG +   R
Sbjct: 361 HAGTAMKGGGLVAAGGRVLNVTATGKTVGEAKDAAYAAVRDVSWENGFYRNDIGWRAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|262163816|ref|ZP_06031556.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM223]
 gi|262027796|gb|EEY46461.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM223]
          Length = 429

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 200/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRTAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI +   P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q T 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQETA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|157163474|ref|YP_001460792.1| phosphoribosylamine--glycine ligase [Escherichia coli HS]
 gi|331670860|ref|ZP_08371695.1| phosphoribosylamine--glycine ligase [Escherichia coli TA271]
 gi|157069154|gb|ABV08409.1| phosphoribosylamine--glycine ligase [Escherichia coli HS]
 gi|324115437|gb|EGC09382.1| phosphoribosylamine-glycine ligase [Escherichia coli E1167]
 gi|331061948|gb|EGI33872.1| phosphoribosylamine--glycine ligase [Escherichia coli TA271]
          Length = 429

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|254502378|ref|ZP_05114529.1| phosphoribosylamine--glycine ligase [Labrenzia alexandrii DFL-11]
 gi|222438449|gb|EEE45128.1| phosphoribosylamine--glycine ligase [Labrenzia alexandrii DFL-11]
          Length = 423

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 221/422 (52%), Positives = 291/422 (68%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREH+LAW +A+SP L++L++ PGN GIA HA+   +D+ +H+A+I FC++
Sbjct: 1   MKVLLIGSGGREHSLAWALAKSPKLTKLYAAPGNAGIAAHAELSDLDVSDHAAVITFCRD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I+ VVVGPE PLV G+ D L+AAG K FGPS+ AA+LE SK+F K  C +  IPTA Y
Sbjct: 61  KQIEFVVVGPEAPLVAGLVDDLDAAGIKAFGPSKAAAQLEGSKAFTKAVCDEANIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F +   A  YV+ K  PIV+KADGL AGKGVVVA T+ +A +A+  C    F    S 
Sbjct: 121 GRFDNAADALNYVRTKGAPIVIKADGLAAGKGVVVAMTLADAEAAVTDCFDGTFGAAGSE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E SFF L DG  A+P  TA+DHKR +DGD GPNTGGMGA SPA  ++ +L
Sbjct: 181 VVIEEFLEGEEASFFVLSDGINALPLATAQDHKRAYDGDEGPNTGGMGAYSPAPVLTDDL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V++ I+ PTI  + K   PF+GVL+AGLMIT  GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 VADVMRSIVEPTIATLSKRGTPFKGVLYAGLMITSDGPKLIEYNTRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTGTTQL 355
           SD+LE++ +   G L  +H +W  + ALTVV+A KGYP  Y  GT I  +   ++   ++
Sbjct: 301 SDLLELMIASADGTLDQSHADWHDDVALTVVMAAKGYPGVYKKGTEIKGLNVISSDEAEV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT    + + ANGGRVL+ TALG ++ +++  AY  V  IDW  G+ R DIG +   
Sbjct: 361 FHAGTKSDGDKILANGGRVLNITALGTSVKDAQAAAYKAVSKIDWPEGFCRSDIGWRAVA 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|146309882|ref|YP_001174956.1| phosphoribosylamine--glycine ligase [Enterobacter sp. 638]
 gi|145316758|gb|ABP58905.1| phosphoribosylamine--glycine ligase [Enterobacter sp. 638]
          Length = 430

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +S ++  PGN G A       VAI + +  A+++F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPRVSTVFVAPGNAGTALEPTLQNVAIGVTDIPALLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  QSEKIDLTIVGPEAPLVIGVVDAFRAAGLTIFGPTEGAAQLEGSKAFTKDFLARHKIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   + +II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDDRASLGVVIAAGGYPGDYRNGDEIHGLPLEEVD 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  NGGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 GGKVFHAGTKLADDDRVLTNGGRVLCATALGNTVAEAQKRAYALMADIHWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|170683731|ref|YP_001746390.1| phosphoribosylamine--glycine ligase [Escherichia coli SMS-3-5]
 gi|218702640|ref|YP_002410269.1| phosphoribosylamine--glycine ligase [Escherichia coli IAI39]
 gi|170521449|gb|ACB19627.1| phosphoribosylamine--glycine ligase [Escherichia coli SMS-3-5]
 gi|218372626|emb|CAR20501.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli IAI39]
          Length = 429

 Score =  347 bits (889), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|257465544|ref|ZP_05629915.1| phosphoribosylamine--glycine ligase [Actinobacillus minor 202]
 gi|257451204|gb|EEV25247.1| phosphoribosylamine--glycine ligase [Actinobacillus minor 202]
          Length = 430

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 197/426 (46%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+ QSPL S+++  PGN G A     + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVRQSPLASKVFVAPGNAGTALEEGIENVAISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQNAIGLTIVGPEAPLVVGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLRQKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+++II PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 ADIHQRVMEEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RLESD++E+      G L      W A+ AL +V+A +GYP +Y  G  I+ +P +N  
Sbjct: 301 LRLESDLVELCLKACDGKLDKIQSKWCAQAALGIVLAAEGYPADYRKGDEITGLPTENRA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL ATALG T+ E+++ A  + E I W+  ++R DIG 
Sbjct: 361 DEKVFLAGVEQKEGKLLTNGGRVLCATALGATVFEAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|258624507|ref|ZP_05719451.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM603]
 gi|258583204|gb|EEW08009.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM603]
          Length = 429

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 201/429 (46%), Positives = 278/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V+I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVSIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI +   P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q T 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQETA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I+W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQINWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|153830384|ref|ZP_01983051.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 623-39]
 gi|148874118|gb|EDL72253.1| phosphoribosylamine--glycine ligase [Vibrio cholerae 623-39]
          Length = 429

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVRKKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYTKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 EQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIHWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|16131835|ref|NP_418433.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. MG1655]
 gi|89110033|ref|AP_003813.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. W3110]
 gi|170083466|ref|YP_001732786.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. DH10B]
 gi|187730149|ref|YP_001882691.1| phosphoribosylamine--glycine ligase [Shigella boydii CDC 3083-94]
 gi|188495477|ref|ZP_03002747.1| phosphoribosylamine--glycine ligase [Escherichia coli 53638]
 gi|238903062|ref|YP_002928858.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli BW2952]
 gi|254039262|ref|ZP_04873311.1| phosphoribosylglycineamide synthetase [Escherichia sp. 1_1_43]
 gi|300947387|ref|ZP_07161580.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 116-1]
 gi|300954763|ref|ZP_07167193.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 175-1]
 gi|301023376|ref|ZP_07187166.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 196-1]
 gi|301645738|ref|ZP_07245659.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 146-1]
 gi|307140697|ref|ZP_07500053.1| phosphoribosylamine--glycine ligase [Escherichia coli H736]
 gi|312974208|ref|ZP_07788378.1| phosphoribosylamine--glycine ligase [Escherichia coli 1827-70]
 gi|331644742|ref|ZP_08345860.1| phosphoribosylamine--glycine ligase [Escherichia coli H736]
 gi|417557|sp|P15640|PUR2_ECOLI RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|42596|emb|CAA36213.1| purD gene product [Escherichia coli K-12]
 gi|396344|gb|AAC43103.1| phosphoribosylglycineamide synthetase [Escherichia coli str. K-12
           substr. MG1655]
 gi|1790438|gb|AAC76979.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. MG1655]
 gi|85676064|dbj|BAE77314.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K12 substr. W3110]
 gi|169891301|gb|ACB05008.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli str. K-12 substr. DH10B]
 gi|187427141|gb|ACD06415.1| phosphoribosylamine--glycine ligase [Shigella boydii CDC 3083-94]
 gi|188490676|gb|EDU65779.1| phosphoribosylamine--glycine ligase [Escherichia coli 53638]
 gi|226838497|gb|EEH70527.1| phosphoribosylglycineamide synthetase [Escherichia sp. 1_1_43]
 gi|238862063|gb|ACR64061.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli BW2952]
 gi|260451166|gb|ACX41588.1| phosphoribosylamine/glycine ligase [Escherichia coli DH1]
 gi|299880896|gb|EFI89107.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 196-1]
 gi|300318262|gb|EFJ68046.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 175-1]
 gi|300452991|gb|EFK16611.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 116-1]
 gi|301075987|gb|EFK90793.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 146-1]
 gi|310331375|gb|EFP98640.1| phosphoribosylamine--glycine ligase [Escherichia coli 1827-70]
 gi|315138562|dbj|BAJ45721.1| phosphoribosylamine--glycine ligase [Escherichia coli DH1]
 gi|315617370|gb|EFU97976.1| phosphoribosylamine--glycine ligase [Escherichia coli 3431]
 gi|320172733|gb|EFW47967.1| Phosphoribosylamine--glycine ligase [Shigella dysenteriae CDC
           74-1112]
 gi|323174482|gb|EFZ60107.1| phosphoribosylamine--glycine ligase [Escherichia coli LT-68]
 gi|323933953|gb|EGB30427.1| phosphoribosylamine-glycine ligase [Escherichia coli E1520]
 gi|323938878|gb|EGB35098.1| phosphoribosylamine-glycine ligase [Escherichia coli E482]
 gi|331036042|gb|EGI08279.1| phosphoribosylamine--glycine ligase [Escherichia coli H736]
          Length = 429

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|126664722|ref|ZP_01735706.1| phosphoribosylamine--glycine ligase [Marinobacter sp. ELB17]
 gi|126631048|gb|EBA01662.1| phosphoribosylamine--glycine ligase [Marinobacter sp. ELB17]
          Length = 428

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 266/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQS L   ++  PGN G A  A  + VAID+ + + +  F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSELADTVFVAPGNAGTATEAGVENVAIDVMDLNGLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              ++ L +VGPE PLV G+ D     G +VFGPS  AA+LE SK+F K F  +  IPT 
Sbjct: 61  ARNNVGLTIVGPEAPLVAGVVDLFEERGLRVFGPSAGAAQLEGSKAFTKDFLARQKIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
           +Y +F+D  +A  YV+ +  PIVVKADGL AGKGV+VA  + EA +A+        F   
Sbjct: 121 SYGNFTDVDEALAYVRQQGAPIVVKADGLAAGKGVIVAMNLAEAENAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG   +   T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGDNVLAMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
             ++  ++ ++I PT+ GM+ E +P++G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PNVHQRIMDEVIYPTVRGMKAEGHPYKGFLYAGLMIDSAGAPRVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +R++SD++ +  + + G L     +W    A+ +V+A  GYP  Y  G +IS + +  T 
Sbjct: 301 LRMQSDLVALCQAAIDGKLDQCSSDWDPRAAVGIVLAAGGYPGSYSKGDVISGLSETETE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             + FHAGT +  N +  NGGRVL ATALG T+TE+++ AY +   I W   ++R+DI  
Sbjct: 361 GEKAFHAGTKLDGNQVVTNGGRVLCATALGNTVTEAQQRAYKLARKISWNGAFYRKDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|284924097|emb|CBG37196.1| phosphoribosylglycineamide synthetase [Escherichia coli 042]
          Length = 429

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|85709866|ref|ZP_01040931.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. NAP1]
 gi|85688576|gb|EAQ28580.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. NAP1]
          Length = 428

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 203/421 (48%), Positives = 276/421 (65%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLL+GSGGREHALAWK+AQSP L +L++ PGNPGIA+ A+CV++D  +H A++ FC+ 
Sbjct: 1   MNVLLLGSGGREHALAWKLAQSPSLGKLFAAPGNPGIAEEAECVSLDASDHGAVVSFCRS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVV+GPE PLV+G++D+L AA    FGPS+ AA+LE SK F K  C +  IPT  Y
Sbjct: 61  HEIALVVIGPEAPLVDGLADSLAAADIPAFGPSKAAAQLEGSKGFTKDLCARAEIPTGGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN----ST 176
                  +A   +   S P V+KADGL AGKGVV++ T + A + +   F        + 
Sbjct: 121 VRTHSRDEAVAALDGFSAPFVLKADGLAAGKGVVISPTREHAEATLSDMFGGQFGSAGAQ 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E SFFA+ DG   IP  TA+DHK++ +GD G NTGGMGA SPA  +++ L
Sbjct: 181 VVIEEFLEGEEASFFAITDGTHVIPLGTAQDHKQVGEGDKGANTGGMGAYSPAPVLTEAL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              V+ +II PT++ M+ E  P+ GVL+AGLM+T  GP LIEYN RFGDPECQ +MMR +
Sbjct: 241 QQRVMDEIIRPTVDTMRSEGMPYSGVLYAGLMLTATGPQLIEYNCRFGDPECQVLMMRYQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
            D+  ++ +C  G L      +  E ALTVV+A KGYP     G  I+         ++F
Sbjct: 301 GDLAAMMLACAKGELEGAGAAFAQETALTVVMAAKGYPGTPQKGGAIALGDAEANGAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTAI + +L ANGGRVL+ TA G ++TE+++ AY  V  +D+  G++R DIG ++  R
Sbjct: 361 HAGTAIKDGSLVANGGRVLNVTATGASVTEAQKAAYDAVAKVDFASGFYRSDIGWKEVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|307257228|ref|ZP_07538999.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306864270|gb|EFM96182.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 428

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A     + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP++Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPDDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++    + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQVLKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|315634700|ref|ZP_07889984.1| phosphoribosylamine-glycine ligase [Aggregatibacter segnis ATCC
           33393]
 gi|315476648|gb|EFU67396.1| phosphoribosylamine-glycine ligase [Aggregatibacter segnis ATCC
           33393]
          Length = 429

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 198/429 (46%), Positives = 271/429 (63%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKIFVAPGNAGTALEQKVENVNISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ HI L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDNHIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALSYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEKDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHDRVMREVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +RLESD++E+      GNL      W  + +L +V+A +GYP +Y  G  IS +PQN   
Sbjct: 301 LRLESDLVELCLKACDGNLDEVKSQWNPKASLGIVLAAEGYPGDYRKGAEISGLPQNAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL ATALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVEAKAGKLVTNGGRVLCATALGESVFEAQQKALKLAEQIQWNGRFYRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R  K 
Sbjct: 421 RAVAREQKK 429


>gi|169334735|ref|ZP_02861928.1| hypothetical protein ANASTE_01141 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257473|gb|EDS71439.1| hypothetical protein ANASTE_01141 [Anaerofustis stercorihominis DSM
           17244]
          Length = 416

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 176/415 (42%), Positives = 252/415 (60%), Gaps = 5/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL +K+ QSPL++E++  PGN GIA  A+CV I + +  ++  F + 
Sbjct: 1   MKVLVVGSGGREHALVYKLKQSPLVTEVFCAPGNAGIANIAECVDIKVDDIDSLKEFAKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I L V+GPELPLV GI D     G KVFGP+++ A  E SK   K+F  KY IPTA Y
Sbjct: 61  NEIGLTVIGPELPLVMGIVDEFEKEGLKVFGPNKKCAAFEGSKGLTKRFLEKYKIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
              +   +  + ++N   P+VVKADGL AGKGV++    + A +A+             +
Sbjct: 121 LEVTTYEEGVKNLENFGFPVVVKADGLAAGKGVIICENREMAVNALKDIMVDKVFGDSGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           +V+IEE+L G E+S     DG   IP  +ARD+K  +D D G NTGGMG  SP      +
Sbjct: 181 SVVIEEFLTGTELSTLCFVDGNKIIPMESARDYKPAYDNDEGLNTGGMGNYSPNKIFDDK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V  KI+ P I+G + E+  ++GVLF GLM+    P ++E+NVRFGDPE Q +M+RL
Sbjct: 241 LNAKVRTKILDPIIKGFKSEELDYKGVLFIGLMVENGEPKVLEFNVRFGDPETQVVMLRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ESD+  I+ +   G L    I W  E ++ VV+ + GYPE Y +G +IS + + +    +
Sbjct: 301 ESDLANIMLNTADGILEEDDIVWSDESSVCVVMVSGGYPESYENGKVISGLDKVSEDVIV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FHAGT     ++  NGGRVL+  A+G+T+ E+RE  Y+ V  I +   Y+R DI 
Sbjct: 361 FHAGTKREGEDIVTNGGRVLNICAVGETLDEAREKVYNEVNKISYDGAYFRNDIA 415


>gi|298504729|gb|ADI83452.1| phosphoribosylamine--glycine ligase [Geobacter sulfurreducens
           KN400]
          Length = 423

 Score =  347 bits (889), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 187/423 (44%), Positives = 262/423 (61%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHAL WKIAQSPL+S+++  PGNPGI   A+ V++ + +   +  F  E
Sbjct: 1   MKVLVIGGGGREHALVWKIAQSPLVSKVYCAPGNPGIGLIAENVSLAVDDLDGLAAFATE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL  GI D     G  +FG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  QSIDLTVVGPELPLSLGIVDRFEEKGLLIFGARRNAAIIEASKAFSKDLMKKYQVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F++   A  ++    +PIVVKADGL AGKGV++A T +EA  A+        F    S
Sbjct: 121 DVFTEVEPAVAFIDRVGVPIVVKADGLAAGKGVIIAHTREEAVGAVTDMLSGNAFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF A  DGK  IP  +A+DHK + DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLTGEEASFLAFTDGKNIIPLASAQDHKAVFDGDTGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++  V+ +++  T++GM  E  P++GVL+AGLMI       +E+N RFGDPECQ ++MR+
Sbjct: 241 IHDKVMAEVMRRTVDGMAAEGRPYRGVLYAGLMINGDQVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SDI+ +L +   G+L    + W  + A+ VV+A  GYP +Y  G  I  +         
Sbjct: 301 KSDIVPVLLAVARGDLSGIELEWHDKAAVCVVMAAGGYPADYRKGDEIRGLEDAARMEDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT+  +  +  +GGRVL  TALG T+ E+ + AY  V+ I W   ++R DIG + 
Sbjct: 361 FVFHAGTSRKDGRIVTSGGRVLGVTALGATVGEAIDRAYRGVQAISWDGVHYRTDIGAKA 420

Query: 414 KER 416
             R
Sbjct: 421 LTR 423


>gi|303253251|ref|ZP_07339400.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248196|ref|ZP_07530224.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|302647933|gb|EFL78140.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306855373|gb|EFM87548.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 428

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 274/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIA--QHAQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEDIKNVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPPQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++    + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQVLKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|110644340|ref|YP_672070.1| phosphoribosylamine--glycine ligase [Escherichia coli 536]
 gi|191174304|ref|ZP_03035812.1| phosphoribosylamine--glycine ligase [Escherichia coli F11]
 gi|218692286|ref|YP_002400498.1| phosphoribosylamine--glycine ligase [Escherichia coli ED1a]
 gi|300985436|ref|ZP_07177439.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 200-1]
 gi|331660566|ref|ZP_08361499.1| phosphoribosylamine--glycine ligase [Escherichia coli TA206]
 gi|110345932|gb|ABG72169.1| phosphoribosylamine-glycine ligase [Escherichia coli 536]
 gi|190905436|gb|EDV65067.1| phosphoribosylamine--glycine ligase [Escherichia coli F11]
 gi|218429850|emb|CAR10676.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli ED1a]
 gi|300306528|gb|EFJ61048.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 200-1]
 gi|315300748|gb|EFU59973.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 16-3]
 gi|324015259|gb|EGB84478.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 60-1]
 gi|331052349|gb|EGI24387.1| phosphoribosylamine--glycine ligase [Escherichia coli TA206]
          Length = 429

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|307261655|ref|ZP_07543322.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868647|gb|EFN00457.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 428

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 273/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A     + VAI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENVAIAATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+  +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLVAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++    + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQVLKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|260596105|ref|YP_003208676.1| phosphoribosylamine--glycine ligase [Cronobacter turicensis z3032]
 gi|260215282|emb|CBA27209.1| Phosphoribosylamine--glycine ligase [Cronobacter turicensis z3032]
          Length = 441

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 189/432 (43%), Positives = 273/432 (63%), Gaps = 12/432 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK  QSP +  ++  PGN G A     Q VAI+  +  A++ F 
Sbjct: 10  MKVLVIGNGGREHALAWKAVQSPHVETVFVAPGNAGTALEPALQNVAINPTDIPALLSFA 69

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           + ++IDL +VGPE PLV G+ DA  AAG ++FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 70  RAENIDLTIVGPEAPLVIGVVDAFRAAGLRIFGPTKGAAQLEGSKAFTKDFLARHRIPTA 129

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 130 EYQNFTETEPALAYIREKGAPIVIKADGLAAGKGVIVAMTLAEAEAAVLDMLAGNAFGDA 189

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+   P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 190 GHRIVVEEFLDGEEASFIVMVDGEHVEPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 249

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT+ GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 250 DDVFQRTMERIIWPTVRGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 309

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-- 350
           MRL+SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P     
Sbjct: 310 MRLQSDLVELCLAACDGKLDTVKSQWDPRPSLGVVMAAGGYPGDYRTGDVIHGLPIEEIA 369

Query: 351 -GTTQLFHAGTA-IVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
            G  ++FHAGT    ++ +  +GGRVL  TALG ++ +++  AY + E+I W   + R+D
Sbjct: 370 NGDGKVFHAGTTLRDDDRVVTSGGRVLCVTALGDSVAQAQARAYRLAEDIHWDDCFCRKD 429

Query: 409 IGLQKKERNVKY 420
           IG +   R    
Sbjct: 430 IGYRAIAREQAK 441


>gi|156935795|ref|YP_001439711.1| phosphoribosylamine--glycine ligase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156534049|gb|ABU78875.1| hypothetical protein ESA_03671 [Cronobacter sakazakii ATCC BAA-894]
          Length = 432

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 195/432 (45%), Positives = 275/432 (63%), Gaps = 12/432 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK  QSPL+  ++  PGN G A     Q VAI   +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAVQSPLVETVFVAPGNAGTALEPALQNVAISPTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q ++IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QAENIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTKGAAQLEGSKAFTKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTETEPALAYIREKGAPIVIKADGLAAGKGVIVAMTLAEAETAVLDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+   P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVEPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT+ GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVFQRTMERIIWPTVRGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-- 350
           MRL+SD++E+  +   G L      W A  AL VV+A  GYP +Y  G +I  +P     
Sbjct: 301 MRLQSDLVELCLAACEGKLDTVKSQWDARPALGVVMAAGGYPGDYRTGDVIHGLPIEEIA 360

Query: 351 -GTTQLFHAGTA-IVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
            G  ++FHAGT    ++ +  +GGRVL  TALG ++ +++  AY + E+I W   + R+D
Sbjct: 361 NGDGKVFHAGTTLRDDDRVVTSGGRVLCVTALGDSVAQAQARAYRLAEDIHWDDCFCRKD 420

Query: 409 IGLQKKERNVKY 420
           IG +   R  + 
Sbjct: 421 IGYRAIAREQEK 432


>gi|163867866|ref|YP_001609070.1| phosphoribosylamine--glycine ligase [Bartonella tribocorum CIP
           105476]
 gi|161017517|emb|CAK01075.1| Phosphoribosylamine-glycine ligase [Bartonella tribocorum CIP
           105476]
          Length = 424

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 224/423 (52%), Positives = 294/423 (69%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL +L+  PGNP   +  + + +DI +H  +I FC+E
Sbjct: 1   MNILLIGSGGREHALAWKIAASPLLKKLYCAPGNPATTEFGENINLDIDDHPLVIDFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV+GI+D+LN A   VFGP+Q+AA+LE SK+F K  C K  IPT +Y
Sbjct: 61  HSIDLVIVGPEAPLVSGITDSLNRAKICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTGSY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F+D  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA +A+D C    F    + 
Sbjct: 121 QCFNDAAKAKAYIHQRGVPIVIKADGLAAGKGVVVATTIEEAFNAVDACFKSAFGDAGNK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IE +LEG E SFF LCDGK A+PF +A+DHKR+ DGD G NTGGMGA SPA  M++E+
Sbjct: 181 IVIESFLEGEEASFFCLCDGKIALPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P ++ M +   PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALKSMHEIGAPFKGILFVGLMITQKGPELIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL I  +   G L N  + W  E ALTVV+A  GYP     GT+I  + +       +
Sbjct: 301 DDILPIFLAAAQGKLENKPLQWSDETALTVVMAAHGYPSSPQKGTVIRNVDKVNTLPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L ANGGRVL+ TA GKTIT +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALRNGELIANGGRVLNITATGKTITNAQKRAYEAVDCIDWPEGFVRRDIGWRAI 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|51246040|ref|YP_065924.1| phosphoribosylamine--glycine ligase [Desulfotalea psychrophila
           LSv54]
 gi|50877077|emb|CAG36917.1| probable phosphoribosylamine--glycine ligase [Desulfotalea
           psychrophila LSv54]
          Length = 590

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 192/430 (44%), Positives = 271/430 (63%), Gaps = 7/430 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WKI QS  + E++  PGN GI + A CV I   +   ++HF Q+
Sbjct: 1   MKVLVVGSGGREHALVWKIKQSQKVEEVFCAPGNAGIEELATCVNISATDIKGLLHFAQK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE  LV GI D     G ++FGPSQ AA LE SK F K F  KY IPTA +
Sbjct: 61  EKIDLTVVGPESSLVAGIVDLFEENGLRIFGPSQAAAILEGSKVFTKNFLQKYSIPTAAF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
             F++   AK+Y++ +  PIVVKADGL AGKGVVVA T++EA  A+D         +   
Sbjct: 121 GVFTEREAAKEYIEQQGAPIVVKADGLAAGKGVVVAKTIEEAKKAVDEIMLDKAFGEAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           ++++E  L G E SF A  DGKT +P  T++DHK  +DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 SIVVESCLLGEEASFIAFTDGKTILPLPTSQDHKAAYDGDKGPNTGGMGAYSPAPIVTDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V+ +++LPTI+G+  E  P++G+L+AGLMI      ++E+N RFGDPE Q ++MRL
Sbjct: 241 ITEYVMTEVMLPTIKGLAAEGRPYKGMLYAGLMIDGDDIKVLEFNCRFGDPEAQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SDI++I  +C+ G L    +       + VV+++ GYP  Y  G II+   Q       
Sbjct: 301 KSDIIDIFEACIDGTLDRVEMKIDPRPTVCVVMSSGGYPGAYASGDIITGFEQADKVDGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA     + +NGGRVL  T++GKT+ ++ E AY   + I W   ++R+DIG + 
Sbjct: 361 EVFHAGTAKEGEAIVSNGGRVLGITSIGKTLEQALERAYKATDCITWNKCFYRKDIGGKA 420

Query: 414 KERNVKYRNK 423
             + +   +K
Sbjct: 421 LAKKLAKPSK 430


>gi|281181069|dbj|BAI57399.1| phosphoribosylglycinamide synthetase [Escherichia coli SE15]
 gi|330908321|gb|EGH36840.1| phosphoribosylamine--glycine ligase [Escherichia coli AA86]
          Length = 429

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|297544100|ref|YP_003676402.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|296841875|gb|ADH60391.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 419

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 167/415 (40%), Positives = 256/415 (61%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+  K++QS  + +++  PGN GI   A+CV I + +   +  F  +
Sbjct: 1   MKVLVIGGGGREHAIVHKLSQSSKVDKIYCAPGNAGIGLLAECVDIKVGDIERLKEFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +IDL VVGPE+PLV GI D    AG K+FGP++ AA +E SK F K+  +KY IPT  +
Sbjct: 61  NNIDLTVVGPEMPLVQGIVDEFEKAGLKIFGPNKSAAAIEGSKYFTKQLLSKYNIPTGRF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F    +  ++++    P+V+KADGL  GKGV +     EA          R F     
Sbjct: 121 KAFDKYQEVLKFLKETWYPVVMKADGLAQGKGVFIVKDFIEAKEALDLMMKKRIFGASGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VIIEE L G E S FA  DG+  +P  +A D+K++++GD GPNTGGMG+ +P   + +E
Sbjct: 181 IVIIEEMLFGKEASVFAFTDGENILPMVSAMDYKKVYEGDKGPNTGGMGSIAPNPYLEEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               V++ I+ P ++ +QKE   ++GVL+AGLM+TE+GP ++E+N RFGDPE Q ++  L
Sbjct: 241 TLKEVMESILKPMVKALQKEGIVYKGVLYAGLMLTEEGPKVLEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+++I+ + + G L    I W+ + A+ VV  + GYP EY  G  I+ + +      +
Sbjct: 301 KTDLIDIMEATIEGKLDKIQIEWENKKAVCVVAVSNGYPGEYQIGFEITGLEKVKE-AFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +HAGTA+ +  +T +GGRVL+ T +G +  E+RE  Y  +E I +   Y+R+DI 
Sbjct: 360 YHAGTALKDGKITTSGGRVLAVTTIGDSYEEAREKVYKEIEKIRFDGMYYRKDIA 414


>gi|289577813|ref|YP_003476440.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter italicus
           Ab9]
 gi|289527526|gb|ADD01878.1| phosphoribosylamine/glycine ligase [Thermoanaerobacter italicus
           Ab9]
          Length = 419

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 166/415 (40%), Positives = 255/415 (61%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+  K++QS  + +++  PGN GI   A+CV I + +   +  F  +
Sbjct: 1   MKVLVIGGGGREHAIVHKLSQSSKVDKIYCAPGNAGIGLLAECVDIKVGDIERLKEFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +IDL VVGPE+PLV GI D    A  K+FGP++ AA +E SK F K+  +KY IPT  +
Sbjct: 61  NNIDLTVVGPEMPLVQGIVDEFEKARLKIFGPNKSAAAIEGSKYFTKQLLSKYNIPTGRF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F    +A ++++    P+V+KADGL  GKGV +     EA          R F     
Sbjct: 121 RAFDKYQEALKFLKEAWYPVVMKADGLAQGKGVFIVKDFIEAKEVLDLMMKKRIFGASGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VIIEE L G E S FA  DG+  +P  +A D+K++++GD GPNTGGMG+ +P   + ++
Sbjct: 181 IVIIEEMLFGKEASVFAFTDGENILPMVSAMDYKKVYEGDKGPNTGGMGSIAPNPYLKEK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               V+  I+ P ++ +QKE   ++GVL+AGLM+TE+GP ++E+N RFGDPE Q ++  L
Sbjct: 241 TLKEVMDSILKPVVKALQKEGIVYKGVLYAGLMLTEEGPKVLEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+++I+ + + G L    I W+ + A+ VV  + GYP EY  G  I+ + +      +
Sbjct: 301 KTDLIDIMEATIEGKLDKIQIEWENKKAVCVVAVSNGYPGEYQIGFEITGLEKVKE-AFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +HAGTA+ +  +T +GGRVL+ T +G +  E+RE  Y  +E I +   Y+R+DI 
Sbjct: 360 YHAGTALKDGKITTSGGRVLAVTTIGDSYEEAREKVYKEIEKIRFDGMYYRKDIA 414


>gi|188996498|ref|YP_001930749.1| phosphoribosylamine/glycine ligase [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931565|gb|ACD66195.1| phosphoribosylamine/glycine ligase [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 424

 Score =  346 bits (888), Expect = 3e-93,   Method: Composition-based stats.
 Identities = 184/423 (43%), Positives = 260/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G+GGREHAL WKI QS L+ E++   GN GI + A+ V I   +   ++ F +E
Sbjct: 1   MKVLVVGNGGREHALVWKIKQSSLVKEVYCASGNAGIGKIAKRVNISPTDIYNLVRFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PL  GI D  N  G K+FG  + AA LE+SK FAK    KYGIPTA +
Sbjct: 61  NKIDLTVVGPEQPLSEGIVDRFNEEGLKIFGHQKSAAILEASKVFAKNLMKKYGIPTAKF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           + F     A ++++    PIV+KADGL AGKGVVVA T +EA  A+       F   +  
Sbjct: 121 ESFEKEEDAIKFIKEVGAPIVIKADGLAAGKGVVVAKTEEEAIQAVKDMFAGKFGPASKR 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG E S+         +P  T++DHKR +D D GPNTGGMGA SP   ++ ++
Sbjct: 181 VVIEEFLEGEEASYICFVKDDKLVPMPTSQDHKRAYDNDEGPNTGGMGAYSPCSLITPKM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
              + +KI+ PT+  M  E     G L+AGLMI  +G  ++E+NVR GDPE Q +M RL+
Sbjct: 241 EKEIQEKIVYPTLRAMINEGRSMCGFLYAGLMIGPKGINVLEFNVRMGDPETQPIMRRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQ 354
           SD++E +   + GN+ N    W  +YA+ VV+A+KGYP+ Y  G +I+ I +        
Sbjct: 301 SDLVEHILEILEGNIENVKPKWNPDYAIGVVMASKGYPDAYEKGKVITGIEEAEKDQDVV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT  V+  +  NGGRVL+ TA G+ I ++RE  Y  +E I ++  ++R+DIG ++ 
Sbjct: 361 VFHAGTEEVDGKIITNGGRVLTVTATGEDIIKAREKVYSAIEKIHFEGAFYRKDIGFREV 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|253987887|ref|YP_003039243.1| phosphoribosylamine--glycine ligase [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253779337|emb|CAQ82498.1| phosphoribosylglycinamide synthetase [Photorhabdus asymbiotica]
          Length = 427

 Score =  346 bits (888), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 195/425 (45%), Positives = 269/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSPL  +++  PGN G       + + I   +   ++ F 
Sbjct: 1   MNILIIGSGGREHALAWKAAQSPLADKIYVAPGNAGTELENHLENIDISATDIDGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I+L +VGPE PLV GI D    AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIELTIVGPEAPLVMGIVDVFQNAGLTIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+    +PIV+KADGL AGKGV+VA T +EA SAI        F   
Sbjct: 121 AYQNFTEIEPALTYLDKVGVPIVIKADGLAAGKGVIVAMTREEARSAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DGK  IP  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLTGEEASFIVMVDGKNVIPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E + + G L+AGLMI  +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRIMEEVIYPTVNGMAAEGHVYTGFLYAGLMINQDGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ SD++E+  +   G L     +W    AL VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 MRMHSDLIELCLAGAKGELAGKTSDWDKRPALGVVLAANGYPADYHKGDIIHGLPQQENG 360

Query: 353 T-QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++FHAGTA+ +NN+  +GGRVL  TALG+TI  +++ AY   E I W   ++R+DIG 
Sbjct: 361 SNKVFHAGTALQDNNVITSGGRVLCVTALGETIANAQKNAYQQAEQITWNGCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|194445679|ref|YP_002043423.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194404342|gb|ACF64564.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
          Length = 429

 Score =  346 bits (888), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 194/429 (45%), Positives = 280/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|215489337|ref|YP_002331768.1| phosphoribosylamine--glycine ligase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|215267409|emb|CAS11860.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O127:H6 str. E2348/69]
          Length = 429

 Score =  346 bits (888), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|16762282|ref|NP_457899.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29143770|ref|NP_807112.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161617314|ref|YP_001591279.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197249645|ref|YP_002149083.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|213161650|ref|ZP_03347360.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213428475|ref|ZP_03361225.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213580342|ref|ZP_03362168.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213612382|ref|ZP_03370208.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213647188|ref|ZP_03377241.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289826731|ref|ZP_06545696.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|20139495|sp|Q8Z334|PUR2_SALTI RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|25293795|pir||AC0931 phosphoribosylglycineamide synthetase [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504586|emb|CAD09469.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139405|gb|AAO70972.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161366678|gb|ABX70446.1| hypothetical protein SPAB_05165 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197213348|gb|ACH50745.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|331685748|ref|ZP_08386330.1| phosphoribosylamine--glycine ligase [Escherichia coli H299]
 gi|331077058|gb|EGI48274.1| phosphoribosylamine--glycine ligase [Escherichia coli H299]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYHTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|331649859|ref|ZP_08350937.1| phosphoribosylamine--glycine ligase [Escherichia coli M605]
 gi|331041325|gb|EGI13477.1| phosphoribosylamine--glycine ligase [Escherichia coli M605]
          Length = 433

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 305 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 364

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 365 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERE 431


>gi|260913709|ref|ZP_05920185.1| phosphoribosylamine-glycine ligase [Pasteurella dagmatis ATCC
           43325]
 gi|260632248|gb|EEX50423.1| phosphoribosylamine-glycine ligase [Pasteurella dagmatis ATCC
           43325]
          Length = 427

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 188/425 (44%), Positives = 267/425 (62%), Gaps = 8/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A     + VAI   +   ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEDKVENVAISATDVEKLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QENQIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLEEAEIAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  ++Q++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 AEIHDRIMQEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+SD++E+  +   G L      W  + +L +V+A +GYP +Y  G  I+ I      
Sbjct: 301 LRLDSDLVELCLAACEGKLDEKKSQWCEKASLGIVLAAEGYPGDYRKGDEITGIESAVEN 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            ++F AG    +  L  NGGRV+  TALG ++ ++++ A  + E + W   ++R DIG +
Sbjct: 361 QKVFLAGVENKDGKLVTNGGRVVCVTALGDSVYDAQQQALRLAEKVKWAGRFYRRDIGYR 420

Query: 413 KKERN 417
              R 
Sbjct: 421 AVARE 425


>gi|301325714|ref|ZP_07219173.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 78-1]
 gi|300847503|gb|EFK75263.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 78-1]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D  PN GGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTDPNPGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|91203298|emb|CAJ72937.1| strongly similar to glycinamide ribonucleotide synthetase (GARS,
           glycinamide ribonucleotide synthetase) [Candidatus
           Kuenenia stuttgartiensis]
          Length = 435

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 186/421 (44%), Positives = 273/421 (64%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IGSGGREHA+AWKIAQSP + +++  PGNPGIA+ A+CV ID+ N   + +F   
Sbjct: 15  MKILIIGSGGREHAIAWKIAQSPKVKKIFCAPGNPGIAEVAECVDIDVNNIEGLFNFAIR 74

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL++GI D        +FGPS+RA+ +E SK FAK    K+ IPTA +
Sbjct: 75  QKIDLTVVGPEDPLLSGIVDTFKDGNLDIFGPSKRASLIEGSKVFAKTIMKKHSIPTADF 134

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F D   A++Y++    PIV+KADGL  GKGV V  T++EA   +              
Sbjct: 135 RVFEDIKMAEKYLEKCFAPIVIKADGLAKGKGVFVCKTLEEAKEHLQEIMVERIFGNAGD 194

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE L G EVS  A+ DG+T IP ++ARDHK I++G+ GPNTGGMGA SP+  ++ E
Sbjct: 195 RVVIEECLHGEEVSILAITDGQTIIPLSSARDHKAIYEGNKGPNTGGMGAYSPSHLITNE 254

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V + I++P I  M++E  P+ G+++AGLM+T  GP ++E+N RFGDPE QA+++R+
Sbjct: 255 MQRYVEENILVPIIHAMKRENRPYSGIIYAGLMLTNAGPKVLEFNARFGDPETQALLVRM 314

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           +SD+  +L +  +  L    + W   +++ VV+A+KGYP +Y  G  IS +   +     
Sbjct: 315 KSDLASLLLAASNNTLDKAELEWYDSHSVCVVLASKGYPGKYRKGLPISGLQAVKALKNI 374

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           Q+FHAGTA V+ N+  NGGRVL  TA GK + E+R   Y  ++ + ++  Y+R+DIG+  
Sbjct: 375 QVFHAGTANVHGNIVTNGGRVLGITATGKDLKEARTFVYDAIDRLSFEGVYYRKDIGVDA 434

Query: 414 K 414
            
Sbjct: 435 I 435


>gi|270265440|ref|ZP_06193699.1| phosphoribosylamine--glycine ligase [Serratia odorifera 4Rx13]
 gi|270040633|gb|EFA13738.1| phosphoribosylamine--glycine ligase [Serratia odorifera 4Rx13]
          Length = 431

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 271/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A       VAI   +  A++ F 
Sbjct: 5   MNILIIGNGGREHALAWKVAQSPLADKVYVAPGNAGTALEPNLANVAISATDIPALVAFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 65  QSHDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  YV++K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 125 EYQNFTDVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVVEEFLDGEEASFIVMVDGENVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++   + ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 245 DEIHQRAMDQVIWPTVRGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL SD++E+  +   G L      W    AL VV+A  GYP +Y +G +I  +PQ    
Sbjct: 305 LRLRSDLVELCLAGAEGKLGEKTSEWDDRPALGVVLAAGGYPGDYSNGDVIQGLPQQESV 364

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +   ++  NGGRVL  TALG T+ E+++ AY + + I W+  + R DIG 
Sbjct: 365 DGKVFHAGTRMQGEDVVTNGGRVLCVTALGATVAEAQQRAYQLAKGIQWQGSFCRNDIGY 424

Query: 412 QKKERN 417
           +   R 
Sbjct: 425 RAIARG 430


>gi|26250777|ref|NP_756817.1| phosphoribosylamine--glycine ligase [Escherichia coli CFT073]
 gi|91212789|ref|YP_542775.1| phosphoribosylamine--glycine ligase [Escherichia coli UTI89]
 gi|117626267|ref|YP_859590.1| phosphoribosylamine--glycine ligase [Escherichia coli APEC O1]
 gi|218561071|ref|YP_002393984.1| phosphoribosylamine--glycine ligase [Escherichia coli S88]
 gi|227885464|ref|ZP_04003269.1| phosphoribosylamine--glycine ligase [Escherichia coli 83972]
 gi|237702772|ref|ZP_04533253.1| phosphoribosylamine-glycine ligase [Escherichia sp. 3_2_53FAA]
 gi|300977007|ref|ZP_07173725.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 45-1]
 gi|301047742|ref|ZP_07194799.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 185-1]
 gi|29427781|sp|Q8FB69|PUR2_ECOL6 RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|26111208|gb|AAN83391.1|AE016770_191 Phosphoribosylamine--glycine ligase [Escherichia coli CFT073]
 gi|91074363|gb|ABE09244.1| Phosphoribosylamine--glycine ligase [Escherichia coli UTI89]
 gi|115515391|gb|ABJ03466.1| phosphoribosylamine--glycine ligase [Escherichia coli APEC O1]
 gi|218367840|emb|CAR05635.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli S88]
 gi|226903085|gb|EEH89344.1| phosphoribosylamine-glycine ligase [Escherichia sp. 3_2_53FAA]
 gi|227837538|gb|EEJ48004.1| phosphoribosylamine--glycine ligase [Escherichia coli 83972]
 gi|294492808|gb|ADE91564.1| phosphoribosylamine--glycine ligase [Escherichia coli IHE3034]
 gi|300300377|gb|EFJ56762.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 185-1]
 gi|300409926|gb|EFJ93464.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 45-1]
 gi|307556148|gb|ADN48923.1| phosphoribosylamine--glycine ligase [Escherichia coli ABU 83972]
 gi|307628379|gb|ADN72683.1| phosphoribosylamine--glycine ligase [Escherichia coli UM146]
 gi|315288326|gb|EFU47725.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 110-3]
 gi|315294359|gb|EFU53710.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 153-1]
 gi|320197099|gb|EFW71717.1| Phosphoribosylamine--glycine ligase [Escherichia coli WV_060327]
 gi|323948824|gb|EGB44721.1| phosphoribosylamine-glycine ligase [Escherichia coli H252]
 gi|323953783|gb|EGB49590.1| phosphoribosylamine-glycine ligase [Escherichia coli H263]
 gi|324009502|gb|EGB78721.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 57-2]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|258620639|ref|ZP_05715676.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM573]
 gi|258587154|gb|EEW11866.1| phosphoribosylamine--glycine ligase [Vibrio mimicus VM573]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 275/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVETIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTKGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+ GM  E N + G L+AGLMI +   P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDKTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+    + G L      W    ++ VV+A  GYP +Y  G +IS +P Q   
Sbjct: 301 MRLQSDLVELCQVAIAGKLDQMESKWDPRASIGVVLAAGGYPGDYAKGDVISGLPTQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I+W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQINWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|260870716|ref|YP_003237118.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O111:H- str. 11128]
 gi|257767072|dbj|BAI38567.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O111:H- str. 11128]
 gi|323177561|gb|EFZ63146.1| phosphoribosylamine--glycine ligase [Escherichia coli 1180]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKVFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|157368541|ref|YP_001476530.1| phosphoribosylamine--glycine ligase [Serratia proteamaculans 568]
 gi|157320305|gb|ABV39402.1| phosphoribosylamine--glycine ligase [Serratia proteamaculans 568]
          Length = 427

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  +  + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALESNLENVAISATDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+++K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTEVEPALAYLRSKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+LEG E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLEGEEASFIVMVDGENVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++   + +II PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRAMDQIIWPTVRGMAAEGNTYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L      W    AL VV+A  GYP +Y +G +I  +PQ  + 
Sbjct: 301 LRLRSDLVELCLAGAEGKLGEKTSEWDERPALGVVLAAGGYPGDYNNGEVIQGLPQQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  N++  +GGRVL  TALG+++ ++++ AY + E I W   + R+DIG 
Sbjct: 361 DGKVFHAGTRMQGNDVVTSGGRVLCVTALGESVAQAQQRAYQLAEGIQWPGSFSRKDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARG 426


>gi|251793046|ref|YP_003007772.1| phosphoribosylamine--glycine ligase [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534439|gb|ACS97685.1| phosphoribosylamine--glycine ligase [Aggregatibacter aphrophilus
           NJ8700]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 266/429 (62%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL ++++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLANKIFVAPGNAGTALEQKVENVNIAATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ HI L +VGPE PLV G+ DA  A G  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDNHIGLTIVGPEAPLVIGVVDAFRAVGLNIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEEAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEKDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHERVMREVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RLESD++E+      G L      W  + +L +V+A +GYP +Y  G  IS +PQ    
Sbjct: 301 LRLESDLVELCLKACDGKLDEVKSQWNPKASLGIVLAAEGYPGDYRKGDEISGLPQSAVE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL  TALG+++ E+++ A    E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVEAKAGKLVTNGGRVLCVTALGESVFEAQQKALKQAEQIQWNGRFYRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R  K 
Sbjct: 421 RAVAREQKK 429


>gi|168239601|ref|ZP_02664659.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194734737|ref|YP_002117076.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194710239|gb|ACF89460.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197287734|gb|EDY27125.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|322616284|gb|EFY13194.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322617273|gb|EFY14175.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625955|gb|EFY22770.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626647|gb|EFY23449.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631482|gb|EFY28239.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635195|gb|EFY31913.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322642600|gb|EFY39196.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646811|gb|EFY43315.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322650809|gb|EFY47202.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655891|gb|EFY52192.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657290|gb|EFY53569.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322665552|gb|EFY61737.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669735|gb|EFY65880.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670986|gb|EFY67118.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322679190|gb|EFY75243.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322679348|gb|EFY75395.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322688115|gb|EFY84079.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195792|gb|EFZ80967.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200697|gb|EFZ85770.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202186|gb|EFZ87242.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209297|gb|EFZ94232.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211622|gb|EFZ96459.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323218040|gb|EGA02753.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221329|gb|EGA05751.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225744|gb|EGA09965.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230968|gb|EGA15085.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235750|gb|EGA19832.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240064|gb|EGA24110.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323242603|gb|EGA26625.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249689|gb|EGA33596.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323252572|gb|EGA36413.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323256934|gb|EGA40646.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262043|gb|EGA45607.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323263951|gb|EGA47465.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268436|gb|EGA51906.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 429

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 280/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +++ IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  RDEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|85375370|ref|YP_459432.1| phosphoribosylamine--glycine ligase [Erythrobacter litoralis
           HTCC2594]
 gi|84788453|gb|ABC64635.1| phosphoribosylamine-glycine ligase [Erythrobacter litoralis
           HTCC2594]
          Length = 426

 Score =  346 bits (887), Expect = 4e-93,   Method: Composition-based stats.
 Identities = 211/425 (49%), Positives = 281/425 (66%), Gaps = 6/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWK+AQSP  ++L++ PGNPGIA+ A+CV +D+ +H A+  FC  
Sbjct: 1   MNILLIGSGGREHALAWKLAQSPSCTKLYAAPGNPGIAEDAECVTLDVADHGAVAEFCTN 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I LVVVGPE PLV+G+ D+L AAG  VFGP+ + A+LE SK F K  C + GIPTA Y
Sbjct: 61  KDIALVVVGPEAPLVDGLGDSLRAAGIAVFGPNAKPAQLEGSKGFTKDLCERAGIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN----ST 176
              +   +A Q ++    P V+KADGL AGKGVV+A T ++A +A+   F        + 
Sbjct: 121 VRTTSLDEATQALERFEAPHVLKADGLAAGKGVVIAETREDAQAALADMFGGQFGEAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++ G E SFFAL DG   +P  TA+DHKRI DGD+GPNTGGMGA SPA  ++ +L
Sbjct: 181 VVIEEFMAGEEASFFALTDGTAIVPIGTAQDHKRIGDGDVGPNTGGMGAYSPAPILTDDL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V+ +II PT+  +++E  P+ GVL+AGLM+TE GP LIEYN RFGDPECQ +MMRL+
Sbjct: 241 QARVMAEIIEPTVTTLREEGMPYSGVLYAGLMLTETGPKLIEYNARFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGN-LHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
            D+ E++ +C  G     +      E ALTVV+A KGYP     G  I          ++
Sbjct: 301 EDLAELMLACAEGRLGEFSDAKMAPETALTVVMAAKGYPGTPEKGGSIDLGQAQANGAKV 360

Query: 356 FHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           FHAGT    N  L ANGGRVL+ TA G  ++E++  AY  V+ ID+  G+ R DIG ++ 
Sbjct: 361 FHAGTKRDANGTLVANGGRVLNVTATGPNVSEAQRAAYQAVDAIDFPTGFCRRDIGWREI 420

Query: 415 ERNVK 419
           +R  K
Sbjct: 421 KRERK 425


>gi|222035716|emb|CAP78461.1| Phosphoribosylamine--glycine ligase [Escherichia coli LF82]
 gi|312948579|gb|ADR29406.1| phosphoribosylamine--glycine ligase [Escherichia coli O83:H1 str.
           NRG 857C]
          Length = 429

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLIELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|190150500|ref|YP_001969025.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307263843|ref|ZP_07545448.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915631|gb|ACE61883.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306870832|gb|EFN02571.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 428

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A     + VAI   +  A+  F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENVAIAATDVPALAAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT+ GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVRGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++    + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQVLKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|206889968|ref|YP_002249062.1| phosphoribosylamine--glycine ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206741906|gb|ACI20963.1| phosphoribosylamine--glycine ligase [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 421

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 186/418 (44%), Positives = 271/418 (64%), Gaps = 8/418 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHA+ WK+AQS ++ +++  PGN GI++ A+CV ++ +N SA++ F + 
Sbjct: 1   MKVLVIGSGGREHAIVWKLAQSKVVDKIYCAPGNAGISEIAECVEVESKNFSALLDFVKY 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI D     G K+ GP++  A++ESSK FAK F  ++ IPT+ Y
Sbjct: 61  EWIDLTVVGPEEPLAKGIVDIFQKEGRKIIGPTKAGAQIESSKVFAKDFMKRHKIPTSEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F+    A++Y++ K  PIV+KADGL AGKGV V  + DEA         ++ F     
Sbjct: 121 KVFTSYTHAEEYIRLKGTPIVIKADGLAAGKGVFVCQSYDEAVDALKLIMKEKAFGSAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE L+G EVS+    DGKT IP  T++DHKR+ D D GPNTGGMG  SP   ++ E
Sbjct: 181 RVVIEECLQGKEVSYLVFTDGKTIIPMVTSKDHKRLLDNDEGPNTGGMGTFSPNPIITPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   +++ +I PTI+G+++E   ++G+L+AGLMI    PY++E+N RFGDPE Q ++ RL
Sbjct: 241 LEYEILETVIKPTIKGLKQEGIVYKGILYAGLMIINNKPYVLEFNCRFGDPETQVILPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           E+DI++I  +     L+   + WK E +L V++A++GYP +Y  G  I  +   +     
Sbjct: 301 ETDIMDIFMAIAEQKLNKVDVKWKNEASLCVILASEGYPGKYKKGIPIYGLEMFKGLKDI 360

Query: 354 QLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +FHAGT    +  +  NGGRVL  TALGK I E+R+ AY  VE I ++   +R+DIG
Sbjct: 361 TVFHAGTKFDDDGKIVTNGGRVLGITALGKDIKEARQKAYSAVEFIKFEGMQYRKDIG 418


>gi|170770126|ref|ZP_02904579.1| phosphoribosylamine--glycine ligase [Escherichia albertii TW07627]
 gi|170121008|gb|EDS89939.1| phosphoribosylamine--glycine ligase [Escherichia albertii TW07627]
          Length = 429

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDDRASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|323963776|gb|EGB59275.1| phosphoribosylamine-glycine ligase [Escherichia coli M863]
 gi|327250478|gb|EGE62188.1| phosphoribosylamine--glycine ligase [Escherichia coli STEC_7v]
          Length = 429

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHLRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|218697713|ref|YP_002405380.1| phosphoribosylamine--glycine ligase [Escherichia coli 55989]
 gi|256021674|ref|ZP_05435539.1| phosphoribosylamine--glycine ligase [Shigella sp. D9]
 gi|260858115|ref|YP_003232006.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O26:H11 str. 11368]
 gi|218354445|emb|CAV01261.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli 55989]
 gi|257756764|dbj|BAI28266.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia coli O26:H11 str. 11368]
 gi|323155545|gb|EFZ41722.1| phosphoribosylamine--glycine ligase [Escherichia coli EPECa14]
 gi|323182105|gb|EFZ67515.1| phosphoribosylamine--glycine ligase [Escherichia coli 1357]
 gi|332105269|gb|EGJ08615.1| phosphoribosylglycinamide synthetase [Shigella sp. D9]
          Length = 429

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|331655706|ref|ZP_08356696.1| phosphoribosylamine--glycine ligase [Escherichia coli M718]
 gi|331046631|gb|EGI18718.1| phosphoribosylamine--glycine ligase [Escherichia coli M718]
          Length = 429

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|242241104|ref|YP_002989285.1| phosphoribosylamine--glycine ligase [Dickeya dadantii Ech703]
 gi|242133161|gb|ACS87463.1| phosphoribosylamine/glycine ligase [Dickeya dadantii Ech703]
          Length = 428

 Score =  346 bits (887), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + + I   +  A+++F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENIHIPATDIPALLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LQNDIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A         F   
Sbjct: 121 EYQNFTEIEPALAYIRRKGAPIVIKADGLAAGKGVIVAMTLEEAENAATDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDNDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+++II PT+ GM  E N + G L+AGLMI+ E  P +IE+N RFGDPE Q +M
Sbjct: 241 DDIHQRVMEQIIWPTVRGMASEGNIYTGFLYAGLMISAEGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL SD++E+  +   G L     +W    +L +V+A  GYP EY  G +IS +P Q+  
Sbjct: 301 LRLRSDLVELCLAACDGKLDEKTSDWDERPSLGIVLAAGGYPAEYRTGDVISGLPTQDMA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +++  NGGRVL  TALG ++ ++++ AY +   I W+  + R DIG 
Sbjct: 361 DGKVFHAGTRLNGDDVVTNGGRVLCVTALGNSVAQAQQRAYELANPIKWQGSFCRTDIGY 420

Query: 412 QKKERN 417
           +  +R 
Sbjct: 421 RAIDRE 426


>gi|74314499|ref|YP_312918.1| phosphoribosylamine--glycine ligase [Shigella sonnei Ss046]
 gi|73857976|gb|AAZ90683.1| phosphoribosylglycinamide synthetase [Shigella sonnei Ss046]
 gi|323167476|gb|EFZ53184.1| phosphoribosylamine--glycine ligase [Shigella sonnei 53G]
          Length = 429

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|119475085|ref|ZP_01615438.1| Phosphoribosylamine-glycine ligase [marine gamma proteobacterium
           HTCC2143]
 gi|119451288|gb|EAW32521.1| Phosphoribosylamine-glycine ligase [marine gamma proteobacterium
           HTCC2143]
          Length = 430

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 190/426 (44%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQS  +  ++  PGN G A  ++C  VAID  +  A+  F 
Sbjct: 1   MNILIIGSGGREHALAWKSAQSDHVDTVFVAPGNAGTATESKCANVAIDTMDFLALATFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ ++ L +VGPE PLV G+ D     G + FGP++ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  KDNNVGLTIVGPEAPLVEGVVDYFAEQGLRCFGPNKGAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y+ F++   A  Y++++  PIV+KADGL AGKGV+VA T  EA  A+        F + 
Sbjct: 121 AYETFTEIEPALLYIKSRGAPIVIKADGLAAGKGVIVALTETEAADAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IE++LEG E SF  + DGK  +P  T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEDFLEGEEASFIVMVDGKNILPMATSQDHKRAGDGDEGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             +Y  ++ ++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 PAIYQRIMDEVIKPTVAGMAAEGNDYTGFLYAGLMINPAGEPRVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL  D++ + NS + G L +T + W    ++ VV+A  GYP +Y  G +IS + + +T 
Sbjct: 301 MRLRGDLITMCNSALDGTLDDTVVEWDPRPSIGVVLAAGGYPGDYAKGNLISGLDKCDTS 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + N  +  +GGRVL ATALG ++TE+++ AY  V  + W + Y+R+DIG 
Sbjct: 361 EAKVFHAGTKLENGQVVTSGGRVLCATALGNSVTEAQQKAYQQVNTLSWDNMYFRKDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|307255069|ref|ZP_07536887.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259506|ref|ZP_07541231.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306861942|gb|EFM93918.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866442|gb|EFM98305.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 428

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A     + +AI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEESIENLAIVATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|292493441|ref|YP_003528880.1| phosphoribosylamine/glycine ligase [Nitrosococcus halophilus Nc4]
 gi|291582036|gb|ADE16493.1| phosphoribosylamine/glycine ligase [Nitrosococcus halophilus Nc4]
          Length = 442

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 197/427 (46%), Positives = 265/427 (62%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A     + VAI   N  A++ F 
Sbjct: 6   MKVLVIGGGGREHALAWKLAQSPKVDRVYVAPGNAGTALEPKLENVAIKPDNIPALVAFA 65

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + I L VVGPE PLV GI DA   AG    GP + AA+LE +KSFAK F  + GIPTA
Sbjct: 66  SAEQIGLTVVGPEAPLVLGIVDAFEEAGLGCLGPHREAARLEGAKSFAKDFLMRCGIPTA 125

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y+ FS+   A  Y++ +  PIVVKADGL AGKGVVVA T  EA  A+        F + 
Sbjct: 126 RYRTFSEVESAVAYIKMQGAPIVVKADGLAAGKGVVVAQTEQEAIDAVHGMLAGGAFGEA 185

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G EVSF  L DG+  +P  +++DHK    GD GPNTGGMGA SPA  ++
Sbjct: 186 GRRVVVEEFLRGEEVSFIVLTDGEHILPLASSQDHKARDRGDTGPNTGGMGAYSPAPVVT 245

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           + ++  V+Q++I+PT+ GM +E  P++G L+AGLMI E   P ++EYN RFGDPE Q +M
Sbjct: 246 EAVHKRVMQEVIVPTVRGMAEEGYPYRGFLYAGLMIAEDGSPRVLEYNCRFGDPEAQPIM 305

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MRL SD++ +  + + G LH   + W +  AL VV+A KGYP  YP G  I  +P     
Sbjct: 306 MRLRSDLVALCQAALEGRLHEVDVTWDSRAALGVVMAAKGYPGSYPVGDPIYGLPAPERE 365

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            +++FH GTA     +   GGRVL    LG ++T+++  AY +V+ I WK  Y+R DIG 
Sbjct: 366 DSKVFHGGTAEKEGRIVTAGGRVLCVCGLGDSVTQAQATAYALVQQITWKEAYYRTDIGY 425

Query: 412 QKKERNV 418
           +   R  
Sbjct: 426 RAVAREA 432


>gi|39934237|ref|NP_946513.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           CGA009]
 gi|192289763|ref|YP_001990368.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           TIE-1]
 gi|39648085|emb|CAE26605.1| Phosphoribosylglycinamide synthetase (GARS) [Rhodopseudomonas
           palustris CGA009]
 gi|192283512|gb|ACE99892.1| phosphoribosylamine/glycine ligase [Rhodopseudomonas palustris
           TIE-1]
          Length = 427

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 229/427 (53%), Positives = 293/427 (68%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A CVA+DI NH A++ FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAASPLVTKLWCAPGNAGIAREATCVALDIGNHQAVVEFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L AAG K FGPS++A++LESSK F K  C  + IPTA Y
Sbjct: 61  NAVDLVVVGPEAPLAAGIVDDLAAAGIKAFGPSRKASQLESSKGFTKDLCKAHDIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + F DP +AK Y++ +  PIV+KADGL AGKGVVVA TV EA +A+D  F          
Sbjct: 121 ERFGDPNQAKTYIRAQGAPIVIKADGLAAGKGVVVAMTVAEAEAAVDMMFGGGLGSAGVE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E++L G E SFF LCDG+ A+P  TA+DHKR +DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEDFLVGEEASFFVLCDGEHALPLATAQDHKRAYDGDKGPNTGGMGAYSPAPVMTDAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +Q+II PT++ M+    PF+GVLFAGLMIT++GP LIEYNVRFGDPECQ +MMR+ 
Sbjct: 241 CQQAMQRIIYPTLKAMKAMGAPFKGVLFAGLMITDEGPQLIEYNVRFGDPECQVLMMRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SDI+  L +C  G L +  + W  E ALTVV+A KGYP  Y  GT I+ + +       Q
Sbjct: 301 SDIVPALLACADGQLDHFSLRWHDEPALTVVMAAKGYPGTYEKGTRIAGLERADAIAGVQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA  KT+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTIASGDWILANGGRVLAVTASAKTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 420

Query: 415 ERNVKYR 421
            R  + +
Sbjct: 421 ARERRGK 427


>gi|307320093|ref|ZP_07599514.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti AK83]
 gi|306894308|gb|EFN25073.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti AK83]
          Length = 423

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 227/421 (53%), Positives = 292/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L++L++ PGNPGIA+ A  V +  +NH  ++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VVVGPE PLV G+ D L AA    FGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDFVVVGPEAPLVAGLGDVLRAADIPTFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   AK Y++ +  PIV+KADGL AGKGV VA ++DEA +A+D CF          
Sbjct: 121 RRFTDAEPAKAYIREEGAPIVIKADGLAAGKGVTVAMSLDEAFAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK+ +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKSVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 VERTMKEIIEPTVRGMAESGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L +   G L      W+ E ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLYAAATGTLEGMKAEWRDEAALTVVMASRGYPGAYEKDTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+    L A GGRVL+ TA GKT+ E+++ AY  V ++ W++G++R DIG Q   R
Sbjct: 361 HAGTAMKGGGLVAAGGRVLNVTATGKTVGEAKDAAYAAVRDVSWENGFYRNDIGWQAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|303250078|ref|ZP_07336280.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307252813|ref|ZP_07534703.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302651141|gb|EFL81295.1| phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306859712|gb|EFM91735.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 428

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A     + VAI   +  A+  F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENVAIAATDVPALAAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+  +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLVAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++    + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQVLKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|261210435|ref|ZP_05924729.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC341]
 gi|260840493|gb|EEX67059.1| phosphoribosylamine--glycine ligase [Vibrio sp. RC341]
          Length = 429

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 199/429 (46%), Positives = 276/429 (64%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V+I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVSIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDAFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|152979938|ref|YP_001352233.1| phosphoribosylamine--glycine ligase [Janthinobacterium sp.
           Marseille]
 gi|151280015|gb|ABR88425.1| phosphoribosylamine--glycine ligase [Janthinobacterium sp.
           Marseille]
          Length = 423

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 188/423 (44%), Positives = 266/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQS  +  ++  PGN G A   +   I I +   +  F  +
Sbjct: 1   MKILVVGSGGREHALAWKLAQSERIQTVYVAPGNGGTALDDRLKNIAITDPQELAQFAVQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +HI L VVGPE PL  GI +     G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EHIALTVVGPETPLAAGIVNIFRNQGLKIFGPTREAAQLESSKDFAKSFMQRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q FS+   A  Y+  K  PIV+KADGL AGKGVVVA ++DEA  A+D            +
Sbjct: 121 QTFSEVNAAHDYINQKGAPIVIKADGLAAGKGVVVAMSLDEAHQAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  T++DHKR+ D D GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKNILPLATSQDHKRLQDNDEGPNTGGMGAYSPAPIVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++II PT++GM K+  PF G L+AGLMI ++  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIIQPTVQGMAKDGIPFSGFLYAGLMIDDKGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L++D++ ++   V+G L    + W    AL VV+A  GYP+    G +IS IP     + 
Sbjct: 301 LKTDLVGVMEHAVNGTLDTIELEWDRRTALGVVMAAAGYPDAPRKGDVISGIPAENADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGTA+ ++ LT  GGRVL    LG ++  +++ AY +++ I +    +R DIG +  
Sbjct: 361 TFHAGTALNDDQLTTTGGRVLCVVGLGDSVKVAQKQAYQVLDQIHFDGAQFRRDIGWRAL 420

Query: 415 ERN 417
           +R+
Sbjct: 421 KRS 423


>gi|189425815|ref|YP_001952992.1| phosphoribosylamine--glycine ligase [Geobacter lovleyi SZ]
 gi|189422074|gb|ACD96472.1| phosphoribosylamine/glycine ligase [Geobacter lovleyi SZ]
          Length = 424

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 186/423 (43%), Positives = 267/423 (63%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHAL WKIAQSPL+++++  PGNPG A  A  + I ++    ++ F + 
Sbjct: 1   MKILVIGGGGREHALVWKIAQSPLVTQIYCAPGNPGTASLATNLPIKVEEIDKLLGFAKS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL  GI D     G ++FGPS+ AA++E+SK+F+K    KY IPTA Y
Sbjct: 61  EGIDLAVVGPELPLSLGIVDLFREYGVRIFGPSRAAARIEASKAFSKDLMHKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F++   A+ +++    PIVVKADGL AGKGV++A T  EA  A+        F    S
Sbjct: 121 GVFTEIPAAEAFIRKTGAPIVVKADGLAAGKGVIIAQTEAEAIEAVQDMLSGNAFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE+L G E SF A+ DG+  IP  +A+DHK I DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 RVVVEEFLTGEEASFLAITDGRFVIPLASAQDHKAIFDGDQGPNTGGMGAYSPAPVVTAE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   +++++   ++GM  E   +QG+++AGLM+ +     +E+N RFGDPECQ ++MR+
Sbjct: 241 VHQKAMEQVVQRAVDGMAAEGCAYQGIVYAGLMVKDGEVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TT 353
           +SD++ +L +   G+L    I W  + A+ VV+A +GYP +YP G  I+ I         
Sbjct: 301 KSDLVPLLLAVAEGDLSGHSIEWHDQAAICVVMAAEGYPGDYPKGDSITGIEAAEQLTDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA  +  +   GGRVL  TALG T+  + E AY  VE I W+   +R DIG + 
Sbjct: 361 TVFHAGTAEKDGRIVTAGGRVLGVTALGNTVAAAIERAYQGVEKISWRGVQFRRDIGKKA 420

Query: 414 KER 416
             R
Sbjct: 421 LGR 423


>gi|188532336|ref|YP_001906133.1| Phosphoribosylamine-glycine ligase [Erwinia tasmaniensis Et1/99]
 gi|188027378|emb|CAO95225.1| Phosphoribosylamine-glycine ligase [Erwinia tasmaniensis Et1/99]
          Length = 426

 Score =  346 bits (886), Expect = 5e-93,   Method: Composition-based stats.
 Identities = 193/425 (45%), Positives = 272/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A     Q VAI   +   +++F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALQNVAIAPTDIQGLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + IDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LNEKIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+ K  PIV+KADGL AGKGV+VA T  EA  AI+       F   
Sbjct: 121 EYQNFTEVEPALAYVREKGAPIVIKADGLAAGKGVIVAMTQQEAEDAIEDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI ++  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVRGMADEGNVYTGFLYAGLMIDKRGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V G L      W    AL VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAAVDGKLDQKDSVWDPRPALGVVLAAGGYPGDYVNGEQIHGLPVEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+  + +  NGGRVL  TALG+ +  +++ AY + + I W   + R DIG 
Sbjct: 361 DGKVFHAGTALEGDRVVTNGGRVLCVTALGENVAAAQQRAYQLTKPISWNGSFCRSDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|307309357|ref|ZP_07589020.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti BL225C]
 gi|306900226|gb|EFN30844.1| phosphoribosylamine/glycine ligase [Sinorhizobium meliloti BL225C]
          Length = 423

 Score =  346 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 226/421 (53%), Positives = 293/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSP L++L++ PGNPGIA+ A  V +  +NH  ++ FC+ 
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPRLTKLYAAPGNPGIAEEAAIVDLHTENHEDVVDFCRT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID VVVGPE PLV G+ D L AA    FGPS  AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  HAIDFVVVGPEAPLVAGLGDVLRAADIPTFGPSAAAAQLEGSKGFTKDLCARYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   AK Y++ +  PIV+KADGL AGKGV VA ++DEA +A+D CF          
Sbjct: 121 RRFTDAEPAKAYIREEGAPIVIKADGLAAGKGVTVAMSLDEAFAAVDECFAGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YL+G E SFF LCDGK+ +P  +A+DHKR+ DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEAYLDGEEASFFCLCDGKSVLPLASAQDHKRVGDGDTGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT+ GM +   PF GV FAGLMITE+GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 VERTMKEIIEPTVRGMAESGYPFTGVFFAGLMITEKGPELIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L +L++   G L      W+ E ALTVV+A++GYP  Y   T I+ +P  +  T++F
Sbjct: 301 SDLLPLLHAAATGTLEGMKAEWRDEAALTVVMASRGYPGAYEKDTPIAALPDASAATKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+    L A GGRVL+ TA GKT+ E+++ AY  V ++ W++G++R DIG +   R
Sbjct: 361 HAGTAMKGGGLVAAGGRVLNVTATGKTVCEAKDAAYAAVRDVSWENGFYRNDIGWRAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|152978819|ref|YP_001344448.1| phosphoribosylamine--glycine ligase [Actinobacillus succinogenes
           130Z]
 gi|150840542|gb|ABR74513.1| phosphoribosylamine--glycine ligase [Actinobacillus succinogenes
           130Z]
          Length = 429

 Score =  346 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 199/426 (46%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A  A  + V I + + +A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNAGTASEANIENVNIGVTDVTALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE +I L +VGPE PLV G+ DA  AAG  +FGP Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QENNIGLTIVGPEAPLVVGVVDAFEAAGLTIFGPRQSAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D  +A  YV+ K  PIV+KADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 EYQNFTDVEQALAYVREKGAPIVIKADGLAAGKGVIVAMTLNEAEDAIKDMLSGNVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGEHVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE++  V+ +II PT+ GM  E N ++G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 QEIHDRVMAQIIYPTVRGMAAENNVYKGFLYAGLMIDKNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+      G L      W  E AL +V+A +GYP +Y  G  I  IP Q   
Sbjct: 301 MRLKSDLVELCLKACQGELDQIKSEWAQEAALGIVLAAEGYPGDYRKGDEIYGIPTQPAQ 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A  +     NGGRVL  TALG ++ E+++ A  + E ++W   ++R DIG 
Sbjct: 361 DEKIFLAGVAEKDGKPVTNGGRVLCVTALGNSVFEAQQKALKLAEQVNWTGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|24115289|ref|NP_709799.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2a str. 301]
 gi|30064713|ref|NP_838884.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2a str.
           2457T]
 gi|24054584|gb|AAN45506.1| phosphoribosylglycinamide synthetase, GAR synthetase [Shigella
           flexneri 2a str. 301]
 gi|30042973|gb|AAP18695.1| phosphoribosylglycinamide synthetase, GAR synthetase [Shigella
           flexneri 2a str. 2457T]
 gi|281603389|gb|ADA76373.1| Phosphoribosylglycinamide synthetase, GAR synthetase [Shigella
           flexneri 2002017]
 gi|313648656|gb|EFS13096.1| phosphoribosylamine--glycine ligase [Shigella flexneri 2a str.
           2457T]
          Length = 429

 Score =  346 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  +++ PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFAAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALVYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDNGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L+VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLSVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|320200154|gb|EFW74743.1| Phosphoribosylamine--glycine ligase [Escherichia coli EC4100B]
          Length = 429

 Score =  346 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETIFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|59713002|ref|YP_205778.1| phosphoribosylamine--glycine ligase [Vibrio fischeri ES114]
 gi|59481103|gb|AAW86890.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Vibrio fischeri ES114]
          Length = 430

 Score =  346 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 194/430 (45%), Positives = 279/430 (64%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A     + VAID+++ +A++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFIAPGNAGTALEPKLENVAIDVEDIAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   A   +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREADLPIFGPTKAAAQLEGSKAFTKDFLARHDIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
           +Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 SYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGASVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI TE  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDTEGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS   + T  
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRASIGVVLAAGGYPADYAKGDVISLPSEETEG 360

Query: 353 TQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGT   +  ++  NGGRVL ATALG T++E++E AY + + + W   + R DIG 
Sbjct: 361 QKIFHAGTTNNDAGDVVTNGGRVLCATALGNTVSEAQERAYELAKQVSWNGMFHRNDIGY 420

Query: 412 QKKERNVKYR 421
           +   R ++ +
Sbjct: 421 RAIARELETK 430


>gi|307246088|ref|ZP_07528170.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306853023|gb|EFM85246.1| Phosphoribosylamine--glycine ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 428

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+ QSPL+ +++  PGN G A     + +AI   +  A++ F 
Sbjct: 1   MNVLIIGNGGREHALAWKVRQSPLVKKVFVAPGNAGTALEEGIENLAIVATDVPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  I L +VGPE PLV G+ DA  A G K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KENQIGLTIVGPEAPLVIGVVDAFRANGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVIKADGLAAGKGVIVAMTLEEAEEAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDQGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ V+Q++I PT++GM  E NP+ G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHNRVMQEVIYPTVKGMAAEGNPYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRLESD++++  +     L      W  + AL +V+A +GYP +Y  G  IS IP Q   
Sbjct: 301 MRLESDLVQLCLAACDEKLDTIKSKWCEQAALGIVLAAEGYPGDYRKGDEISGIPTQAQK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           + ++F AG    +  L  NGGRVL ATALG ++ ++++ A  + E I W+  ++R DIG 
Sbjct: 361 SQKVFLAGVEQKDGKLVTNGGRVLCATALGNSVFDAQQQALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|92118639|ref|YP_578368.1| phosphoribosylamine--glycine ligase [Nitrobacter hamburgensis X14]
 gi|91801533|gb|ABE63908.1| phosphoribosylamine--glycine ligase [Nitrobacter hamburgensis X14]
          Length = 428

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 222/427 (51%), Positives = 287/427 (67%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA S LL++LW  PGN GIA+ A+CV++D+ +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIADSVLLTKLWCAPGNAGIAREAECVSLDVADHAAVIAFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D L  AG K FGPS+ AA+LESSK F K+ C    IPTA Y
Sbjct: 61  NKVDLVVVGPEAPLAAGIVDDLAVAGIKAFGPSKAAAQLESSKGFTKELCRDNAIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           + F+D   AK Y++ +  PIV+KADGL AGKGVVVA T+DEA +A+D      F    + 
Sbjct: 121 ERFNDAAAAKAYIRVQGAPIVIKADGLAAGKGVVVATTLDEALAAVDMMFDGGFGGAGAQ 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE++ G E SFFALCDG+ A+   TA+DHKR  DGD GPNTGGMGA SPA  M+ E+
Sbjct: 181 VVVEEFMRGEEASFFALCDGEDALALATAQDHKRAFDGDKGPNTGGMGAYSPAPVMTAEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II+PT+  M+    PF+GVLFAGL+ITEQGP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CRRTMDEIIIPTLRAMRARGAPFKGVLFAGLIITEQGPKLIEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DI+  L +     L +  + W    ALTVV+A KGYP +Y  GT I  +         +
Sbjct: 301 GDIVPALFAVCDEQLKHFDLRWFPASALTVVMAAKGYPGDYARGTRIDGLDNAAKVEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT      + ANGGRVL+  A GKT+ E++  AY  V+ I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTKEEGGQILANGGRVLNVCASGKTVAEAQARAYEAVDRINWPDGFCRRDIGFQAV 420

Query: 415 ERNVKYR 421
            R  + +
Sbjct: 421 ARERELK 427


>gi|16767429|ref|NP_463044.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167994977|ref|ZP_02576067.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|131617|sp|P26977|PUR2_SALTY RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|154288|gb|AAA27198.1| 5-phosphoribosylglycinamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|6960361|gb|AAF33521.1| Salmonella typhimurium phosphoribosylamine--glycine ligase
           (SW:P26977); contains similarity to Pfam domain PF01071
           (GARS), Score=962, E=1.5e-285, N=1 [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16422734|gb|AAL23003.1| phosphoribosylglycinamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|205327266|gb|EDZ14030.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|261249279|emb|CBG27141.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996476|gb|ACY91361.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|312915281|dbj|BAJ39255.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321223375|gb|EFX48442.1| Phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
          Length = 429

 Score =  345 bits (885), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|300938767|ref|ZP_07153481.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 21-1]
 gi|300456301|gb|EFK19794.1| phosphoribosylamine--glycine ligase [Escherichia coli MS 21-1]
          Length = 429

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGMKIFGPTAGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTQEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLAGNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|291279578|ref|YP_003496413.1| phosphoribosylamine--glycine ligase [Deferribacter desulfuricans
           SSM1]
 gi|290754280|dbj|BAI80657.1| phosphoribosylamine--glycine ligase [Deferribacter desulfuricans
           SSM1]
          Length = 427

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 190/425 (44%), Positives = 269/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL++GSGGREHAL+WKIAQS L  +++  PGN G A     + V I+  +  ++I F 
Sbjct: 1   MKVLVVGSGGREHALSWKIAQSNLAEKVFVAPGNAGTALEEKCENVDINANDFDSLISFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           + + IDL VVGPE PL  GI D     G K+FGP + AA +E+SK+FAK+     GIPTA
Sbjct: 61  KNEKIDLTVVGPEDPLAKGIVDEFEKNGLKIFGPKKDAAMIEASKAFAKEIMFSAGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQI 173
            Y+ FS+   AK+YV+ K  PIVVKADGL AGKGV VA T++EA S      ID+ F + 
Sbjct: 121 EYKEFSEFDAAKKYVEEKGAPIVVKADGLAAGKGVTVAKTIEEAISALKEIFIDKVFGKS 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+LEG E S+ A  DGK  +P  +++DHK ++D D GPNTGGMGA SPA  ++
Sbjct: 181 GEKVVIEEFLEGEEASYLAFTDGKHVLPLVSSQDHKPVYDNDEGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
            E++S   + I  P I  + K    ++G+++AGLMIT+ GP ++E+N RFGDPE Q ++ 
Sbjct: 241 DEIFSFTTENIAKPLINELNKRGIVYKGIIYAGLMITQDGPKVLEFNCRFGDPETQPVLY 300

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--G 351
           ++ SDI+ I+ S V GNL + ++ W  +  + VV+A+ GYP+ Y  G  I+ I       
Sbjct: 301 KMRSDIIPIILSAVDGNLSSVNVEWYDDATICVVLASGGYPKSYKKGYEITGIEDAEKLE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + NN +  NGGRVL  T   K +  + +  Y  VE I +K  ++R+DIG 
Sbjct: 361 NIKVFHAGTKLENNKVLTNGGRVLGVTCRAKDLKTAIDNVYKAVEKIHFKDMHFRKDIGA 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 KALRR 425


>gi|325499263|gb|EGC97122.1| phosphoribosylamine-glycine ligase [Escherichia fergusonii ECD227]
          Length = 433

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 305 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 364

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 365 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYGLMTDIHWDDCFCRKDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERE 431


>gi|110807855|ref|YP_691375.1| phosphoribosylamine--glycine ligase [Shigella flexneri 5 str. 8401]
 gi|110617403|gb|ABF06070.1| phosphoribosylamine--glycine ligase [Shigella flexneri 5 str. 8401]
          Length = 429

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALVYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVCDKDNGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L+VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLSVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|152996999|ref|YP_001341834.1| phosphoribosylamine--glycine ligase [Marinomonas sp. MWYL1]
 gi|150837923|gb|ABR71899.1| phosphoribosylamine--glycine ligase [Marinomonas sp. MWYL1]
          Length = 428

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 185/428 (43%), Positives = 269/428 (62%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPG--IAQHAQCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK A+S  + +++  PGN G       + V I + + + ++ F 
Sbjct: 1   MKVLIIGNGGREHALAWKTAESNQVEKVFVAPGNAGSATENKVENVNIGVTDIADLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++++IDL +VGPE PLV G+ DA    G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KKENIDLTIVGPEAPLVIGVVDAFEKEGLAIFGPTAAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  Y++    PIVVKADGL AGKGV++A T  EA  A++       F   
Sbjct: 121 AYGNFTEIEPAVAYIKQHGAPIVVKADGLAAGKGVILAQTEAEAIEAVEDMLQGNSFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L G E SF  + DG+T +P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLVGEEASFICMVDGETVLPMATSQDHKARDNGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I+PT++GM  E N ++G L+AG+MI  +  P  +EYN RFGDPE Q +M
Sbjct: 241 PEIHDRIMNEVIMPTVKGMNAEGNRYRGFLYAGVMIAPDGTPKTLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MRL SD+ ++  + V+G L     +W    +L VV+A  GYP +Y  G +IS +  N   
Sbjct: 301 MRLRSDLAQMCLAAVNGKLDTVEADWDPRASLGVVLAAGGYPADYAKGDVISGLDTNLPE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AGTA+ +  +  NGGRVL A ALG T+ E++  AY +V  + W   Y+R DIG 
Sbjct: 361 GQKVFQAGTALKDGQVVTNGGRVLCAVALGNTVAEAQAAAYDVVNTLSWDKVYFRTDIGH 420

Query: 412 QKKERNVK 419
           +   R  K
Sbjct: 421 RAIAREQK 428


>gi|240948277|ref|ZP_04752663.1| phosphoribosylamine--glycine ligase [Actinobacillus minor NM305]
 gi|240297316|gb|EER47857.1| phosphoribosylamine--glycine ligase [Actinobacillus minor NM305]
          Length = 430

 Score =  345 bits (885), Expect = 7e-93,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 271/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+ QS L S+++  PGN G A     + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVRQSLLASKVFVAPGNAGTALEEGIENVAISATDVPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  I+L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQNAIELTIVGPEAPLVVGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLRQKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVKDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEGDKGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+++II PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 ADIHQRVMEEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RLESD++E+      G L      W  + AL +V+A +GYP +Y  G  I+ +P +N  
Sbjct: 301 LRLESDLVELCLKACEGKLDEIQSKWCEQAALGIVLAAEGYPADYRKGDEITGLPTENRA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL ATALG T+ E+++ A  + E I W+  ++R DIG 
Sbjct: 361 DEKVFLAGVEQKEGKLVTNGGRVLCATALGATVFEAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVARE 426


>gi|204931273|ref|ZP_03222033.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204319888|gb|EDZ05095.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
          Length = 429

 Score =  345 bits (885), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACEGKLDGKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|319897624|ref|YP_004135821.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Haemophilus influenzae F3031]
 gi|317433130|emb|CBY81504.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Haemophilus influenzae F3031]
          Length = 429

 Score =  345 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 269/427 (62%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL ++++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLANKIFVAPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VG E PLV GI D    AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGSEAPLVIGIVDTFRKAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAENAVHDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P   ++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSQVVIEEFLDGEEASFIVMVDGKNVEPMANSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHDRIMREVIYPTVNGMVAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W  + +L +V+A +GYP++Y  G  IS +PQ    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVTSQWNPQASLGIVLAAEGYPKDYRKGDEISGLPQSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG       L  NGGRVL  TALG+++ ++++ A  + E I W   ++R+DIG 
Sbjct: 361 NEKVFLAGVTEQEGKLVTNGGRVLCVTALGESVFDAQQKALKLAEKIQWTGRFYRKDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|255654308|ref|ZP_05399717.1| phosphoribosylamine--glycine ligase [Clostridium difficile
           QCD-23m63]
 gi|296452598|ref|ZP_06894292.1| phosphoribosylamine-glycine ligase [Clostridium difficile NAP08]
 gi|296880990|ref|ZP_06904936.1| phosphoribosylamine-glycine ligase [Clostridium difficile NAP07]
 gi|296258559|gb|EFH05460.1| phosphoribosylamine-glycine ligase [Clostridium difficile NAP08]
 gi|296428011|gb|EFH13912.1| phosphoribosylamine-glycine ligase [Clostridium difficile NAP07]
          Length = 416

 Score =  345 bits (884), Expect = 8e-93,   Method: Composition-based stats.
 Identities = 165/415 (39%), Positives = 264/415 (63%), Gaps = 5/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHA+ WK+++   + +++  PGN GIA  A+CV I   N   ++ F +E
Sbjct: 1   MKILVVGGGGREHAICWKLSKEKNVEKIYCAPGNAGIANVAECVNIGDTNIEELLKFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I L +VGPE+PLV GI D     G +VFGP+++ A+LE SK+F+K+F  K+ IPTA Y
Sbjct: 61  NEIGLTIVGPEVPLVMGIVDEFEKEGLRVFGPNKKCAQLEGSKAFSKEFMIKHNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + +++  +A   + N   P+V+KADGL AGKGVV+    ++A + +              
Sbjct: 121 KEYTNLEEAISEIDNFGYPVVIKADGLAAGKGVVIPENREDAIATLKEMMSDKKFGAAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+L+G E S  A  D  T +P  +A+DHK++++ + GPNTGGMG  SP+   ++E
Sbjct: 181 KIVIEEFLKGIETSILAFVDNDTIVPMASAKDHKKVNNYEQGPNTGGMGTFSPSEIYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V + ++  T+EG +K+   F+G+LF GLMITE G  ++EYNVRFGDPE Q+++ RL
Sbjct: 241 LANRVKETVLEKTLEGFKKDGLDFKGILFVGLMITEDGEKVLEYNVRFGDPETQSVLFRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+ EI+ S +   L +  IN+  + A+ V++ + GYP+ Y  G II+ +        +
Sbjct: 301 ETDLHEIMESILDNKLKDIEINYSDDEAVCVMLTSGGYPDSYEKGKIITGLENLDDDIVV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FH+GT +++ NL  NGGRV+  TA   T+ ++ E  Y  ++ I+++  ++R DIG
Sbjct: 361 FHSGTKMLDGNLVTNGGRVIGITAKSATVKDAAEKVYENIKKINFEGMHYRTDIG 415


>gi|256026321|ref|ZP_05440186.1| phosphoribosylamine--glycine ligase [Escherichia sp. 4_1_40B]
          Length = 429

 Score =  345 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK  QSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAVQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|300714864|ref|YP_003739667.1| Phosphoribosylamine-glycine ligase [Erwinia billingiae Eb661]
 gi|299060700|emb|CAX57807.1| Phosphoribosylamine-glycine ligase [Erwinia billingiae Eb661]
          Length = 426

 Score =  345 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK +QSPL   ++  PGN G A     Q V I   +  A++ F 
Sbjct: 1   MKILVIGNGGREHALAWKASQSPLAETVFVAPGNAGTALEPALQNVDISATDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q ++I L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSENIGLTIVGPETPLVMGVVDAFRAAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y ++K  PIV+KADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYQNFTEVEPALAYTRSKGAPIVIKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ + D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGNADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVRGMAAEGNVYTGFLYAGLMIDQSGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V G L+     W    +L VV+A  GYP +Y  G  I  +P + T 
Sbjct: 301 LRLQSDLVDLCLAAVDGKLNTKDSVWDPRPSLGVVLAAGGYPGDYATGDQIHGLPLEETP 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  NGGRVL  TALG+ +  +++ AY + ++I W   + R DIG 
Sbjct: 361 NGKVFHAGTKMQDDLVVTNGGRVLCVTALGEDVAAAQKHAYELAKHISWNGSFCRSDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIGRK 426


>gi|168245131|ref|ZP_02670063.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194450383|ref|YP_002048160.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194408687|gb|ACF68906.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|205336121|gb|EDZ22885.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
          Length = 429

 Score =  345 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 279/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDEFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACEGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|168467893|ref|ZP_02701730.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197264018|ref|ZP_03164092.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|238913753|ref|ZP_04657590.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|195629008|gb|EDX48400.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197242273|gb|EDY24893.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
          Length = 429

 Score =  345 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|319405359|emb|CBI78976.1| Phosphoribosylamine-glycine ligase [Bartonella sp. AR 15-3]
          Length = 424

 Score =  345 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 224/423 (52%), Positives = 290/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +    + +DI +H ++I FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCAPGNPATMEFGTNINLDIDDHYSVIDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PL+ GI+DALNAA   VFGP+Q+AA+LE SK F K  C +  IPTA Y
Sbjct: 61  NAIDLVVVGPEAPLIAGITDALNAAHICVFGPNQKAAQLEGSKGFTKDLCYRNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F + +KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID C    F      
Sbjct: 121 QRFDNALKAKSYIHRQGIPIVIKADGLAAGKGVVVARTMEEAFDAIDACFEGTFGDAGKK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E YLEG E SFF LCDGK AIPF +A+DHKR+ DGD G NTGGMGA SPA  M++++
Sbjct: 181 VVVEAYLEGEETSFFCLCDGKVAIPFGSAQDHKRVGDGDTGVNTGGMGAYSPAPIMTEKM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +Q+I+ P + G+ +    F+G+LF GLMIT+ GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLQEIVTPALRGLAEMDISFRGILFVGLMITQTGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL +  +   GNL   ++ W  E ALTVV+A  GYP     G++I  I +       +
Sbjct: 301 DDILPLFLTAAQGNLKKKNLRWSEETALTVVMAANGYPFSPQKGSVIRNIDKADSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA+GKTI  +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 IFQAGTALCNGELIANSGRVLNITAIGKTIKLAQKRAYEAVDYIDWPQGFVRRDIGWRAI 420

Query: 415 ERN 417
            R 
Sbjct: 421 MRE 423


>gi|254491219|ref|ZP_05104400.1| phosphoribosylamine--glycine ligase [Methylophaga thiooxidans
           DMS010]
 gi|224463732|gb|EEF80000.1| phosphoribosylamine--glycine ligase [Methylophaga thiooxydans
           DMS010]
          Length = 431

 Score =  345 bits (884), Expect = 9e-93,   Method: Composition-based stats.
 Identities = 192/431 (44%), Positives = 272/431 (63%), Gaps = 9/431 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSP  + ++  PGNPG         V I +++   ++ F 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPKSTAVFVAPGNPGTENETGISNVNIQVEDIEGLVSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  I L VVGPE+PLV G+ DA  AAG + FGPSQ AA+LE+SKSF K F  ++ IPTA
Sbjct: 61  KDNDIALTVVGPEVPLVMGVVDAFEAAGLRCFGPSQAAAELEASKSFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F++   A  Y++ +  PIVVKADGL AGKGV+VA T  +A +A++       F + 
Sbjct: 121 DYQVFTEVAPATAYIKQQGAPIVVKADGLAAGKGVIVAETEQQAIAAVEDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE++ G E SF  + DG+  +P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFMVGEEASFIVMVDGENILPLATSQDHKARDNGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             +Y  ++Q++I PT++GM  +  P+ G L+AG+MI +   P ++EYN RFGDPE Q ++
Sbjct: 241 DSVYQRIMQQVIEPTVKGMAADGRPYTGFLYAGVMIDDTGAPKVVEYNCRFGDPETQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MRL+SD++E+  + +   L+    NW +  A+ VV+A  GYPE Y  G +IS I      
Sbjct: 301 MRLQSDLVELCEAALDKRLNEVDANWDSRAAIGVVMAAGGYPESYRKGDVISGIENAESN 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA  + N+   GGRVL  TALG T+ E++  AY  +  I W   Y+R DI  
Sbjct: 361 GNKVFHAGTASQDGNVVTAGGRVLCVTALGHTVAEAQASAYQSLAKISWNDAYFRTDIAY 420

Query: 412 QKKERNVKYRN 422
           +   R    +N
Sbjct: 421 RAVAREQAVKN 431


>gi|200388238|ref|ZP_03214850.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|199605336|gb|EDZ03881.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
          Length = 429

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 194/429 (45%), Positives = 280/429 (65%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVGTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 WRAIEREQR 429


>gi|316932706|ref|YP_004107688.1| phosphoribosylamine/glycine ligase [Rhodopseudomonas palustris
           DX-1]
 gi|315600420|gb|ADU42955.1| phosphoribosylamine/glycine ligase [Rhodopseudomonas palustris
           DX-1]
          Length = 427

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 230/427 (53%), Positives = 292/427 (68%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A CVA+DI +HSA+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAASPLVTKLWCAPGNAGIAREATCVALDIADHSAVIAFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D VVVGPE PL  GI D L AAG K FGPS++A++LESSK F K  C  + IPTA Y
Sbjct: 61  NQVDFVVVGPEAPLAAGIVDDLAAAGIKTFGPSRKASQLESSKGFTKDLCKAHDIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + FSDP +AK Y++ +  PIVVKADGL AGKGVVVA T+ EA +AID  F          
Sbjct: 121 ERFSDPNEAKAYIRVQGAPIVVKADGLAAGKGVVVATTLAEAEAAIDMMFGGGLGDAGVE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E++L G E SFF LCDG  A+P  +A+DHKR +DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEDFLVGEEASFFVLCDGDHALPLASAQDHKRAYDGDKGPNTGGMGAYSPAPVMTDAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +Q+II PT++ M+    PF+GVLFAGLMITE GP LIEYNVRFGDPECQ +MMR+ 
Sbjct: 241 CQQTMQRIIYPTLKAMKAMGAPFKGVLFAGLMITEDGPQLIEYNVRFGDPECQVLMMRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SDI+  L +C  G L +  + W  + ALTVV+A KGYP  Y  GT I+ + +       Q
Sbjct: 301 SDIVPSLLACADGQLDHVSLRWHDDPALTVVMAAKGYPGHYEKGTRIAGLERADAIPGVQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA  KT+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTVASGDWVLANGGRVLAVTASAKTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 420

Query: 415 ERNVKYR 421
            R  + +
Sbjct: 421 ARERRRK 427


>gi|329122901|ref|ZP_08251472.1| phosphoribosylamine-glycine ligase [Haemophilus aegyptius ATCC
           11116]
 gi|327471832|gb|EGF17272.1| phosphoribosylamine-glycine ligase [Haemophilus aegyptius ATCC
           11116]
          Length = 429

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 269/427 (62%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKAAQSPLADKVFVAPGNVGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVTGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDPRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++    + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKVLKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|157147201|ref|YP_001454520.1| phosphoribosylamine--glycine ligase [Citrobacter koseri ATCC
           BAA-895]
 gi|157084406|gb|ABV14084.1| hypothetical protein CKO_02984 [Citrobacter koseri ATCC BAA-895]
          Length = 429

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPQVETVYVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLIEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACDGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W + + R+DIG
Sbjct: 361 DGKVFHAGTKLAEDDRVVTSGGRVLCATALGHTVAEAQQRAYALMADIRWDNCFSRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|254286253|ref|ZP_04961212.1| phosphoribosylamine--glycine ligase [Vibrio cholerae AM-19226]
 gi|150423668|gb|EDN15610.1| phosphoribosylamine--glycine ligase [Vibrio cholerae AM-19226]
          Length = 429

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 198/429 (46%), Positives = 274/429 (63%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ+P +  ++  PGN G A   +   V I I +  A++ F 
Sbjct: 1   MQVLIIGSGGREHALAWKVAQNPQVDTIYVAPGNAGTALEHKVQNVNIGITDIPALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I+L +VGPE PLV G+ D   AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKAIELTIVGPEAPLVIGVVDTFRAAGLPIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 AYANFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLAGNAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E N + G L+AGLMI     P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNTYTGFLYAGLMIDSTGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ VV+A  GYP +Y  G +IS +P Q + 
Sbjct: 301 MRLQSDLVELCQAAIAGKLDQVESKWDPRASIGVVLAAGGYPGDYAKGEVISGLPTQESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  NGGRVL ATALG T+ E+++ AY + + I W   + R DIG 
Sbjct: 361 GQKVFHAGTETQGDQVVTNGGRVLCATALGNTVLEAQQRAYQLADQIRWNGMFCRRDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|167631118|ref|YP_001681617.1| phosphoribosylamine--glycine ligase [Heliobacterium modesticaldum
           Ice1]
 gi|167593858|gb|ABZ85606.1| phosphoribosylamine--glycine ligase [Heliobacterium modesticaldum
           Ice1]
          Length = 439

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 196/428 (45%), Positives = 268/428 (62%), Gaps = 13/428 (3%)

Query: 2   RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEK 61
           +VL++G GGREHAL WK+ QSP ++E++  PGN GIA+ A CV I   + + I+ F  EK
Sbjct: 10  KVLVVGGGGREHALVWKLKQSPRVAEVYCAPGNAGIARIAHCVDIKADDVTGILTFAWEK 69

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            IDL VVGPE PL  GI D  N     +FGP+++AA++E SK+FAK    KY IPTA Y 
Sbjct: 70  RIDLTVVGPEAPLSAGIVDVFNDHEMPIFGPTKKAAEIEGSKAFAKDLMRKYDIPTAAYG 129

Query: 122 HFSDPMKAKQYVQNKS--------MPIVVKADGLCAGKGVVVAATVDEATSAIDRC---- 169
            F++   A Q++   +         P VVKADGL AGKGV+VAA V EA  A+       
Sbjct: 130 VFTEIEPAFQFIDKLAAARPVEAGCPCVVKADGLAAGKGVIVAADVAEAKEAVRSMLKGN 189

Query: 170 -FQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSP 228
            F      V+IEE+LEG EVS  A  DG   +P  +A+DHKRI DGD GPNTGGMGA SP
Sbjct: 190 AFGDAGRRVVIEEFLEGEEVSILAFTDGDHVLPMVSAQDHKRIFDGDQGPNTGGMGAYSP 249

Query: 229 ALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPEC 288
           A   ++ L   V + ++LPTI+ M+ E  P++GVL+AGLM+T QGP ++EYN RFGDPE 
Sbjct: 250 APVYTEALAREVEKTVLLPTIQAMKAEGRPYRGVLYAGLMVTAQGPKVLEYNARFGDPET 309

Query: 289 QAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ 348
           Q ++MR+++D+++++ + +   L    I W ++  + VV+A  GYP +Y  G  IS +  
Sbjct: 310 QPVLMRMQTDLVDVIEAILENRLEEQPIEWSSDATVCVVMAAGGYPGDYEKGKAISGLDD 369

Query: 349 NTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
                ++FHAGTA   + +   GGRVL+ TA G TI E+ +LAY  VE I +    +R D
Sbjct: 370 ALPGVEVFHAGTAAKEDQIVTAGGRVLAVTAKGPTIGEAIDLAYRQVERIHFDGLQFRRD 429

Query: 409 IGLQKKER 416
           IG +  ER
Sbjct: 430 IGRRALER 437


>gi|293417507|ref|ZP_06660130.1| phosphoribosylamine-glycine ligase [Escherichia coli B185]
 gi|291430834|gb|EFF03831.1| phosphoribosylamine-glycine ligase [Escherichia coli B185]
          Length = 429

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+++A +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEKAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + +N  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADNEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|260774393|ref|ZP_05883307.1| phosphoribosylamine--glycine ligase [Vibrio metschnikovii CIP
           69.14]
 gi|260610520|gb|EEX35725.1| phosphoribosylamine--glycine ligase [Vibrio metschnikovii CIP
           69.14]
          Length = 429

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 193/429 (44%), Positives = 281/429 (65%), Gaps = 9/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHAL WK+AQ+P +  ++  PGN G A     + V I +++ + ++ F 
Sbjct: 1   MQVLVIGSGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVNIAVEDIAGLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE+PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQKQIALTIVGPEIPLVLGVVDAFRDAGLPIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T+ EA  AI        F + 
Sbjct: 121 AYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDMLADNSFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+ GM  E NP+ G L+AGLMI  Q  P +IEYN RFGDPE Q +M
Sbjct: 241 QDVHDRVMREVIYPTVRGMAAEGNPYTGFLYAGLMIDAQGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++E+  + + G L      W    ++ +V+A  GYP +Y  G +IS +P +   
Sbjct: 301 MRLQSDLVELCLAALDGKLDQVESKWDPRASIGIVLAAGGYPADYRKGDVISGLPTEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT+  +  +  NGGRVL ATALG+++ ++++ AY + + I+W+  ++R DIG 
Sbjct: 361 GEKVFHAGTSDQSGAVVTNGGRVLCATALGESVFQAQQRAYQLAKQIEWQGMFYRHDIGY 420

Query: 412 QKKERNVKY 420
           +   R    
Sbjct: 421 RAIAREQAK 429


>gi|238752804|ref|ZP_04614272.1| Phosphoribosylamine--glycine ligase [Yersinia rohdei ATCC 43380]
 gi|238709002|gb|EEQ01252.1| Phosphoribosylamine--glycine ligase [Yersinia rohdei ATCC 43380]
          Length = 428

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 274/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I + + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPRLENVDIGVMDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEIEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM  E N + G L+AGLMI T+    +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQIIWPTVRGMAAEGNVYTGFLYAGLMISTDGQLKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL SD++E+  +   G L     +W    AL VV A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRLRSDLVELCLAGTQGKLDEKTSDWDERPALGVVFAAGGYPADYRQGDVIYGLPQQEAA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG+++ ++++ AY + ENI W+  ++R+DIG
Sbjct: 361 DGKVFHAGTRLDSNNNVVTSGGRVLCVTALGESVAQAQQRAYELAENIQWEGAFYRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|17546910|ref|NP_520312.1| phosphoribosylamine--glycine ligase [Ralstonia solanacearum
           GMI1000]
 gi|20139461|sp|Q8XXC4|PUR2_RALSO RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|17429210|emb|CAD15898.1| probable phosphoribosylamine--glycine ligase (gars)
           (glycinamideribonucleotide synthetase)
           (phosphoribosylglycinamide synthetase) protein
           [Ralstonia solanacearum GMI1000]
          Length = 422

 Score =  345 bits (884), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 184/422 (43%), Positives = 262/422 (62%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V+++GSGGREHALAWK+A+SP +  ++  PGN G A   +   + I +   +  F + 
Sbjct: 1   MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNVPITDPEVLAAFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   VVGPE PL  GI D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVHFTVVGPEAPLAAGIVDLFRAKGLRIFGPTRAAAQLESSKDFAKAFMQRHGIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
           Q F +  +A  YV  +  PIV+KADGL AGKGVVVA T++E          D       +
Sbjct: 121 QTFGNAAEAHAYVDREGAPIVIKADGLAAGKGVVVAMTLEEAHGAIDMMLADNRLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  +CDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVVCDGKDVVAMATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPTI GM+K+  P+ G L+AGLMI  +  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVLREIILPTIRGMEKDGIPYTGFLYAGLMIDADGTPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           +++D+ ++L+  + G L    ++W    AL VV+A   YP+    G +I+ IP+ T  + 
Sbjct: 301 MKTDLFDVLDRAIDGKLDGMELDWDRRTALGVVMAAYNYPDTPRKGDVITGIPKETEDSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT +GGRVL    L  T+  ++  AY  VE I +    +R+DIG +  
Sbjct: 361 TFHAGTTLKDGALTTSGGRVLCVVGLADTVKAAQRAAYGAVEQIQFDGAQYRKDIGHRAI 420

Query: 415 ER 416
            R
Sbjct: 421 RR 422


>gi|315122631|ref|YP_004063120.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496033|gb|ADR52632.1| phosphoribosylamine--glycine ligase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 414

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 326/413 (78%), Positives = 376/413 (91%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSPLLSELWS  GNPGIAQHA+C+ +D+++H AII FCQ+
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPLLSELWSTSGNPGIAQHAKCIPLDVEDHLAIIQFCQK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLV++GPELPLVNGISDALN+AGFKVFGPS+RA++LESSK F KKFCTKY IPTA Y
Sbjct: 61  KKIDLVIIGPELPLVNGISDALNSAGFKVFGPSKRASQLESSKFFTKKFCTKYSIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           QHF+DP+ AK+YV+ + MPIV+KADG+ AGKGVVVA T+D A  AIDRCFQQINSTV+IE
Sbjct: 121 QHFADPIVAKKYVKTQKMPIVIKADGIFAGKGVVVATTLDAAIVAIDRCFQQINSTVVIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           EYLEGFEVSFFA+CDGK A+PFTTARDHKR+ DGDIGPNTGGMGACSPALG+S+ELYST+
Sbjct: 181 EYLEGFEVSFFAICDGKIAVPFTTARDHKRVGDGDIGPNTGGMGACSPALGLSKELYSTI 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDIL 300
           I+ II PT+EGM++E+ PFQGVLFAGLMIT+Q PYLIEYNVRFGDPECQAMMMRLESDIL
Sbjct: 241 IKTIIQPTVEGMKQEKIPFQGVLFAGLMITKQKPYLIEYNVRFGDPECQAMMMRLESDIL 300

Query: 301 EILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAGT 360
           EILNSC  GNLHNT I+WKAEYALTVVVAT GYPE YP GT+I KIP +T  T+LFHAGT
Sbjct: 301 EILNSCAQGNLHNTTIDWKAEYALTVVVATNGYPETYPKGTVIRKIPLDTDKTKLFHAGT 360

Query: 361 AIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +I++ +L ANGGRVL+ATALGKTI+ESRE AY+MVE+IDW+HG+WR+DIGLQK
Sbjct: 361 SIIDGSLVANGGRVLNATALGKTISESRERAYNMVEDIDWEHGFWRKDIGLQK 413


>gi|218551011|ref|YP_002384802.1| phosphoribosylamine--glycine ligase [Escherichia fergusonii ATCC
           35469]
 gi|218358552|emb|CAQ91200.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Escherichia fergusonii ATCC 35469]
          Length = 429

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 276/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHLRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P     
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVMAAGGYPGDYHTGDVIHGLPLAEVE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|323974205|gb|EGB69337.1| phosphoribosylamine-glycine ligase [Escherichia coli TW10509]
          Length = 429

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHLRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVS 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCITALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|148253229|ref|YP_001237814.1| phosphoribosylamine--glycine ligase [Bradyrhizobium sp. BTAi1]
 gi|146405402|gb|ABQ33908.1| phosphoribosylamine--glycine ligase [Bradyrhizobium sp. BTAi1]
          Length = 427

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 222/423 (52%), Positives = 287/423 (67%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL+ LW  PGN GIA+ A+CVA+D+ +H+ +I FCQ 
Sbjct: 1   MNILLIGSGGREHALAWKIAGSPLLTTLWCAPGNAGIAKEAECVALDVTDHAGVIAFCQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D + AAG K+FGP + AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  NKVDLVVVGPETPLAAGIVDDVEAAGIKIFGPRKLAAQLEGSKGFTKDLCAEYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F +  +A  YV+    PIVVKADGL AGKGVVVA T+ EA  A+       F    + 
Sbjct: 121 CRFDNAPEALAYVREHGAPIVVKADGLAAGKGVVVAKTLAEAEDAVRMMFEGGFGVAGTE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG EVSFFALCDG+TAIP  +A+DHKR+ D D GPNTGGMGA SP   ++ E+
Sbjct: 181 VVIEEFLEGREVSFFALCDGQTAIPLASAQDHKRVFDHDQGPNTGGMGAYSPTPFVTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
           +  ++ +IILPTI+GM     PF+G+L+AGLM+T QGP L EYNVRFGDPECQ +M+R+ 
Sbjct: 241 HDQIMSRIILPTIDGMNARGTPFKGILYAGLMLTAQGPKLFEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD++  + +   G L N  + W  + A+TVV+A KGYP +Y  G++I  +         +
Sbjct: 301 SDLVPAMLAACDGQLKNFDLRWFPDAAVTVVIAAKGYPGDYAKGSVIEGLDAAAKVEGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + ANGGRVL+  A GKT+TE++  AY  V+ I W  G+ R DI  Q  
Sbjct: 361 IFHAGTVAKDGAILANGGRVLNICASGKTVTEAQARAYQAVDLIQWPDGFCRRDIAWQAL 420

Query: 415 ERN 417
            + 
Sbjct: 421 AQE 423


>gi|210624283|ref|ZP_03294299.1| hypothetical protein CLOHIR_02255 [Clostridium hiranonis DSM 13275]
 gi|210153125|gb|EEA84131.1| hypothetical protein CLOHIR_02255 [Clostridium hiranonis DSM 13275]
          Length = 418

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 158/415 (38%), Positives = 256/415 (61%), Gaps = 5/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHA+ WK+     + +++  PGN GIA  A+CV I   +   ++ F ++
Sbjct: 3   MKILVVGGGGREHAICWKLKNEKDVEKVYCAPGNAGIADSAECVDIKDSDIENLVKFAKD 62

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE+PLV GI DA    G ++FGP+++ A  E SK+F+K F  +  IPTA Y
Sbjct: 63  NAIDLTVVGPEVPLVMGIVDAFEKEGLRIFGPNKQCATFEGSKAFSKDFMIRNDIPTAKY 122

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + ++D  +A   + +   P+V+KADGL AGKGVV+    ++A + +             +
Sbjct: 123 KEYTDLDEAIAEIDSFGYPVVIKADGLAAGKGVVIPENREDAITTLKEMMADKKFGDAGN 182

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E S  A  D  T +P  +A+DHK++++G+ G NTGGMG  SP+   ++E
Sbjct: 183 KVVIEEFLTGIETSILAFVDNNTIVPMESAKDHKKVNNGEKGLNTGGMGTFSPSELWTEE 242

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + +   ++  T++G Q +   ++G+LF G+MIT++G  ++EYNVRFGDPE Q+++ RL
Sbjct: 243 LANEIKVNVLDKTLKGFQNDGLDYRGILFVGVMITKEGVKVLEYNVRFGDPETQSVLFRL 302

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+ EI+N+ +   L    I +  E A+ V++ + GYPE Y  G  I+ + +      +
Sbjct: 303 ETDLSEIMNAVIDNKLSEIEIKYTDEQAICVMLTSGGYPEAYEKGKEITGLDKLDDEIVV 362

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FH+GT + +  L  NGGRV+  TA   T+ E+ +  Y  ++ I+++  ++R DIG
Sbjct: 363 FHSGTKMSDGKLVTNGGRVIGITAKAGTVAEAADKVYENIKRINFEGMHYRTDIG 417


>gi|6730014|pdb|1GSO|A Chain A, Glycinamide Ribonucleotide Synthetase (Gar-Syn) From E.
           Coli
          Length = 431

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 3   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 62

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 63  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 122

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 123 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 182

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 183 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 242

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGD E Q +M
Sbjct: 243 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDLETQPIM 302

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 303 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 362

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 363 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 422

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 423 WRAIERE 429


>gi|154483499|ref|ZP_02025947.1| hypothetical protein EUBVEN_01203 [Eubacterium ventriosum ATCC
           27560]
 gi|149735751|gb|EDM51637.1| hypothetical protein EUBVEN_01203 [Eubacterium ventriosum ATCC
           27560]
          Length = 423

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 178/422 (42%), Positives = 260/422 (61%), Gaps = 8/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHA+A  +A+SP + +++  PGN GI Q A+CV I       ++ F +E
Sbjct: 1   MKVLIVGSGGREHAIATAVAKSPKVDKIYCAPGNAGIGQVAECVNIGAMEFDKLVDFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL V+G + PLV GI D    +G +VFGP + AA LE SK+F+K    KY IPTA Y
Sbjct: 61  KEIDLTVIGMDDPLVGGIVDKFEESGLRVFGPRKNAAILEGSKAFSKDLMKKYNIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           ++F  P +A +Y++    PIV+KADGL  GKGV++  T +EA        +D+ F    +
Sbjct: 121 ENFDSPEEAMKYLETSKYPIVLKADGLALGKGVLICNTKEEAMDGVKELMLDKKFGNAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           T++IEE++ G EVS  +  DGKT    T+A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 181 TIVIEEFMTGREVSVLSFVDGKTIKIMTSAQDHKRAKDGDQGLNTGGMGTFSPSPFYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + +   T++ M  E   F+GV+F GLM+TE GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 VDEFCKKYVYQATVDAMAAEGREFKGVIFFGLMLTEDGPKVLEYNARFGDPEAQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           ++DI+++  +CV G L    + ++   A+ VV+A+ GYP  Y  G  I  +   +N    
Sbjct: 301 KNDIIDVFEACVDGTLDQIDLQFEDNAAVCVVLASDGYPVSYEKGFEIKGLENFENKEGY 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT    + +  NGGRVL  TA GK + E+R  AY   + I +++ Y R DIG + 
Sbjct: 361 YVFHAGTKAEGDKIVTNGGRVLGVTAKGKDLKEARANAYEATKLIQFENKYMRNDIG-KA 419

Query: 414 KE 415
            +
Sbjct: 420 ID 421


>gi|240850074|ref|YP_002971467.1| phosphoribosylamine-glycine ligase PurD [Bartonella grahamii
           as4aup]
 gi|240267197|gb|ACS50785.1| phosphoribosylamine-glycine ligase PurD [Bartonella grahamii
           as4aup]
          Length = 424

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 220/423 (52%), Positives = 297/423 (70%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL++L+  PGNP   +  + + ++I +H  +I FC++
Sbjct: 1   MNILLIGSGGREHALAWKIAASPLLTKLYCAPGNPATTEFGENINLNIDDHHLVIDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LN+A   VFGP+Q+AA+LE SK+F K  C K  IPT +Y
Sbjct: 61  HSIDLVIVGPEAPLVAGITDSLNSANICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTGSY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F+D  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA +A+D C    F    + 
Sbjct: 121 QCFNDASKAKAYIHQQGVPIVIKADGLAAGKGVVVATTMEEAFNAVDACFKSAFGDAGNK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++E +LEG E SFF LCDGK A+PF +A+DHKR+ DGDIG NTGGMGA SPA  M+QE+
Sbjct: 181 IVVESFLEGEEASFFCLCDGKVALPFGSAQDHKRVGDGDIGANTGGMGAYSPAPIMTQEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P ++ M++   PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALKSMKEMGAPFKGILFVGLMITQKGPELIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQ 354
            DIL I  +   G L N  + W  + ALTVV+A  GYP+    GT+I  + +       +
Sbjct: 301 DDILPIFLAAAQGKLENKPLRWSEKTALTVVMAANGYPDSPQKGTVIRNVDKVNNLPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT + +  L ANGGRVL+ TA GKTIT +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTVLRDGELIANGGRVLNITATGKTITHAQKRAYEAVDCIDWPEGFVRRDIGWRAI 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|148826467|ref|YP_001291220.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittEE]
 gi|229845939|ref|ZP_04466051.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae 7P49H1]
 gi|148716627|gb|ABQ98837.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittEE]
 gi|229810943|gb|EEP46660.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae 7P49H1]
 gi|309973615|gb|ADO96816.1| Phosphoribosylamine-glycine ligase [Haemophilus influenzae R2846]
          Length = 428

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 192/426 (45%), Positives = 271/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKAAQSPLADKVFVTPGNAGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAENAVHDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSQVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM +E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMREVIYPTVNGMAEEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W  + +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVTSRWDPQASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAVLRE 426


>gi|320185955|gb|EFW60703.1| Phosphoribosylamine--glycine ligase [Shigella flexneri CDC 796-83]
          Length = 429

 Score =  344 bits (883), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +  +   
Sbjct: 301 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLLLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|82546347|ref|YP_410294.1| phosphoribosylamine--glycine ligase [Shigella boydii Sb227]
 gi|81247758|gb|ABB68466.1| phosphoribosylglycinamide synthetase [Shigella boydii Sb227]
 gi|332092335|gb|EGI97410.1| phosphoribosylamine--glycine ligase [Shigella boydii 3594-74]
          Length = 429

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 190/427 (44%), Positives = 274/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+  K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKASTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +  +   
Sbjct: 301 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLLLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|170723774|ref|YP_001751462.1| phosphoribosylamine--glycine ligase [Pseudomonas putida W619]
 gi|169761777|gb|ACA75093.1| phosphoribosylamine--glycine ligase [Pseudomonas putida W619]
          Length = 431

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 186/426 (43%), Positives = 272/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVTALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T++EA +A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +IS +      
Sbjct: 300 LRLESSLVLLIEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVISGLEAAAKI 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT++ +  +  NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTSLKDGQVVTNGGRVLCATAMGSTVADAQQQAYRLAKEVTWNGSFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|238760271|ref|ZP_04621415.1| Phosphoribosylamine--glycine ligase [Yersinia aldovae ATCC 35236]
 gi|238701535|gb|EEP94108.1| Phosphoribosylamine--glycine ligase [Yersinia aldovae ATCC 35236]
          Length = 428

 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMSQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L     +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLDEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + ENI W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAENIQWEGVFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|56416001|ref|YP_153076.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364928|ref|YP_002144565.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205354423|ref|YP_002228224.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207859353|ref|YP_002246004.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|56130258|gb|AAV79764.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197096405|emb|CAR62010.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|205274204|emb|CAR39222.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206711156|emb|CAR35530.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|326629555|gb|EGE35898.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 429

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 194/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|197334390|ref|YP_002157187.1| phosphoribosylamine--glycine ligase [Vibrio fischeri MJ11]
 gi|197315880|gb|ACH65327.1| phosphoribosylamine--glycine ligase [Vibrio fischeri MJ11]
          Length = 430

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 194/430 (45%), Positives = 279/430 (64%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IG+GGREHAL WK AQ+P +  ++  PGN G A     + VAID+++ +A++ F 
Sbjct: 1   MNVLIIGAGGREHALGWKAAQNPNVETVFIAPGNAGTALEPKLENVAIDVEDIAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I+L +VGPE PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  KEKAIELTIVGPEAPLVIGVVDAFREAGLPIFGPTKAAAQLEGSKAFTKDFLARHDIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
           +Y +F++   A  YV+ +  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 SYANFTEIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEDAIKDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DG + +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGASVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+++ +++++I PT+ GM  E  P+ G L+AGLMI  E  P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHNRILEEVIYPTVRGMDAEGAPYTGFLYAGLMIDAEGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ESD++E+    +   L      W    ++ VV+A  GYP +Y  G +IS   + T  
Sbjct: 301 MRMESDLVELCLMAIDEKLDEAESKWDPRASIGVVLAAGGYPGDYAKGDVISLPSEETED 360

Query: 353 TQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGT   +  ++  NGGRVL ATALG T++E++E AY + + + W   + R DIG 
Sbjct: 361 QKIFHAGTTNNDAGDVVTNGGRVLCATALGNTVSEAQERAYQLAKQVSWNGMFHRNDIGY 420

Query: 412 QKKERNVKYR 421
           +   R ++ +
Sbjct: 421 RAIARELETK 430


>gi|332159927|ref|YP_004296504.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664157|gb|ADZ40801.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330863077|emb|CBX73208.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica
           W22703]
          Length = 431

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 272/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLAEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAEKIQWEGAFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|312965341|ref|ZP_07779574.1| phosphoribosylamine--glycine ligase [Escherichia coli 2362-75]
 gi|312290015|gb|EFR17902.1| phosphoribosylamine--glycine ligase [Escherichia coli 2362-75]
          Length = 429

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + +DL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKVDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+++A +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEKAEAAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGTLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 DGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|15602089|ref|NP_245161.1| phosphoribosylamine--glycine ligase [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|13431795|sp|P57829|PUR2_PASMU RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|12720449|gb|AAK02308.1| PurD [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 429

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 268/425 (63%), Gaps = 8/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSP+  +++  PGN G A     + VAI   +   ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPMAEKVFVAPGNAGTALEEKVENVAISATDVEKLVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q  HI L +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QANHIGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTKAAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+DEA +A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLDEAEAAVKEMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  ++Q++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHERIMQQVIYPTVNGMAAEGNIYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RLESD++E+  +   G L      W  + +L +V+A +GYP +Y  G  I+ I      
Sbjct: 301 LRLESDLVELCLAACDGKLDQKKSQWCEQASLGIVLAAEGYPGDYRKGDEITGIESAVEN 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            ++F AG    +  L  NGGRV+  TALG T+ ++++ A  + E + W   ++R DIG +
Sbjct: 361 QKVFLAGVENKDGKLVTNGGRVVCVTALGDTVYDAQQQALALAEQVKWTGRFYRRDIGYR 420

Query: 413 KKERN 417
              R 
Sbjct: 421 AVARE 425


>gi|89075363|ref|ZP_01161785.1| phosphoribosylamine--glycine ligase [Photobacterium sp. SKA34]
 gi|89048912|gb|EAR54481.1| phosphoribosylamine--glycine ligase [Photobacterium sp. SKA34]
          Length = 428

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A     + V I +++ +A++ F 
Sbjct: 1   MKVLIIGNGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVEIGVEDIAALVEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  +A   +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNQIGLTIVGPEAPLVIGVVDAFRSAKLPIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T  EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVVKADGLAAGKGVIVAMTEQEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           Q+++  V++++I PT+EGM  E  P+ G L+AGLMI ++  P +IEYN RFGDPE Q +M
Sbjct: 241 QDIHDRVMKEVIYPTVEGMAAEGAPYTGFLYAGLMIMSDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R++SD++E+  + +   L      W    ++ VV+A  GYP  Y  G +IS +PQ    
Sbjct: 301 LRMQSDLVELCLAAIDEKLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPQQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAG A  N N+  NGGRVL ATA+G T+ E+++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFHAGAANNNGNIVTNGGRVLCATAMGDTVLEAQQRAYALAKQISWDGMFHRDDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|319406932|emb|CBI80569.1| Phosphoribosylamine-glycine ligase [Bartonella sp. 1-1C]
          Length = 424

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 227/423 (53%), Positives = 290/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +    + +DI +H +I+ FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCTPGNPATMEFGTNIDLDINDHFSIVDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV GI+DALNAA   VFGP+Q+AA+LE SK F K  C K  IPTA Y
Sbjct: 61  NTIDLVVVGPEAPLVGGITDALNAAHICVFGPNQQAAQLEGSKGFTKDLCYKNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F + +KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID C    F      
Sbjct: 121 QRFDNALKAKSYIHQQGIPIVIKADGLAAGKGVVVAMTMEEAFDAIDSCFEGTFGDAGKE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +LEG E SFF LCDGK AIPF +A+DHKRI DGD G NTGGMGA SPA  M++E+
Sbjct: 181 VVVEAFLEGEETSFFCLCDGKIAIPFGSAQDHKRIGDGDTGVNTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +Q+I+ P + G+ +    F+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLQEIVTPALRGLAEMDISFKGILFVGLMITQKGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL +  +   GNL   ++ W  E ALTVV+A  GYP     G++I  I +       +
Sbjct: 301 DDILPLFLAAAQGNLEKKNLQWSEETALTVVMAANGYPVSPQKGSVIRNIDKVNSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA GKTI  +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALCNGELIANSGRVLNITATGKTIKIAQKRAYEAVDCIDWPEGFVRRDIGWRAI 420

Query: 415 ERN 417
            R 
Sbjct: 421 MRE 423


>gi|299066209|emb|CBJ37393.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Ralstonia
           solanacearum CMR15]
          Length = 422

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 185/422 (43%), Positives = 262/422 (62%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V+++GSGGREHALAWK+A+SP +  ++  PGN G A   +   + I +   +  F + 
Sbjct: 1   MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNVPITDPEVLAAFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   VVGPE PL  GI D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVHFTVVGPEAPLAAGIVDLFRAKGLRIFGPTRAAAQLESSKDFAKAFMHRHGIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
           Q F +  +A  YV  +  PIV+KADGL AGKGVVVA T++E          D       +
Sbjct: 121 QTFGNAAEAHAYVDREGAPIVIKADGLAAGKGVVVAMTLEEAHGAIDMMLADNRLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  +CDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVVCDGKDVVAMATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPTI GM+K+  P+ G L+AGLMI  +  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVLREIILPTIRGMEKDGIPYTGFLYAGLMIDADGIPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           +++D+ ++L+  + G L    ++W    AL VV+A   YP+    G +I+ IP+ T  + 
Sbjct: 301 MKTDLFDVLDRAIDGKLDGMELDWDRRTALGVVMAAHNYPDTPRKGDVITGIPKETEDSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT NGGRVL    L  T+  ++  AY  VE I +    +R+DIG +  
Sbjct: 361 TFHAGTTLKDGTLTTNGGRVLCVVGLADTVKAAQRAAYGAVEQIRFDGAQYRKDIGHRAI 420

Query: 415 ER 416
            R
Sbjct: 421 RR 422


>gi|91978565|ref|YP_571224.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisB5]
 gi|91685021|gb|ABE41323.1| phosphoribosylamine--glycine ligase [Rhodopseudomonas palustris
           BisB5]
          Length = 427

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 226/423 (53%), Positives = 290/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWKIA SPL+++LW  PGN GIA+ A CV +D+ +H+A+I FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKIAASPLVTKLWCAPGNAGIARAATCVPLDLADHAAVIDFCKA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I+ VVVGPE PLV GI D L AAG K FGPS +AA+LE SK F K  C  +GIPTA Y
Sbjct: 61  NAIEFVVVGPEAPLVAGIVDDLTAAGIKAFGPSSKAAQLEGSKGFTKDLCKAHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           + FSDP +AK Y++ +  PIVVKADGL AGKGVVVA T+ EA +A+D  F          
Sbjct: 121 ERFSDPDEAKAYIRVQGAPIVVKADGLAAGKGVVVAMTLAEAEAAVDMIFGGALGDAGVE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E++L G E SFF LCDG+ A+   TA+DHKR +DGD GPNTGGMGA SPA  M++ +
Sbjct: 181 VVVEDFLVGEEASFFVLCDGEHALALATAQDHKRAYDGDKGPNTGGMGAYSPAPVMTEAV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PT++GM+    PF+GVLFAGLMITE GP LIEYNVRFGDPECQ +M+R+ 
Sbjct: 241 CKQAMERIITPTLKGMKAMGMPFKGVLFAGLMITEDGPQLIEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SDI+  L +C  G L +  + W  E ALTVV+A KGYP  Y  GT I+ + +       +
Sbjct: 301 SDIVPALLACADGQLAHFSLRWVDEPALTVVMAAKGYPGAYEKGTRIAGLERAEQIPGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT    + + ANGGRVL+ TA   T+ E++  AY  +  I+W  G+ R DIG Q  
Sbjct: 361 IFHAGTMASGDWILANGGRVLAVTASANTVAEAQRRAYEAIGVINWPEGFCRRDIGWQAV 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|301160671|emb|CBW20202.1| phosphoribosylglycineamide synthetase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
          Length = 429

 Score =  344 bits (882), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +   ++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPTLLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|238756045|ref|ZP_04617368.1| Phosphoribosylamine--glycine ligase [Yersinia ruckeri ATCC 29473]
 gi|238705712|gb|EEP98106.1| Phosphoribosylamine--glycine ligase [Yersinia ruckeri ATCC 29473]
          Length = 427

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 186/425 (43%), Positives = 269/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   +  +++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIPSLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRNAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 FYQNFTEIEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLQEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ +II PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DKVHQRVMDQIIWPTVRGMAAEGNIYTGFLYAGLMISSDGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++ +  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVGLCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  N++  +GGRVL  TALG  + ++++ AY +  +I W+ G+ R+DIG 
Sbjct: 361 DAKVFHAGTRLDGNHVVTSGGRVLCVTALGADVADAQQRAYQLAADIHWEGGFCRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|209517572|ref|ZP_03266411.1| phosphoribosylamine/glycine ligase [Burkholderia sp. H160]
 gi|209501985|gb|EEA02002.1| phosphoribosylamine/glycine ligase [Burkholderia sp. H160]
          Length = 427

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 184/423 (43%), Positives = 262/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  + + IDI + +A+  F ++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQLVYVAPGNGGTAQDERLLNIDITDPAALADFVEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI +   + G K+FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EQIAFTLVGPEAPLAAGIVNLFRSRGLKIFGPTKEAAQLESSKDFAKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F+D   A  Y+  K  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFADVAAAHAYLDAKGAPIVIKADGLAAGKGVVVAQTLEEAHAAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +   +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKHVLALASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++II PT+ GM+KE   + G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIIQPTVRGMEKEGIRYTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D  +++   + G L    + W    AL VV+A   YP+    G  I+ IP  T  + 
Sbjct: 301 LKGDYSKVVEHAIAGTLDTVELEWDRRTALGVVLAAHNYPDTPRKGDRINGIPAETADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT +GGRVL    L  ++  ++  AY  +  I +    +R DIG +  
Sbjct: 361 TFHAGTTLTDGKLTTSGGRVLCVVGLADSVRTAQAAAYQTINQISFDGMQYRRDIGYRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|94309729|ref|YP_582939.1| phosphoribosylamine--glycine ligase [Cupriavidus metallidurans
           CH34]
 gi|93353581|gb|ABF07670.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Cupriavidus metallidurans CH34]
          Length = 422

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 188/422 (44%), Positives = 262/422 (62%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHALAWK+AQSP +  ++  PGN G A   +   + + +   +  F + 
Sbjct: 1   MKVLVVGSGGREHALAWKLAQSPKVQVVYVAPGNGGTALDKRLQNVPLTDPEVLAAFVER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   VVGPE PL  GI D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVAFTVVGPEAPLAGGIVDVFRARGLRIFGPTKAAAQLESSKDFAKAFMHRHGIPTAYY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q FSD   A  Y+  +  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 QTFSDAAGAHAYIDAQGAPIVIKADGLAAGKGVVVAMTLEEAHAAVDMMLADNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E SF  + DGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLEGEEASFIVMVDGKNVLALATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           L++  +++IILPT+ GM+K+  PF G L+AGLMI     P  +E+N R GDPE Q +M R
Sbjct: 241 LHARALREIILPTVRGMEKDGIPFTGFLYAGLMIDANGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L++D+++++ + V G L    ++W    AL VV+A   YPE    G  I+ IP  T    
Sbjct: 301 LKTDLVDVMEAAVDGKLDQIELDWDRRTALGVVMAAYDYPENPRKGDAITGIPAETADAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  L  +GGRVL    L  T+  +++ AY  VE I +    +R DIG +  
Sbjct: 361 TFHAGTTLKDGTLLTSGGRVLCVVGLADTVKAAQKNAYAAVEQIRFDGMQFRTDIGYRAI 420

Query: 415 ER 416
           +R
Sbjct: 421 KR 422


>gi|319775179|ref|YP_004137667.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Haemophilus influenzae F3047]
 gi|317449770|emb|CBY85977.1| phosphoribosylglycinamide synthetase phosphoribosylamine-glycine
           ligase [Haemophilus influenzae F3047]
          Length = 429

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 270/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKAAQSPLADKVFVAPGNVGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE+PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEVPLVTGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDPRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++    + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKVLKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|95930762|ref|ZP_01313495.1| phosphoribosylamine--glycine ligase [Desulfuromonas acetoxidans DSM
           684]
 gi|95133242|gb|EAT14908.1| phosphoribosylamine--glycine ligase [Desulfuromonas acetoxidans DSM
           684]
          Length = 423

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 188/423 (44%), Positives = 261/423 (61%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHAL WKIAQSPL+ +++  PGNPG+ + A+ V + + N   +  F  +
Sbjct: 1   MKILVVGGGGREHALVWKIAQSPLVEKVYCAPGNPGMKELAETVHLAVDNIDGLCDFAIK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPELPL  GI D   A G  +FGPS+ AA++E SK F+K    KYGI TA Y
Sbjct: 61  EQIDLTVVGPELPLTLGIVDRFKAQGLAIFGPSKAAAQIEGSKGFSKDLMAKYGIKTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F+D   A  Y++ +  PIVVK DGL AGKGV++A TVDEA +A+D       F     
Sbjct: 121 ESFTDRDAAAAYIRQQGAPIVVKVDGLAAGKGVILAQTVDEAIAAVDDILVKKTFGDAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE+L G E SFFA  DGK  +P  +++DHK+I DGD GPNTGGMGA SPA  ++  
Sbjct: 181 AVVVEEFLTGEEASFFAFTDGKNILPLASSQDHKQIFDGDKGPNTGGMGAYSPAPVVTDA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           LY  ++ +++ PTI+GM  E  P+ G+LF GLMI      ++E+N RFGDPECQ ++ R+
Sbjct: 241 LYQRIVDEVVQPTIDGMAAEGCPYCGILFVGLMIENDDFKVLEFNARFGDPECQPLLSRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SD++ +L  C  G L    + W    A+ VV+A  GYP  Y  G +I  I         
Sbjct: 301 KSDVVPVLLDCARGELTTKALEWYDRAAVCVVLAAGGYPASYSKGDVIEGIDAANAVDGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA  +  +   GGRVL  T  G+T+  + + AY   + I W     R DIG + 
Sbjct: 361 RVFHAGTAEQDGRIVTAGGRVLGVTGWGETVAVAIDKAYEGADKIQWNGMQMRRDIGQKA 420

Query: 414 KER 416
            +R
Sbjct: 421 LKR 423


>gi|320539745|ref|ZP_08039408.1| putative phosphoribosylglycinamide synthetase
           phosphoribosylamine-glycine ligase [Serratia symbiotica
           str. Tucson]
 gi|320030210|gb|EFW12226.1| putative phosphoribosylglycinamide synthetase
           phosphoribosylamine-glycine ligase [Serratia symbiotica
           str. Tucson]
          Length = 427

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 269/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+AQSPL  +++  PGN G A  A  + VAI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKVAQSPLADKVFVAPGNAGTALEAKLENVAISATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG K+FGPSQ AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPSQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQHF++   A  YV++K  PIV+KADGL AGKGV+VA T+ EA   +        F   
Sbjct: 121 EYQHFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLAEAEDTVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLAGEEASFIVMVDGEHVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++   + ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRAMDQVIWPTVRGMAAEGNIYVGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +RL SD++E+  +   G L     +W    AL VV+AT GYP  Y  G +I  + Q    
Sbjct: 301 LRLRSDLVELCLAGAEGKLGEKTSDWDERPALGVVMATGGYPGNYHSGEVIQGLSQQEYA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  + +  +GGRVL  TALG T+ ++++ AY +   I W   + R+DIG 
Sbjct: 361 DGKVFHAGTCMQGDEVVTSGGRVLCVTALGATVEQAQQRAYQLTAGIQWPGSFCRKDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARG 426


>gi|318607522|emb|CBY29020.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 431

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 272/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPALENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T+ EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLAEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAEKIQWEGAFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|148828068|ref|YP_001292821.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittGG]
 gi|148719310|gb|ABR00438.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae PittGG]
          Length = 429

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 269/427 (62%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVFVAPGNVGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP+Q AA+LE SK+F K F   + IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTQAAAQLEGSKAFTKDFLACHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK      T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEAMATSQDHKRVGENDTGLNTGGMGAYSPAPVIT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E + + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGSVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDTRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A   + L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQESKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|134093818|ref|YP_001098893.1| phosphoribosylamine--glycine ligase [Herminiimonas arsenicoxydans]
 gi|133737721|emb|CAL60766.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           (Phosphoribosylamine--glycine ligase) (Glycinamide
           ribonucleotide synthetase) [Herminiimonas
           arsenicoxydans]
          Length = 423

 Score =  344 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 187/422 (44%), Positives = 269/422 (63%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQS  +  ++  PGN G A   +   I I +   +  F Q+
Sbjct: 1   MKILVVGSGGREHALAWKLAQSERIQTVFVAPGNGGTALDERLQNIAITDPQELAQFVQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +++ L VVGPE PL  GI +   A G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  ENVALTVVGPETPLAAGIVNIFRAQGLKIFGPTREAAQLESSKDFAKSFMQRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q FSD   A  Y+ +K  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 QTFSDVAPAHAYIDSKGAPIVIKADGLAAGKGVVVAMTLEEAHAAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +   T++DHKR+ D D GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKNILALATSQDHKRLLDHDEGPNTGGMGAYSPAPIVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++II PT++GM K+  PF G L+AGLMI ++  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIIQPTVQGMAKDGIPFSGFLYAGLMIDDKGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L++D++ ++   V+G L    + W    AL VV+A  GYP+    G +I+ IP     + 
Sbjct: 301 LKTDLVGVMEHAVNGTLDTIELEWDRRTALGVVMAAAGYPDAPRKGDVITGIPAEDADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGTA+ +  LT +GGRVL    LG ++  +++ AY ++++I +    +R DIG +  
Sbjct: 361 TFHAGTALNDKQLTTSGGRVLCVVGLGDSVKMAQKKAYEVIDHIHFDGAQYRHDIGWRAL 420

Query: 415 ER 416
           +R
Sbjct: 421 KR 422


>gi|323132511|gb|ADX19941.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
          Length = 433

 Score =  343 bits (880), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +   ++ F 
Sbjct: 5   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPTLLSFA 64

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 65  QHEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 124

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 125 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 184

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 185 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 244

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 245 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 304

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 305 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGSYSTGDEIHGLPLEEVA 364

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 365 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 424

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 425 WRAIERE 431


>gi|126697795|ref|YP_001086692.1| phosphoribosylamine--glycine ligase [Clostridium difficile 630]
 gi|255099384|ref|ZP_05328361.1| phosphoribosylamine--glycine ligase [Clostridium difficile
           QCD-63q42]
 gi|255305242|ref|ZP_05349414.1| phosphoribosylamine--glycine ligase [Clostridium difficile ATCC
           43255]
 gi|115249232|emb|CAJ67045.1| Phosphoribosylamine--glycine ligase [Clostridium difficile]
          Length = 416

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 163/415 (39%), Positives = 263/415 (63%), Gaps = 5/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHA+ WK+++   + +++  PGN GIA  A+CV I   N   ++ F +E
Sbjct: 1   MKILVVGGGGREHAICWKLSKEKNVEKIYCAPGNAGIANVAECVNIGDTNIEELLKFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I L +VGPE+PLV GI D     G +VFGP+++ A+LE SK+F+K+F  K+ IPTA Y
Sbjct: 61  NEIGLTIVGPEVPLVMGIVDEFEKEGLRVFGPNKKCAQLEGSKAFSKEFMIKHNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + +++  +A   + +   P+V+KADGL AGKGVV+    ++A + +              
Sbjct: 121 KEYTNLEEAISEIDSFGYPVVIKADGLAAGKGVVIPENREDAIATLKEMMSDKKFGAAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+L+G E S  A  D  T +P  +A+DHK++++ + GPNTGGMG  SP+   ++E
Sbjct: 181 KIVIEEFLKGIETSILAFVDNDTIVPMASAKDHKKVNNYEQGPNTGGMGTFSPSEIYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V + ++  T+EG +K+   F+G+LF GLMITE G  ++EYNVRFGDPE Q+++ RL
Sbjct: 241 LANKVKETVLEKTLEGFKKDGLNFKGILFVGLMITEDGEKVLEYNVRFGDPETQSVLFRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+ EI+ + +   L +  IN+  + A+ V++ + GYP+ Y  G II+ +        +
Sbjct: 301 ETDLHEIMEAILDNKLKDIEINYSDDEAVCVMLTSGGYPDSYEKGKIITGLENLDDDIVV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FH+GT + + NL  NGGRV+  TA   T+ ++ E  Y  ++ I+++  ++R DIG
Sbjct: 361 FHSGTKMFDGNLVTNGGRVIGITAKSTTVKDAAEKVYENIKKINFEGMHYRTDIG 415


>gi|146305742|ref|YP_001186207.1| phosphoribosylamine--glycine ligase [Pseudomonas mendocina ymp]
 gi|145573943|gb|ABP83475.1| phosphoribosylamine--glycine ligase [Pseudomonas mendocina ymp]
          Length = 429

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 265/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAVEAKCENVAIDVLAIEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE PLV G+ D   + G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VQLTIVGPEAPLVKGVVDLFRSRGLDIFGPTAAAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGQNVLPMATSQDHKRVGDADTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 PEVHQRVMDEVIYPTVRGMASEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
            RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  + +    
Sbjct: 300 CRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGDVIEGLEEAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + +  +   GGRVL ATA+G+T+ E+++ AY + E I W   + R DIG 
Sbjct: 360 DGKVFHAGTKLSDGQIVTAGGRVLCATAIGRTVAEAQQQAYRLAEKIRWNGMFHRSDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|121602480|ref|YP_988711.1| phosphoribosylamine--glycine ligase [Bartonella bacilliformis
           KC583]
 gi|120614657|gb|ABM45258.1| phosphoribosylamine--glycine ligase [Bartonella bacilliformis
           KC583]
          Length = 424

 Score =  343 bits (880), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 227/423 (53%), Positives = 300/423 (70%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +  + + +DI +H  +I FC+ 
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCAPGNPATIEFGENIVLDIDDHLLVIDFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV++GPE PL++GI+DALNAA   VFGP+Q+AA+LE SKSF K  C +  IPT+ Y
Sbjct: 61  HSIDLVIIGPEAPLISGITDALNAADIYVFGPNQKAAQLEGSKSFTKDLCQRNNIPTSIY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F D  KAK Y++ + +PIV+K DGL AGKGVV+A T++EA +A+D C    F      
Sbjct: 121 QCFDDASKAKSYIRQQGVPIVIKVDGLAAGKGVVIATTIEEAFNAVDSCFEGAFGDAGKK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IE +LEG E SFF LCDGKTAIPF +A+DHKR+ DGDIG NTGGMGA SPA  M++E+
Sbjct: 181 IVIEAFLEGEEASFFCLCDGKTAIPFGSAQDHKRVGDGDIGENTGGMGAYSPAPVMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++II P + GM + +  F+G+LFAGLMIT +GP LIE+NVRFGDPECQ +MMRLE
Sbjct: 241 VNRTLKEIIEPALRGMAEMEALFKGILFAGLMITSEGPKLIEFNVRFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL +L +   GNL N  I W  + ALTVV+A  GYP     G++I  + +       Q
Sbjct: 301 EDILPLLLAAAQGNLENRPILWSEKTALTVVMAANGYPNAPQKGSVIRNVDKVNTLSDVQ 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FH+GTA+ N  L ANGGRVL+ TA+GKT++++++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFHSGTALHNGELIANGGRVLNITAVGKTVSKAQKRAYEAVDCIDWPQGFVRRDIGWRAI 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|123440691|ref|YP_001004683.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087652|emb|CAL10434.1| phosphoribosylamine--glycine ligase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 431

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYSGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NNN+  +GGRVL  TALG T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQHAYKLAEKIQWEGAFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAITRE 427


>gi|319898594|ref|YP_004158687.1| phosphoribosylamine-glycine ligase [Bartonella clarridgeiae 73]
 gi|319402558|emb|CBI76103.1| Phosphoribosylamine-glycine ligase [Bartonella clarridgeiae 73]
          Length = 424

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 224/423 (52%), Positives = 291/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +  + + +DI +H ++I+FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCTPGNPATMEFGENIDLDIDDHCSVINFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PLV GI+DALNAA   VFGP+Q+A +LE SK F K  C +  IPTA Y
Sbjct: 61  NAIDLAVVGPEAPLVAGITDALNAAHICVFGPNQKATQLEGSKGFTKDLCYRNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F +  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID C    F      
Sbjct: 121 QRFDNASKAKSYIHQQGIPIVIKADGLAAGKGVVVAMTIEEAFDAIDACFEGTFGDAGKE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +LEG E SFF LCDGK AIPF +A+DHKR+ DGD G NTGGMGA SPA  M++E+
Sbjct: 181 VVVEAFLEGEEASFFCLCDGKIAIPFGSAQDHKRVGDGDTGVNTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I++P + GM +    F+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVIPALRGMAEMDIYFKGILFVGLMITQKGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL +  S   GNL   ++ W  E ALTVV+A  GYP     G++I  I +       +
Sbjct: 301 DDILPLFLSAAQGNLQKKNLQWSEETALTVVMAANGYPVSPQKGSVIRNIDKVNSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA+GKTI  +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALRNGELIANSGRVLNITAIGKTIKLAQKRAYEAVDYIDWPQGFVRRDIGWRAI 420

Query: 415 ERN 417
            R 
Sbjct: 421 MRE 423


>gi|187929468|ref|YP_001899955.1| phosphoribosylamine--glycine ligase [Ralstonia pickettii 12J]
 gi|309781757|ref|ZP_07676490.1| phosphoribosylamine--glycine ligase [Ralstonia sp. 5_7_47FAA]
 gi|187726358|gb|ACD27523.1| phosphoribosylamine/glycine ligase [Ralstonia pickettii 12J]
 gi|308919398|gb|EFP65062.1| phosphoribosylamine--glycine ligase [Ralstonia sp. 5_7_47FAA]
          Length = 422

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 190/422 (45%), Positives = 264/422 (62%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V+++GSGGREHALAWK+A+SP +  ++  PGN G A   +   + I +   +  F + 
Sbjct: 1   MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNLPITDPEVLAAFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   VVGPE PL  GI D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGIHFTVVGPEAPLAAGIVDLFRAKGLRIFGPTKAAAQLESSKDFAKAFMHRHGIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q FSD  +A  YV  +  PIVVKADGL AGKGVVVA T +EA SAID            +
Sbjct: 121 QTFSDAAQAHAYVDQEGAPIVVKADGLAAGKGVVVAMTAEEAHSAIDMMLADNRLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  +CDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVVCDGKNVVALATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           L++  +++II+PTI GM+K+  P+ G L+AGLMI  E  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARALREIIMPTIRGMEKDGIPYTGFLYAGLMIDAEGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           +++D+ ++L+  + G L    ++W    AL VV+A   YP+    G +I+ IP+ T  + 
Sbjct: 301 MKTDLYDVLDRAIDGKLDGMELDWDRRTALGVVMAAHNYPDTPRKGDVITGIPKETEDSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT NGGRVL    L  T+  ++  AY+ +E I +    +R DIG +  
Sbjct: 361 TFHAGTTLKDGVLTTNGGRVLCVVGLADTVKAAQRAAYNAIEQIHFDGAQYRTDIGHRAI 420

Query: 415 ER 416
             
Sbjct: 421 RH 422


>gi|255659542|ref|ZP_05404951.1| phosphoribosylamine--glycine ligase [Mitsuokella multacida DSM
           20544]
 gi|260848096|gb|EEX68103.1| phosphoribosylamine--glycine ligase [Mitsuokella multacida DSM
           20544]
          Length = 427

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 200/423 (47%), Positives = 281/423 (66%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQ 59
           M +L+IGSGGREH LAWK+AQSP  ++L+++PGNPG+A  A+C+  +DI ++ A++   +
Sbjct: 1   MNILVIGSGGREHTLAWKLAQSPKATKLYAVPGNPGMADIAECIGGVDICDNEALVKLAE 60

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +K IDLVVVGPE+PL NG+ DA+NAAG K FGP + AA++E SKSF+K    KYGIPTA 
Sbjct: 61  DKAIDLVVVGPEVPLTNGVVDAMNAAGIKAFGPRKLAAEIEGSKSFSKNLMKKYGIPTAK 120

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQIN 174
           Y+ F+D  +A+ Y++ +  PIV+KADGL AGKGV+VA T++EA  A+          +  
Sbjct: 121 YEVFTDADEARAYIKKEGAPIVIKADGLAAGKGVIVAMTLEEALDAVHEIMDDAAFGKAG 180

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S V+IEE++EG E S  A  DGKT  P  +++DHKR +DGD GPNTGGMG  +PA  M+ 
Sbjct: 181 SRVVIEEFMEGEEASLLAFTDGKTIYPMVSSQDHKRAYDGDKGPNTGGMGTYAPAPVMTD 240

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
           E+     ++I+ PTI  M KE  P++G L+AGLMIT++GP ++E+N RFGDPE Q ++  
Sbjct: 241 EMVKIATERILKPTIAAMAKEGRPYKGCLYAGLMITKEGPKVVEFNARFGDPETQVVLPL 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG-TT 353
           LESD+++I+ +C  G+L   HI W    A+ VV+A+ GYP+ Y  G  I  + +     T
Sbjct: 301 LESDLVDIMLACTDGHLDEEHIEWSKGAAVCVVIASGGYPKAYKKGYPIEGLAKAKALDT 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA  +  +  NGGRVL   A    I  + + AY  V  I +K  + R DI  + 
Sbjct: 361 LVFHAGTAEKDGKIVTNGGRVLGVVAKADDIRTAVDKAYKGVNAITFKDAFHRNDIAHRA 420

Query: 414 KER 416
            ER
Sbjct: 421 LER 423


>gi|323703214|ref|ZP_08114867.1| phosphoribosylamine/glycine ligase [Desulfotomaculum nigrificans
           DSM 574]
 gi|323531873|gb|EGB21759.1| phosphoribosylamine/glycine ligase [Desulfotomaculum nigrificans
           DSM 574]
          Length = 425

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 187/421 (44%), Positives = 269/421 (63%), Gaps = 5/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHAL WK+ QSP + +++  PGN GI+Q A CV I   +   +++F Q+
Sbjct: 1   MKILVVGGGGREHALVWKLRQSPKVDQIFCAPGNAGISQIATCVNIPAGDVYGLLNFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE+PL NGI D    AG K+FGP++ AA++E SK+ AK+   KY IPTA Y
Sbjct: 61  QQIDLTVVGPEIPLTNGIVDIFEQAGLKIFGPTRAAAEIEGSKALAKEIMAKYNIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
             F+D  +AK+Y++    P VVKADGL AGKGV+VA   + A +        R F Q   
Sbjct: 121 GIFADAAQAKEYIKQYGAPCVVKADGLAAGKGVIVAMDEETALAAVDIIMAQRAFGQAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYL+G EVS  A  +G T IP   ++DHKR+ D D GPNTGGMGA +PA   + E
Sbjct: 181 KVVIEEYLQGEEVSVLAFVEGDTIIPMVASQDHKRVGDHDTGPNTGGMGAYAPAPLYTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   V + I+ PT++ +  E  P++GVL+AGLMIT+ GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LAEIVERDILQPTVKALAAEGRPYRGVLYAGLMITDAGPKVLEFNARFGDPETQPVLSLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+++I+ + + G L +  + WK   A+ VV+A +GYP  Y  G  I  +       ++
Sbjct: 301 ETDLVDIIEAILEGRLASQPVTWKNGAAVCVVMAAQGYPGNYERGQEIKGLNNLPSGIEV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGTA+ +  +  +GGRVL  TA+G  I ++ + AY  V  I +   ++R DIG +  E
Sbjct: 361 FHAGTALKDGKIVTDGGRVLGVTAVGTDIADAIKKAYQGVAAIHFAGAHYRTDIGQKALE 420

Query: 416 R 416
           +
Sbjct: 421 K 421


>gi|254973881|ref|ZP_05270353.1| phosphoribosylamine--glycine ligase [Clostridium difficile
           QCD-66c26]
 gi|255091266|ref|ZP_05320744.1| phosphoribosylamine--glycine ligase [Clostridium difficile CIP
           107932]
 gi|255312925|ref|ZP_05354508.1| phosphoribosylamine--glycine ligase [Clostridium difficile
           QCD-76w55]
 gi|255515684|ref|ZP_05383360.1| phosphoribosylamine--glycine ligase [Clostridium difficile
           QCD-97b34]
 gi|255648778|ref|ZP_05395680.1| phosphoribosylamine--glycine ligase [Clostridium difficile
           QCD-37x79]
 gi|260681998|ref|YP_003213283.1| phosphoribosylamine--glycine ligase [Clostridium difficile CD196]
 gi|260685596|ref|YP_003216729.1| phosphoribosylamine--glycine ligase [Clostridium difficile R20291]
 gi|306518895|ref|ZP_07405242.1| phosphoribosylamine--glycine ligase [Clostridium difficile
           QCD-32g58]
 gi|260208161|emb|CBA60472.1| phosphoribosylamine--glycine ligase [Clostridium difficile CD196]
 gi|260211612|emb|CBE01841.1| phosphoribosylamine--glycine ligase [Clostridium difficile R20291]
          Length = 416

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 162/415 (39%), Positives = 263/415 (63%), Gaps = 5/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHA+ WK+++   + +++  PGN GI   A+CV I   N   ++ F +E
Sbjct: 1   MKILVVGGGGREHAICWKLSKEKNVEKVYCAPGNAGITNVAECVNIGDTNIEELLKFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I L +VGPE+PLV GI D     G +VFGP+++ A+LE SK+F+K+F  K+ IPTA Y
Sbjct: 61  NEIGLTIVGPEVPLVMGIVDEFEKEGLRVFGPNKKCAQLEGSKAFSKEFMIKHNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + +++  +A   + +   P+V+KADGL AGKGVV+    ++A + +              
Sbjct: 121 KEYTNLEEAISEIDSFGYPVVIKADGLAAGKGVVIPENREDAIATLKEMMSDKKFGAAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+L+G E S  A  D  T +P  +A+DHK++++ + GPNTGGMG  SP+   ++E
Sbjct: 181 KIVIEEFLKGIETSILAFVDNDTIVPMASAKDHKKVNNYEQGPNTGGMGTFSPSEIYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L + V + ++  T+EG +K+   F+G+LF GLMITE G  ++EYNVRFGDPE Q+++ RL
Sbjct: 241 LANKVKETVLEKTLEGFKKDGLNFKGILFVGLMITEDGEKVLEYNVRFGDPETQSVLFRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+ EI+ + +   L +  IN+  + A+ V++ + GYP+ Y  G II+ +        +
Sbjct: 301 ETDLHEIMETILDNKLKDIEINYSDDEAVCVMLTSGGYPDSYEKGKIITGLENLDDDIVV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FH+GT +++ NL  NGGRV+  TA   T+ ++ E  Y  ++ I+++  ++R DIG
Sbjct: 361 FHSGTKMLDGNLVTNGGRVIGITAKSTTVKDAAEKVYENIKKINFEGMHYRTDIG 415


>gi|254787033|ref|YP_003074462.1| phosphoribosylamine--glycine ligase [Teredinibacter turnerae T7901]
 gi|237685925|gb|ACR13189.1| phosphoribosylamine--glycine ligase [Teredinibacter turnerae T7901]
          Length = 428

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 192/426 (45%), Positives = 268/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK AQS  + +++  PGN G A  A  + V ID+     ++ F 
Sbjct: 1   MKVLIIGSGGREHALAWKAAQSENVEKVFVAPGNAGTATEAKMENVPIDVMAFDELLKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  I+L +VGPE PLV+G+ D   AAG   FGP + AA+LE SKSF K F  ++ IPTA
Sbjct: 61  TDNAIELTIVGPEAPLVDGLVDKFTAAGLACFGPGKGAAQLEGSKSFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F++   A  Y++ K  PIV+KADGL AGKGV+VA  +  A +A+        F   
Sbjct: 121 DYQTFTNEQDALAYLRAKGAPIVIKADGLAAGKGVIVAEDLATAEAAVTDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DG+  +P  T++DHKR  DGD G NTGGMGA SPA  ++
Sbjct: 181 GCRVVIEEFLQGEEASFIVIADGENVLPMATSQDHKRAGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+Y  V+ ++I+PTI GM  E N + G L+AGLMIT +  P +IEYN RFGDPE Q +M
Sbjct: 241 AEVYQRVMDEVIMPTIRGMAAEGNSYTGFLYAGLMITADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++++  + +   L +    W    A+ VV+A  GYP  Y  G +IS + +  + 
Sbjct: 301 LRLKSDLVQLCQAALDKTLASHTTEWDDRPAVGVVLAAGGYPGSYRKGDVISGLGEGESA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT+  +  +  NGGRVL ATALG ++TE++  AY + ++IDW   Y R DI  
Sbjct: 361 DAKVFHAGTSEADGKVVTNGGRVLCATALGTSVTEAQRNAYVLAKHIDWNDVYMRTDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|77919825|ref|YP_357640.1| phosphoribosylamine--glycine ligase [Pelobacter carbinolicus DSM
           2380]
 gi|77545908|gb|ABA89470.1| phosphoribosylamine--glycine ligase [Pelobacter carbinolicus DSM
           2380]
          Length = 423

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 191/423 (45%), Positives = 276/423 (65%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHA+ WKIAQSPL+ E++  PGN GIA  A CV++ + +   ++ F Q+
Sbjct: 1   MKVLVIGSGGREHAMVWKIAQSPLVEEVFCAPGNAGIAGQATCVSLKVDDIDGLLAFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL VVGPELPL  G+ D   AAG  +FG ++ AA++E SKSF K    KYG+PTA+Y
Sbjct: 61  KQIDLTVVGPELPLTLGVVDRFRAAGLTIFGATRDAAQIEGSKSFCKDLMAKYGVPTASY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
             F+D  +A  +++ +  PIVVKADGL AGKGV++A TV++A +A      +  F    +
Sbjct: 121 GTFTDCDEAVAFIKQQGAPIVVKADGLAAGKGVILADTVEQAVAAVESILCEGAFGSAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E SF A  DG+  +P  +++DHK  +DGD GPNTGGMGA SPA  ++ E
Sbjct: 181 RVVIEEFLEGEEASFLAFTDGERIVPLASSQDHKAAYDGDTGPNTGGMGAYSPAPVVTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++  +I++++ PTI GM  E   +  +L+AGLMI +    ++E+N RFGDPE Q ++ RL
Sbjct: 241 IHDKIIEQVLKPTIAGMAAEGCAYSSILYAGLMIKDGELKVLEFNARFGDPETQPLLARL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SDI+ +L +C  G+L    + W  + A+ VV+A+ GYP +Y  G  I  +         
Sbjct: 301 KSDIVPVLLACARGDLSGVELEWHDKAAVCVVMASGGYPGDYAKGHAIDGLDAAAGIEDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT + ++++   GGRVL  T LG T+ E+ E AY  V+ I+WK  ++R DIG + 
Sbjct: 361 VVFHAGTTLQDDSIVTAGGRVLGVTGLGTTVAEAIERAYQGVKTINWKDVHYRSDIGRKA 420

Query: 414 KER 416
             R
Sbjct: 421 LNR 423


>gi|239995219|ref|ZP_04715743.1| Phosphoribosylamine-glycine ligase [Alteromonas macleodii ATCC
           27126]
          Length = 430

 Score =  343 bits (879), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 277/430 (64%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IG GGREHALA+K AQS  +S ++  PGN G A     + VAID+ + + ++ F 
Sbjct: 1   MNVLVIGGGGREHALAFKAAQSSDVSTVFVAPGNAGTATEPKLENVAIDVNDIAGLVSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   ++L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QGNDVELTIVGPEAPLVAGVVDAFTNAGLMIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+ K  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 EYQNFTEIDPAIAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAEDAIRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRAADGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           Q+++  ++Q++I+PT+ GM  E N + G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 QDIHDRIMQEVIMPTVNGMAAEGNDYVGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+SD++ +  +   G L    I +    ++ VV+A  GYP  Y  G +I+   +    
Sbjct: 301 LRLKSDLVPLCQAACKGELAGETIEFDERASVGVVLAAGGYPGSYDKGDVITGFEEAAKL 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATALG  +TE+++ AY +++ I +K  Y+R DI  
Sbjct: 361 DGKVFHAGTALQDGEVVTAGGRVLCATALGNNVTEAQQKAYELLKAIQFKDVYYRTDIAH 420

Query: 412 QKKERNVKYR 421
           +   R  + +
Sbjct: 421 RAIAREAEAK 430


>gi|82778819|ref|YP_405168.1| phosphoribosylamine--glycine ligase [Shigella dysenteriae Sd197]
 gi|81242967|gb|ABB63677.1| phosphoribosylglycinamide synthetase [Shigella dysenteriae Sd197]
          Length = 429

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 277/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDKRTSLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  +GGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTSGGRVLCVTALGHTVAEAQKCAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|168234403|ref|ZP_02659461.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194471203|ref|ZP_03077187.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194457567|gb|EDX46406.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205331662|gb|EDZ18426.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 429

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 280/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P ++  
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEDAA 360

Query: 352 TTQLFHAGTAIVNNN-LTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + + N +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADGNRVLTSGGRVLCATALGHTVAEAQKRAYALMIDIRWDGNFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|241663581|ref|YP_002981941.1| phosphoribosylamine--glycine ligase [Ralstonia pickettii 12D]
 gi|240865608|gb|ACS63269.1| phosphoribosylamine/glycine ligase [Ralstonia pickettii 12D]
          Length = 422

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 188/422 (44%), Positives = 263/422 (62%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V+++GSGGREHALAWK+A+SP +  ++  PGN G A   +   + I +   +  F + 
Sbjct: 1   MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNLPITDPEVLAAFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   VVGPE PL  GI D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGIHFTVVGPEAPLAAGIVDLFRAKGLRIFGPTKAAAQLESSKDFAKAFMHRHGIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           Q F D  +A  YV  +  PIV+KADGL AGKGVVVA T +EA SAID            +
Sbjct: 121 QTFGDAAQAHAYVDQEGAPIVIKADGLAAGKGVVVAMTAEEAHSAIDMMLADNRLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  +CDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVVCDGKNVVALATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           L++  +++IILPTI GM+K+  P+ G L+AGLMI  +  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARALREIILPTIRGMEKDGIPYTGFLYAGLMIDADGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           +++D+ ++L+  + G L    ++W    AL VV+A   YP+    G +I+ IP+ T  + 
Sbjct: 301 MKTDLYDVLDRAIDGKLDGMELDWDRRTALGVVMAAHNYPDTPRKGDVITGIPKETEDSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT NGGRVL    L  T+  ++  AY+ +E I +    +R DIG +  
Sbjct: 361 TFHAGTTLKDGVLTTNGGRVLCVVGLADTVKAAQRAAYNAIEQIHFDGAQYRTDIGHRAI 420

Query: 415 ER 416
             
Sbjct: 421 RH 422


>gi|198241778|ref|YP_002218091.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|197936294|gb|ACH73627.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|326625884|gb|EGE32229.1| phosphoribosylamine--glycine ligase [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 429

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 193/427 (45%), Positives = 279/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVDTVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ +A  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVNAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  +GGRVL ATALG T+ E+++ AY ++ +I W   + R DIG
Sbjct: 361 DGKVFHAGTKLADDDRVLTSGGRVLCATALGHTVAEAQKRAYALMTDIRWDGSFSRNDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|146342907|ref|YP_001207955.1| phosphoribosylamine--glycine ligase [Bradyrhizobium sp. ORS278]
 gi|146195713|emb|CAL79740.1| Phosphoribosylamine--glycine ligase (GARS) (Glycinamide
           ribonucleotide synthetase) (Phosphoribosylglycinamide
           synthetase) [Bradyrhizobium sp. ORS278]
          Length = 427

 Score =  342 bits (878), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 221/423 (52%), Positives = 291/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SPLL++LW  PGN GIA+ A+CVA+D  NH+ +I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAGSPLLTKLWCAPGNAGIAKEAECVALDTTNHADVIAFCRA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PL  GI D ++ AG K+FGP + AA+LE SK F K  C +YGIPT  Y
Sbjct: 61  NKVDLVVVGPETPLAAGIVDDVSGAGIKIFGPRKLAAQLEGSKGFTKDLCAEYGIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F +  +A  YV+    PIVVKADGL AGKGVVVA T+ EA  A+       F    + 
Sbjct: 121 SRFDNAPEALAYVREHGAPIVVKADGLAAGKGVVVARTLVEAEEAVRMMFDGGFGVAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+LEG EVSFFALCDG+TAIP  +A+DHKR+ D D GPNTGGMGA SP   ++QE+
Sbjct: 181 VVIEEFLEGREVSFFALCDGETAIPLASAQDHKRVFDHDQGPNTGGMGAYSPTPFVTQEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
           +  ++++IILPTI+GM     PF+G+L+AGLM+T +GP L EYNVRFGDPECQ +M+R+ 
Sbjct: 241 HDQIMKRIILPTIDGMNARGTPFKGILYAGLMLTAEGPKLFEYNVRFGDPECQVLMLRMM 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           SD++  + +   G L N  + W  + A+TVV+A +GYP +Y  G++I  +         +
Sbjct: 301 SDLVPAMLAACDGQLKNFDLRWFPDAAVTVVMAAEGYPGDYAKGSVIEGLDDAAKVDGVE 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT + + ++ ANGGRVL+  A GKTITE++  AY  V+ I W  G+ R DI  Q  
Sbjct: 361 IFHAGTVVKDGSIIANGGRVLNVCATGKTITEAQARAYEAVDRIRWTDGFCRRDIAWQAL 420

Query: 415 ERN 417
            + 
Sbjct: 421 AQE 423


>gi|319403920|emb|CBI77508.1| Phosphoribosylamine-glycine ligase [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 424

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 229/423 (54%), Positives = 291/423 (68%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA SPLL++L+  PGNP   +    + +DI +H +II+FC++
Sbjct: 1   MNVLLIGSGGREHALAWKIAASPLLTKLYCTPGNPATMEFGTNINLDINDHCSIINFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLVVVGPE PLV GI+DALNAA   VFGP+Q+AA+LE SK F K  C K  IPTA Y
Sbjct: 61  NTIDLVVVGPEAPLVGGITDALNAAHICVFGPNQKAAQLEGSKGFTKDLCYKNNIPTAPY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F + +KAK Y+  + +PIV+KADGL AGKGVVVA T++EA  AID C    F      
Sbjct: 121 QRFDNALKAKSYIHQQGIPIVIKADGLAAGKGVVVAMTMEEAFDAIDSCFEGTFGDAGKE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +LEG E SFF LCDGK AIPF +A+DHKRI DGD G NTGGMGA SPA  M++E+
Sbjct: 181 VVVEAFLEGEETSFFCLCDGKIAIPFGSAQDHKRIGDGDTGVNTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +Q+I+ P + G+ +    F+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLQEIVTPALRGLAEMDISFKGILFVGLMITQKGPQLIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL +  +   GNL   ++ W  E ALTVV+A  GYP     G++I  I +       +
Sbjct: 301 DDILPLFLAAAQGNLEKKNLQWSEETALTVVMAANGYPVSPQKGSVIRNIDKVNSLPNVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L AN GRVL+ TA GKTI  +++ AY  VE IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALCNGELIANSGRVLNITATGKTIKIAQKRAYEAVECIDWPEGFVRRDIGWRAI 420

Query: 415 ERN 417
            R 
Sbjct: 421 MRE 423


>gi|78224100|ref|YP_385847.1| phosphoribosylamine--glycine ligase [Geobacter metallireducens
           GS-15]
 gi|78195355|gb|ABB33122.1| phosphoribosylamine--glycine ligase [Geobacter metallireducens
           GS-15]
          Length = 423

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 185/423 (43%), Positives = 265/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHAL WKIAQSPL+ +++  PGNPGI   A+ V + + +   ++ F +E
Sbjct: 1   MKVLVVGGGGREHALVWKIAQSPLVGKVYCAPGNPGIGALAENVPLTVDDLPGLLAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K I L VVGPELPL  GI D     G  VFG  + AA +E+SK+F+K    KYG+PTA Y
Sbjct: 61  KEIGLTVVGPELPLSLGIVDLFEEHGLLVFGARRNAAIIEASKAFSKDLMKKYGVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F++   A  ++    +PIV+KADGL AGKGV++A + DEA + ++       F    S
Sbjct: 121 DVFTEVDPAVAFIDKVGVPIVIKADGLAAGKGVIIAQSRDEAVATVNDMLSGNAFGSAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF A  DGK  IP  +A+DHK + DGD GPNTGGMGA SPA  ++Q 
Sbjct: 181 RVVIEEFLVGEEASFLAFTDGKQIIPLASAQDHKAVFDGDQGPNTGGMGAYSPAPVVTQT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   + +++  T++GM  E  P++GVL+AGLMI      ++E+N RFGDPECQ ++MR+
Sbjct: 241 IHDFAMAEVMRRTVDGMAAEGRPYRGVLYAGLMINGSDVKVLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SDI+ +L     G+L    I W  + A+ VV+A +GYP +Y  G  I  + +       
Sbjct: 301 KSDIVPVLLGVARGDLSGVAIEWHDKAAVCVVMAAEGYPADYRKGDEIRGLDEAAAIDDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA  +  +   GGRVL  T LG T+ ++ + AY  V  I W+  ++R+DIG + 
Sbjct: 361 YVFHAGTAAGDGKIVTAGGRVLGVTGLGATVKDAIDRAYRGVAKICWEGVHFRKDIGAKA 420

Query: 414 KER 416
            +R
Sbjct: 421 LKR 423


>gi|260589122|ref|ZP_05855035.1| phosphoribosylamine--glycine ligase [Blautia hansenii DSM 20583]
 gi|331082538|ref|ZP_08331663.1| phosphoribosylamine-glycine ligase [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260540542|gb|EEX21111.1| phosphoribosylamine--glycine ligase [Blautia hansenii DSM 20583]
 gi|330400516|gb|EGG80146.1| phosphoribosylamine-glycine ligase [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 424

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 177/423 (41%), Positives = 258/423 (60%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHA+AWK+A+SP + +++  PGN GIA+ A+CV I       +  F +E
Sbjct: 1   MKVLIIGSGGREHAIAWKVAKSPKVDKIYCAPGNAGIAEFAECVPIGAMEFEKLAAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DL VVG + PLV G+ D     G +VFGP + AA LE SK+F+K    KY IPTA Y
Sbjct: 61  NAVDLTVVGMDDPLVGGVVDVFEKEGLRVFGPRKNAAILEGSKAFSKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQY-VQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQIN 174
           ++F D  +A  Y  +    PIV+KADGL  GKGV++  T++EA   +             
Sbjct: 121 ENFEDADEALAYLREKAEFPIVLKADGLALGKGVLICNTLEEAEEGVCTIMLDKKFGSAG 180

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           +T++IEE++ G EVS  +  DGKT    T+A+DHKR  DGD G NTGGMG  SP+   ++
Sbjct: 181 NTLVIEEFMTGREVSVLSFVDGKTIKTMTSAQDHKRAKDGDEGLNTGGMGTFSPSPFYTK 240

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
           E+     + +   T++ M  E   F+G++F GLM+TE+GP ++EYN RFGDPE Q ++ R
Sbjct: 241 EVDEFCEKYVYQATVDAMAAEGREFKGIIFFGLMLTEKGPKVLEYNARFGDPEAQVVIPR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGT 352
           L++DI+E+  +CV G L    + ++   A+ VV+A+ GYP  Y  G  I  +   ++   
Sbjct: 301 LKNDIVEVFEACVDGKLDEIDLQFEDNAAVCVVLASDGYPVSYEKGYPIEGLENFKDKDG 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
             +FHAGTA  +  +  NGGRVL  TA G  + E+R  AY   + I++++ Y R DIG +
Sbjct: 361 YYVFHAGTAFKDGKIVTNGGRVLGVTAKGADLKEARANAYEATKWINFENKYMRNDIG-K 419

Query: 413 KKE 415
             +
Sbjct: 420 AID 422


>gi|254284327|ref|ZP_04959295.1| phosphoribosylamine--glycine ligase [gamma proteobacterium NOR51-B]
 gi|219680530|gb|EED36879.1| phosphoribosylamine--glycine ligase [gamma proteobacterium NOR51-B]
          Length = 428

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 193/425 (45%), Positives = 266/425 (62%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+V++IG+GGREHALAWK+AQS  + +++ +PGN G A  A  Q + +D+ + +AI  F 
Sbjct: 1   MKVMVIGNGGREHALAWKLAQSASVEQVFVVPGNAGTAMEAGLQNIDLDVMDFAAIADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
               I L VVGPE PLV GI D   A     FGPS+ AA+LE SK+F K F  ++ IPT 
Sbjct: 61  STNGIGLTVVGPEAPLVEGIVDYFTARKLPCFGPSKGAAQLEGSKAFTKDFLARHKIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F++  KA  Y++ +  PIV+KADGL AGKGV+VA ++  A +A++       F   
Sbjct: 121 FYQTFTEVDKALAYIREQGAPIVIKADGLAAGKGVIVAESLPVAEAAVEDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DG+  +P  T++DHKRI +GD GPNTGGMGA SPA  +S
Sbjct: 181 GCRVVIEEFLPGEEASFIVMVDGEHILPMATSQDHKRIGEGDTGPNTGGMGAYSPAPVVS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+++II PT+ GM  E N + G L+AGLMI +Q  P +IEYN RFGDPE Q +M
Sbjct: 241 DEIFQRVMERIIEPTVRGMASEGNAYCGFLYAGLMIDDQGNPRVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD   +  + + G L      W    A+ VV+A++GYP  Y  G  I+ +      
Sbjct: 301 LRLKSDFAGLCQAALSGALDTVDAEWDPRPAIGVVLASQGYPGTYAKGMAIAGLDSPFGD 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            T++FHAGTA    +   +GGRVL  TALG T+ E++ LAY  V+ I W+    R DIG 
Sbjct: 361 DTKVFHAGTAEQAGHCVTSGGRVLCVTALGNTVAEAQALAYRGVDKIAWEGMTCRRDIGW 420

Query: 412 QKKER 416
           +  ER
Sbjct: 421 RAVER 425


>gi|158521438|ref|YP_001529308.1| phosphoribosylamine--glycine ligase [Desulfococcus oleovorans Hxd3]
 gi|158510264|gb|ABW67231.1| phosphoribosylamine--glycine ligase [Desulfococcus oleovorans Hxd3]
          Length = 591

 Score =  342 bits (878), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 186/427 (43%), Positives = 255/427 (59%), Gaps = 7/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHAL WKIAQSP + +++  PGN GIA  A  V I   +   ++ F  E
Sbjct: 1   MKVLVIGSGGREHALVWKIAQSPKVDKIFCAPGNAGIAPLAASVPIKADDVDGLLEFAAE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI D   AAG KVFG  + AA+LE+SK +AK+   KY IPTA  
Sbjct: 61  EQIDLTVVGPEAPLSLGIVDRFEAAGLKVFGAGRDAARLETSKGYAKEILLKYNIPTARG 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
           + F D  +A  Y++     +VVKADGL AGKGV V  +  +          DR F    +
Sbjct: 121 RCFDDYDEALAYLKELGGAVVVKADGLAAGKGVFVCNSEKQAADALRQIMKDRLFGDAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE LEG E SF AL DG+T +P   ++DHK + DGD GPNTGGMGA SPA  + + 
Sbjct: 181 RVVIEERLEGEEASFIALTDGETVLPMPCSQDHKAVGDGDTGPNTGGMGAYSPAPVVDEY 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L+  +++ +++ T++ M  E   ++GVL+AGLMI+     ++E+N RFGDPE Q ++MR+
Sbjct: 241 LHRKIMETVMVATVKAMAAEGVRYRGVLYAGLMISGGNVRVLEFNARFGDPEAQPLLMRV 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           ++DI+ +L +     LH   +      A+ VV+A+ GYP  Y  G  IS +         
Sbjct: 301 KNDIVPVLEAVCENRLHEHTLEIDDRAAVCVVMASGGYPGAYKKGMAISGLSNVNRMKDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
             FHAGT      +  +GGRVL  TALGKT+ ++   AY  V  I W+  Y R DIG + 
Sbjct: 361 VAFHAGTRAKGKKVVTDGGRVLGVTALGKTVEDAIRRAYEAVAKISWEGAYHRNDIGHKA 420

Query: 414 KERNVKY 420
            +R V+ 
Sbjct: 421 LKRLVEK 427


>gi|254449289|ref|ZP_05062735.1| phosphoribosylamine--glycine ligase [gamma proteobacterium
           HTCC5015]
 gi|198261098|gb|EDY85397.1| phosphoribosylamine--glycine ligase [gamma proteobacterium
           HTCC5015]
          Length = 430

 Score =  342 bits (877), Expect = 5e-92,   Method: Composition-based stats.
 Identities = 180/427 (42%), Positives = 267/427 (62%), Gaps = 10/427 (2%)

Query: 1   MR-VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHF 57
           M+ VL+IG GGREHALAWK AQSP +  ++  PGN G A+    + VAI  ++   ++ F
Sbjct: 1   MKSVLVIGGGGREHALAWKAAQSPQVDTVYVAPGNAGTAREHNIENVAIAAEDIDGLLAF 60

Query: 58  CQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPT 117
            Q+  IDL +VGPE PLV G+ D    AG ++FGP+  AA+LE SK+F+K F  ++ IPT
Sbjct: 61  AQDTGIDLTIVGPEAPLVAGVVDRFRNAGLRIFGPTAEAAQLEGSKAFSKDFLARHQIPT 120

Query: 118 ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQ 172
           A YQ+F++   A  Y+     PIVVKADGL AGKGV++A T+++A  A+        F +
Sbjct: 121 ARYQNFTEIDPALDYIDQMGAPIVVKADGLAAGKGVIIAETIEQAKDAVRDMLAGNAFGE 180

Query: 173 INSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGM 232
               V+IEE+L+G E SF  + DG   +P  +++DHK   +GD+GPNTGGMGA SPA  +
Sbjct: 181 AGHRVVIEEFLQGEEASFIVMVDGDQVLPMASSQDHKARDNGDLGPNTGGMGAYSPAPVV 240

Query: 233 SQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAM 291
           + EL+  ++ ++I PT++GM  +   + G L+AG+M+  +  P ++E+N RFGDPE Q +
Sbjct: 241 TDELHQRIMDEVIRPTVQGMISDGIRYTGFLYAGIMMEADGTPKVLEFNCRFGDPETQPI 300

Query: 292 MMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NT 350
           MMRL+SD++ +  + + G L  +  +W    AL VV+A  GYP  Y  G +IS + + + 
Sbjct: 301 MMRLQSDLVALCEAALDGQLDQSTAHWDPRCALGVVLAAGGYPASYRKGDVISGLDRVDA 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
              ++FHAGT +  +    +GGRVL    LG T++ ++E AY  V+ I W   Y+R DIG
Sbjct: 361 EDAKVFHAGTQLDGDQALTSGGRVLCMVGLGNTVSAAQERAYQGVKTIQWDDVYYRTDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 HRAIARE 427


>gi|121604634|ref|YP_981963.1| phosphoribosylamine--glycine ligase [Polaromonas naphthalenivorans
           CJ2]
 gi|120593603|gb|ABM37042.1| phosphoribosylamine--glycine ligase [Polaromonas naphthalenivorans
           CJ2]
          Length = 430

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 187/429 (43%), Positives = 265/429 (61%), Gaps = 14/429 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHALAWK++QSP +  ++  PGN G A  A+   I+I +  A+  +   
Sbjct: 1   MKVLVVGGGGREHALAWKLSQSPKVQAVYVAPGNGGTALDARLENINITDVQALRAWAAT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  GI D     G +VFGP++ AA+LESSK+F+K F  ++ IPTA Y
Sbjct: 61  EKIALTVVGPEQPLAAGIVDEFRKHGLRVFGPTKAAAQLESSKAFSKAFMKRHHIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D   A  Y+  K  PIVVKADGL AGKGVVVA T+ EA  AI+             
Sbjct: 121 ETFTDAAAAHAYIDEKGAPIVVKADGLAAGKGVVVAMTLHEAHEAIEFMLAPDPEFNPLG 180

Query: 177 ---------VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACS 227
                    V+IEE+L+G E SF  +CDGK      T++DHKR+ DGD+GPNTGGMGA S
Sbjct: 181 VTHNEGGARVVIEEFLQGEEASFIVMCDGKNVAAMATSQDHKRLLDGDLGPNTGGMGAYS 240

Query: 228 PALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDP 286
           PA  ++ ++++  +++IILPTI+GM+K+  PF G L+AGLMI     P  +E+N R GDP
Sbjct: 241 PAPVVTPDVHARAMREIILPTIKGMEKDGIPFTGFLYAGLMIDAHGKPKTLEFNCRMGDP 300

Query: 287 ECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI 346
           E Q +MMRL++D+ +++ +   G L    + W    AL VV+A  GYP     G  I  +
Sbjct: 301 ETQPIMMRLKTDLFDVMMAATSGALDKIELEWDRRPALGVVMAAHGYPLHPRKGDAIHGL 360

Query: 347 PQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
           P  T    +FHAGT   + ++  +GGRVL  TALG T+  +++ AY +  +I++    +R
Sbjct: 361 PLATEDAMVFHAGTQRQDGSIVTSGGRVLCVTALGGTVKAAQQRAYEVARSIEFDGAQYR 420

Query: 407 EDIGLQKKE 415
           +DIG +  +
Sbjct: 421 KDIGYRAIK 429


>gi|295095111|emb|CBK84201.1| phosphoribosylamine--glycine ligase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 430

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 192/427 (44%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPQVETVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q ++IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNENIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ + D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   + +II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++++  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVDLCLAACEGKLDEKTSEWDERASLGVVIAAGGYPGSYNTGDEIHGLPLEEID 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  NGGRVL ATALG+T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GAKVFHAGTKLSDDDRVLTNGGRVLCATALGQTVAEAQKRAYALMADIHWNGSFSRQDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|292486749|ref|YP_003529619.1| phosphoribosylamine-glycine ligase [Erwinia amylovora CFBP1430]
 gi|292897980|ref|YP_003537349.1| phosphoribosylglycineamide synthetase [Erwinia amylovora ATCC
           49946]
 gi|291197828|emb|CBJ44923.1| phosphoribosylglycineamide synthetase [Erwinia amylovora ATCC
           49946]
 gi|291552166|emb|CBA19203.1| phosphoribosylamine-glycine ligase [Erwinia amylovora CFBP1430]
          Length = 426

 Score =  342 bits (877), Expect = 6e-92,   Method: Composition-based stats.
 Identities = 188/425 (44%), Positives = 269/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG+GGREHALAWK AQSPL   ++  PGN G A       VAI   +   +++F 
Sbjct: 1   MKILVIGNGGREHALAWKAAQSPLADRVFVAPGNAGTALEPALHNVAISPTDIQGLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             ++IDL +VGPE PLV G+ DA  +AG K+FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  LNENIDLTIVGPEAPLVIGVVDAFRSAGLKIFGPTQAAAQLEGSKAFTKDFLARHQIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+    A  YV+ K  PIV+KADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYQNFTAVEPALAYVREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAIQHMLAGNAFGNA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             ++  V+ ++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 241 DVIHQRVMDEVIWPTVRGMAAEGNVYTGFLYAGLMIDKSGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +RL+SD++++  + V G L   +  W    +L VV+A  GYP +Y +G  I  +P +   
Sbjct: 301 LRLQSDLVDLCLAAVEGKLDQKNSVWDPRPSLGVVLAAGGYPGDYINGEQIHGLPVEEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + +  +  +GGRVL  TALG+ +  ++  AY + + I W   + R DIG 
Sbjct: 361 DGKVFHAGTTLQDGLVVTSGGRVLCVTALGEDVAAAQRRAYQLAKPIYWNGSFCRSDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIDR 425


>gi|325292029|ref|YP_004277893.1| phosphoribosylamine-glycine ligase [Agrobacterium sp. H13-3]
 gi|325059882|gb|ADY63573.1| phosphoribosylamine-glycine ligase [Agrobacterium sp. H13-3]
          Length = 423

 Score =  342 bits (877), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 234/421 (55%), Positives = 294/421 (69%), Gaps = 4/421 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VLLIGSGGREHALAWKIAQSPLL EL++ PGNPGIA HA  V++D+++H+A+I F +E
Sbjct: 1   MKVLLIGSGGREHALAWKIAQSPLLDELYAAPGNPGIADHATVVSLDVEDHAAVIAFARE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID VVVGPE PLV G++D L AA    FGPS+ AA+LE SK F K  C +Y IPT  Y
Sbjct: 61  KAIDFVVVGPEAPLVAGLADDLRAADIATFGPSKAAAQLEGSKGFTKDLCARYDIPTGAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF----QQINST 176
           Q F     AKQYV+ +  PIV+KADGL AGKGV VA +  EA +AID CF        + 
Sbjct: 121 QRFKTAEPAKQYVREQGAPIVIKADGLAAGKGVTVAMSEAEALAAIDDCFDGAFGAAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++E +L+G E SFF L DGKTA+   TA+DHKR+ DGD GPNTGGMGA SPA  M+  +
Sbjct: 181 VVVEAFLDGEEASFFCLSDGKTALALATAQDHKRVGDGDTGPNTGGMGAYSPAPVMTPAM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++II PTI GM K+ NPF GV FAGLMIT +GP LIEYNVRFGDPECQ +MMRL+
Sbjct: 241 VERTMKEIIEPTISGMAKDGNPFSGVFFAGLMITAKGPELIEYNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD+L IL +   G L      W+ + ALTVV+A+KGYP  Y   T I+ IP  +   ++F
Sbjct: 301 SDLLPILYATATGTLDKVKAEWRDDAALTVVLASKGYPGAYDKNTPIAHIPDASEEAKVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           HAGTA+ +  L A GGRVL+ TA GK +TE++  AY +   ++W++G+ R DIG Q   R
Sbjct: 361 HAGTALKDGRLVATGGRVLNVTAFGKNVTEAQARAYALAAKVEWENGFCRRDIGWQAVAR 420

Query: 417 N 417
            
Sbjct: 421 E 421


>gi|268593007|ref|ZP_06127228.1| phosphoribosylamine--glycine ligase [Providencia rettgeri DSM 1131]
 gi|291311480|gb|EFE51933.1| phosphoribosylamine--glycine ligase [Providencia rettgeri DSM 1131]
          Length = 427

 Score =  342 bits (877), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 189/425 (44%), Positives = 266/425 (62%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG GGREHALAWK AQSPL  +++  PGN G A     + V I   +   ++ F 
Sbjct: 1   MNILIIGGGGREHALAWKAAQSPLADKVYVAPGNAGTALEPSLENVNISATDIDGLLQFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK I L +VGPE PLV G+ DA  AAG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKQIGLTIVGPEAPLVIGVVDAFKAAGLTIFGPTKGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F+D   A  Y+     PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 AYENFTDIEPALAYLDKVGAPIVIKADGLAAGKGVIVAMTLQEAKEAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  IP  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGENVIPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V++++I PT++GM +E N +QG L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMEQVIYPTVKGMDQEGNRYQGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL+SD++ +  +   G L      W    AL VV+A  GYP +Y +G +IS +P     
Sbjct: 301 MRLQSDLVALCLAGAKGELAGKDSLWDERPALGVVIAAGGYPGDYHNGDVISGLPTTEAA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            +++FHAGT + +  +   GGRVL  TAL   I +++  AY + + I W   ++R DIG 
Sbjct: 361 DSKVFHAGTRMKDGEVVTAGGRVLCVTALDNDIAKAQAKAYEVAKTIHWNDSFYRNDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|197119819|ref|YP_002140246.1| phosphoribosylamine--glycine ligase [Geobacter bemidjiensis Bem]
 gi|197089179|gb|ACH40450.1| phosphoribosylamine--glycine ligase [Geobacter bemidjiensis Bem]
          Length = 423

 Score =  342 bits (877), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 187/423 (44%), Positives = 265/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WKIAQSPL+S+++  PGNPG A  AQ V I + N   ++ F ++
Sbjct: 1   MKVLVVGSGGREHALVWKIAQSPLVSQVFCAPGNPGTATLAQNVDIAVDNLQGLLDFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + + L VVGPELPL  G+ D     G K FG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  EGVALTVVGPELPLSMGLVDLFEENGLKAFGARKNAAIIEASKAFSKDLMHKYNVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F++   A  ++    +PIV+KADGL AGKGV++A T DEA +A+        F    S
Sbjct: 121 GVFTEVEPAVSFIDQTGIPIVIKADGLAAGKGVIIAQTRDEAVAAVTDMLSGNAFGAAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF A  DG+  IP  +A+DHK + DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLKGEEASFLAFTDGERIIPLASAQDHKAVFDGDQGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   + +++  T++GM+ E   ++GVL+AGLMI       +E+N RFGDPECQ ++MR+
Sbjct: 241 IHDKAMAEVMRRTVDGMKAEGRTYRGVLYAGLMIDGGSVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TGTT 353
           +SDI+ IL +   G+L    I W  + A+ VV+A +GYP +Y  G +I  +         
Sbjct: 301 KSDIVPILMAVASGSLEGVEIEWHDKAAVCVVMAAEGYPADYRKGDVIGGLDAAGKIEDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT      +  +GGRVL  TALG T+ E+ E AY  V+ I W   ++R+DIG + 
Sbjct: 361 VVFHAGTKAAGEGVVTSGGRVLGVTALGGTVKEAIERAYKGVKEITWPGVHYRKDIGAKA 420

Query: 414 KER 416
             R
Sbjct: 421 MNR 423


>gi|332171894|gb|AEE21148.1| phosphoribosylamine/glycine ligase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 429

 Score =  342 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 195/428 (45%), Positives = 278/428 (64%), Gaps = 11/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHAL +K AQS  +S ++  PGN G A     + V ID++   A++ F 
Sbjct: 1   MKVLIIGGGGREHALGFKAAQSDSVSHVYVAPGNAGTALEPKLENVPIDVEEIEALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  ++L +VGPE+PLV G+ DA  A G  +FGPS+ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KQNAVELTIVGPEVPLVLGVVDAFQAEGLAIFGPSKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTEIEPAIAYLQEKGAPIVIKADGLAAGKGVIVAMTLAEAEEAVRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+EGM  E N + G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 DEIHQRVMNEVIYPTVEGMASEGNDYHGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI---PQN 349
           +RL+SD++E++   V G L      +    A+ VV+A  GYP+ Y  G +IS +      
Sbjct: 301 LRLQSDLVELIQLAVAGKLDQATAQFDPRAAVGVVLAAGGYPQAYNKGDVISGLSLSDSA 360

Query: 350 TGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
             + ++FHAGT  V+  +T NGGRVL ATALG+T+T++++ AY +   I W+  ++R+DI
Sbjct: 361 DASAKVFHAGTKEVDGQVTTNGGRVLCATALGETVTQAQQRAYELANTISWEGMFYRDDI 420

Query: 410 GLQKKERN 417
             +   R 
Sbjct: 421 AYRAIARE 428


>gi|83648652|ref|YP_437087.1| phosphoribosylamine--glycine ligase [Hahella chejuensis KCTC 2396]
 gi|83636695|gb|ABC32662.1| Phosphoribosylamine-glycine ligase [Hahella chejuensis KCTC 2396]
          Length = 432

 Score =  342 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 192/432 (44%), Positives = 275/432 (63%), Gaps = 9/432 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK AQ+  +  ++  PGN G A     + VAID+ +  A+I F 
Sbjct: 1   MNVLVIGSGGREHALAWKAAQADYVKTVFVAPGNAGTALEPKLENVAIDVLDFDALIAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ H++L +VGPE PLV G+ +   A G ++FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KDNHVELTIVGPEAPLVEGVVNRFQAEGLRIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F++   A  Y++ +  PIVVKADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 AYQSFTEIEPALAYLREQGAPIVVKADGLAAGKGVIVAMTLGEAEDAVRDMLADAKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+LEG E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLEGEEASFIVMVDGKHMLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
             ++  +++++I PT++GM +E N + G L+AGLMI+ +  P +IEYN RFGDPE Q +M
Sbjct: 241 DSVHERIMREVIYPTVQGMAQEGNDYVGFLYAGLMISADGAPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MR++SD++++  +   G L +   +W    A+ +V+A  GYP+ Y  G  IS +      
Sbjct: 301 MRMQSDLVDLCIAATQGALDSKTSDWDPRAAVGIVLAAGGYPDSYAKGAAISGLENADRA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + +  +  +GGRVL ATALG  +TE++  AY  V  IDW+  Y+R+DI  
Sbjct: 361 DAKVFHAGTLMRDGQVVTHGGRVLCATALGVDVTEAQRKAYEQVARIDWQDMYYRKDIAY 420

Query: 412 QKKERNVKYRNK 423
           +   R     N 
Sbjct: 421 RAIAREQAGENA 432


>gi|224368044|ref|YP_002602207.1| PurD [Desulfobacterium autotrophicum HRM2]
 gi|223690760|gb|ACN14043.1| PurD [Desulfobacterium autotrophicum HRM2]
          Length = 587

 Score =  342 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 187/422 (44%), Positives = 266/422 (63%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHAL WKI+QS ++ +++  PGN G  Q+A+ +AI   +  A+  F +E
Sbjct: 1   MKILVVGSGGREHALTWKISQSTMVDKIYCAPGNAGTTQYAENLAIKADDIEALGLFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DL VVGPE+PL  GI D   + G + FGP+++AA+LE+SK FAK    KY IPTA  
Sbjct: 61  NGVDLTVVGPEVPLSMGIVDHFESMGLRAFGPNKKAAQLEASKIFAKNLMNKYNIPTAQG 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F++  KAK YV+    P+VVKADGL AGKGV V AT  EA         +  F    +
Sbjct: 121 RSFNNIDKAKNYVKQIGAPVVVKADGLAAGKGVFVCATEAEANQALDSLINENLFGDAGT 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE L+G E SF AL DGKT +   +++DHKRI D D GPNTGGMGA SPA  +   
Sbjct: 181 LVVVEECLQGEEASFIALTDGKTVLALPSSQDHKRIFDNDEGPNTGGMGAYSPAPVLDFM 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    + ++++P ++GM  E   F+GVL+AGLMI +    ++E+N R GDPE Q ++MRL
Sbjct: 241 LRQKAMDEVMVPAVQGMAAEGCLFKGVLYAGLMIHKDQIKVLEFNARMGDPETQPILMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQ 354
           +SD++ ++ +CV G L            L VV+A +GYP +Y  G +I+ I Q     T+
Sbjct: 301 KSDLVPLMEACVDGGLDRYKAEIDPRSTLCVVMAAQGYPGDYGKGGVITGIDQAETADTK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA+   ++ A GGRVL  TALG T+ +++E AY     I W   ++R+DIG +  
Sbjct: 361 VFHAGTALKGKDVVAAGGRVLGVTALGDTVHQAQERAYAACAKISWDAAFYRKDIGAKAI 420

Query: 415 ER 416
            R
Sbjct: 421 AR 422


>gi|107103954|ref|ZP_01367872.1| hypothetical protein PaerPA_01005025 [Pseudomonas aeruginosa PACS2]
 gi|254238423|ref|ZP_04931746.1| phosphoribosylamine-glycine ligase [Pseudomonas aeruginosa C3719]
 gi|126170354|gb|EAZ55865.1| phosphoribosylamine-glycine ligase [Pseudomonas aeruginosa C3719]
          Length = 429

 Score =  342 bits (876), Expect = 7e-92,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 271/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P +++++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVAKVFVAPGNAGTATEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  + L +VGPE PLV G+ D     G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  AKN-VQLTIVGPEAPLVAGVVDLFRERGLDIFGPTAGAAQLEGSKAFTKDFLARHRIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y++ +  PIV+KADGL AGKGV+VA  +DEA +A+        F   
Sbjct: 120 AYRNFTEVEPALAYLREQGAPIVIKADGLAAGKGVIVAMNLDEAEAAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGQNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVLDEVIYPTVRGMAEEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  + +    
Sbjct: 300 VRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGEVIEGLAEAAAL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G++++ +++ AY + E I W   ++R+DIG 
Sbjct: 360 DGKVFHAGTALKDGQVVTSGGRVLCATAIGESVSAAQQQAYRLAEKIRWNGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|331269936|ref|YP_004396428.1| phosphoribosylformylglycinamidine synthase [Clostridium botulinum
           BKT015925]
 gi|329126486|gb|AEB76431.1| phosphoribosylformylglycinamidine synthase [Clostridium botulinum
           BKT015925]
          Length = 1664

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 177/421 (42%), Positives = 272/421 (64%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHA+ WK++QS L+ +++  PGN G ++  +C  I+++    +++F ++
Sbjct: 1   MKILVVGSGGREHAIVWKVSQSALVDKIYCAPGNGGTSKENKCENINLEEIEDLLNFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++IDL +VGPE+ LV+GI D       K+FGPS+ A+KLE SKSFAKKF  KY + TA Y
Sbjct: 61  ENIDLTIVGPEVSLVDGIVDRFKENNLKIFGPSKEASKLEGSKSFAKKFMKKYCVKTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F D  +A +Y++N S P V+KADGL AGKGVV+  T +EA  AI+        +    
Sbjct: 121 EVFEDVKEAVKYLENCSYPTVIKADGLAAGKGVVICKTKEEAKKAIENFMIKDVLKGSGL 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+LEG E S  ++ DGKT IPF +++DHK+I DGD GPNTGGMG   P    + +
Sbjct: 181 KIVIEEFLEGVEASILSITDGKTIIPFISSKDHKQIFDGDKGPNTGGMGVIVPNFYCTDK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     ++I+ PT++G+Q+E   + G +F G+MIT++G YL+EYNVR GDPE Q ++  +
Sbjct: 241 VLEEFNEEILKPTLKGIQEEDMDYIGTIFFGIMITKKGVYLLEYNVRMGDPETQGVLSLM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD LE++   +   L N  + WK  +   +   +KGYP  Y  G  I+ +      +++
Sbjct: 301 DSDYLELMLKALDKELKNYDVKWKNGHICCITAVSKGYPGSYEKGFEITGLNNT--DSKV 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           F AG    N  L ++GGRVL+  A GKT+ ++++ AY  +E ID+   Y+R DIG +K +
Sbjct: 359 FIAGAKEENEKLVSDGGRVLNVVAFGKTLDDAKKKAYKDIEKIDFDGMYYRHDIGNRKVK 418

Query: 416 R 416
           R
Sbjct: 419 R 419


>gi|300721654|ref|YP_003710929.1| phosphoribosylglycinamide synthetase [Xenorhabdus nematophila ATCC
           19061]
 gi|297628146|emb|CBJ88697.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 427

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 198/425 (46%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL S+++  PGN G A     + V I   +   ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLASKVFVAPGNAGTALETNLENVDIAATDIEGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE+PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEVPLVIGVVDAFQQAGLTIFGPTKAAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
           TYQ+F++   A  Y++   +PIV+KADGL AGKGVVVA T++EA  A+        F   
Sbjct: 121 TYQNFTEIDPALAYLEKTGVPIVIKADGLAAGKGVVVAMTMEEAQGAVKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLAGEEASFIVMVDGKNVVPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V++KII PT+EGM  E + + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMEKIIYPTVEGMAAEGHTYTGFLYAGLMIDQQGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           MRL SD++E+  +   G L     +W +  AL +V+A  GYP  Y  G +IS + ++T  
Sbjct: 301 MRLRSDLVELCLAGAKGKLGGKTSSWDSRPALGIVLAAGGYPANYAKGDVISGLAEDTNI 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTAI +  +   GGRVL  TALG  I E++  AY   E+I W+  ++R+DIG 
Sbjct: 361 DEKIFHAGTAIKDETVVTAGGRVLCVTALGNNIAEAQRKAYQRAEHISWEKCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|226942840|ref|YP_002797913.1| phosphoribosylamine--glycine ligase [Azotobacter vinelandii DJ]
 gi|226717767|gb|ACO76938.1| Phosphoribosylglycinamide synthetase [Azotobacter vinelandii DJ]
          Length = 426

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 184/426 (43%), Positives = 269/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ   + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDARVEKVFVAPGNAGTATEAKCENVAIDVLALEELADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE PLV G+ D   A G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKH-VQLTIVGPEAPLVKGVVDLFRARGLDIFGPTAGAAQLEGSKAFTKDFLARHDIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y++ +  PIVVKADGL AGKGV+VA T++EA +A+        F   
Sbjct: 120 AYRNFTEVEPALAYLRERGAPIVVKADGLAAGKGVIVATTLEEAEAAVRDMLSGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GARVVIEEFLDGEEASFIVMVDGQNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 PEVHRRVMDEIIHPTVRGMAAEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  +      
Sbjct: 300 LRLESSLVLLVEAALARALDKVEARWDPRPTVGVVLAAGGYPGDYAKGDVIEGLDDAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G +++ +++ AY + E I W   ++R+DIG 
Sbjct: 360 DGKVFHAGTALKDGRIVTSGGRVLCATAIGPSVSSAQQQAYRLAEKIRWSGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|317494898|ref|ZP_07953308.1| phosphoribosylamine-glycine ligase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917086|gb|EFV38435.1| phosphoribosylamine-glycine ligase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 427

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 197/425 (46%), Positives = 279/425 (65%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++  PGN G A     + V I   + S ++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENVDISATDISGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +   I L +VGPE PLV G+ DA  A G K+FGPSQ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KSHDIGLTIVGPEAPLVIGVVDAFQAEGLKIFGPSQAAAQLEGSKAFTKDFLARHRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F+D   A  Y++++  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYRNFTDIEPAISYIRSQGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+LEG E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLEGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM KE NP+ G L+AGLMI+ Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDEVIWPTVHGMAKEGNPYSGFLYAGLMISAQGHPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+     W    AL VV+A  GYPE Y  G +I  +P N+  
Sbjct: 301 LRMRSDLVELCLAGAEGKLNEKESLWDERDALGVVLAAGGYPESYRTGDVIHGLPINSPE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +V +++   GGRVL ATALG  I ++++ AY + E I W+  ++R+DIG 
Sbjct: 361 GEKVFHAGTQLVGSDVVTQGGRVLCATALGHGIKQAQQNAYQLAEQISWEGSFYRKDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RAIQR 425


>gi|70734167|ref|YP_257807.1| phosphoribosylamine--glycine ligase [Pseudomonas fluorescens Pf-5]
 gi|68348466|gb|AAY96072.1| phosphoribosylamine--glycine ligase [Pseudomonas fluorescens Pf-5]
          Length = 429

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 186/426 (43%), Positives = 269/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QKN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEEAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 SEVHQRVMDLVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G  I+ +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKVEAQWDPRPSLGIVLAAGGYPGDYAKGAAITGLDAAAAL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G ++  +++ AY +   IDW+  ++R+DIG 
Sbjct: 360 EGKVFHAGTALKDGQVVTSGGRVLCATAMGDSVDAAQQQAYRLAAEIDWQGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|15600048|ref|NP_253542.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa PAO1]
 gi|218893949|ref|YP_002442818.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa LESB58]
 gi|254244247|ref|ZP_04937569.1| phosphoribosylamine-glycine ligase [Pseudomonas aeruginosa 2192]
 gi|20139739|sp|Q9HUV8|PUR2_PSEAE RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|9951127|gb|AAG08240.1|AE004899_1 phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa PAO1]
 gi|126197625|gb|EAZ61688.1| phosphoribosylamine-glycine ligase [Pseudomonas aeruginosa 2192]
 gi|218774177|emb|CAW29994.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa LESB58]
          Length = 429

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 270/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P +++++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVAKVFVAPGNAGTATEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  + L +VGPE PLV G+ D     G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  AKN-VQLTIVGPEAPLVAGVVDLFRERGLDIFGPTAGAAQLEGSKAFTKDFLARHRIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y+  +  PIV+KADGL AGKGV+VA  +DEA +A+        F   
Sbjct: 120 AYRNFTEVEPALAYLHEQGAPIVIKADGLAAGKGVIVAMNLDEAEAAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGQNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVLDEVIYPTVRGMAEEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  + +    
Sbjct: 300 VRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGEVIEGLAEAAAL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G++++ +++ AY + E I W   ++R+DIG 
Sbjct: 360 DGKVFHAGTALKDGQVVTSGGRVLCATAIGESVSAAQQQAYRLAEKIRWNGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|327398758|ref|YP_004339627.1| phosphoribosylamine--glycine ligase [Hippea maritima DSM 10411]
 gi|327181387|gb|AEA33568.1| Phosphoribosylamine--glycine ligase [Hippea maritima DSM 10411]
          Length = 424

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 190/422 (45%), Positives = 275/422 (65%), Gaps = 7/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++ ++G GGREHALAWKI QSPL   L+ +PGN G A+ A  + I  ++   ++ FC+E
Sbjct: 1   MKIAIVGGGGREHALAWKIKQSPLCDNLFCLPGNAGTAEIATNIDISAEDLDGVVGFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLV +GPE PL +GI D L+  G K FGPS++AA+LE+SKSF K F  KY IPTA Y
Sbjct: 61  KAIDLVAIGPENPLADGIVDRLSEVGIKAFGPSKKAAQLEASKSFTKDFLKKYNIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F+    AK Y++ K  PIVVKADGL AGKGV VA T +EA        I++ F +  +
Sbjct: 121 ETFTSFEDAKAYIEKKGAPIVVKADGLAAGKGVTVAKTKEEAIKALKSIFIEKRFGEAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E SF    DG+  +P   A+DHK I++ D GPNTGGMG+ +PA  + + 
Sbjct: 181 RVVIEEFLEGEEASFLVFSDGENILPMIAAQDHKPIYNNDEGPNTGGMGSYAPAPIVDEN 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   +I  I+   I+GM+KE+ P++GVL+AGLMI ++ PY++E+N RFGDPE QA++  L
Sbjct: 241 LKQYIIDNIMKKAIDGMKKEEAPYKGVLYAGLMIKDKKPYVLEFNCRFGDPETQAILPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TT 353
           +SDI++I+ + + GNL+   ++WK  YA+ VV+A+ GYP  Y  G  I  + +       
Sbjct: 301 KSDIVQIMLATIEGNLNKYSLSWKEGYAVGVVLASGGYPLSYEKGKPIIGLDKIVELDDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT + +  +  NGGRVL+   + K    ++E AY+ ++ I +   ++R DIG + 
Sbjct: 361 IVFHAGTKLKDGQILTNGGRVLNVVGMDKDFRTAQEKAYNAIKFIHFDRMHYRTDIGNKA 420

Query: 414 KE 415
            +
Sbjct: 421 YK 422


>gi|23015506|ref|ZP_00055280.1| COG0151: Phosphoribosylamine-glycine ligase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 429

 Score =  342 bits (876), Expect = 8e-92,   Method: Composition-based stats.
 Identities = 209/423 (49%), Positives = 276/423 (65%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WK+  SPLL+ LW  PGN GIA  A+CVAI  +    ++ F + 
Sbjct: 6   MKVLVVGSGGREHALCWKLKSSPLLTRLWCAPGNAGIADSAECVAIGAEKVDELLAFAKA 65

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +DLVVVGPE PLV G++D   AAG KVFGPS  AA+LE SK F K    K GIPTA Y
Sbjct: 66  NAVDLVVVGPEAPLVLGLADKCRAAGIKVFGPSAAAAELEGSKGFMKDVAAKAGIPTAWY 125

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
             F++  KAK +++ K  PIVVK DGL AGKGVVVA T++E          +R F    +
Sbjct: 126 GRFTNMEKAKDFIRQKGAPIVVKTDGLAAGKGVVVAMTLEEALSAVDMMMGERVFGDAGN 185

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE+L+G E SFFALCDG TA+P   A+DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 186 ELVIEEFLDGEECSFFALCDGSTALPLVAAQDHKRVGDGDTGPNTGGMGAYSPAPVVTDA 245

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + + ++++ ILP ++ M +   P+ GVLFAG+M+T  GP L+EYNVRFGDPECQ +M RL
Sbjct: 246 IQAEIMERSILPLVKTMAEMGKPYTGVLFAGIMVTSAGPKLLEYNVRFGDPECQVLMARL 305

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SD+L +L +   G L   ++ W  + AL VV+A KGYP  Y   T+I  + +       
Sbjct: 306 DSDLLPVLAAGAEGKLAGVNLQWSDDVALVVVMAAKGYPGTYEKNTVIGGLDRAAQVEGV 365

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            + HAGTA+ +  + A GGRVL  TA G T+ E+RE AY  V+ +DW  G+ R DI  + 
Sbjct: 366 TVLHAGTALKDGQVVATGGRVLGITAKGATVAEARERAYKAVDALDWPGGFCRRDIAWRA 425

Query: 414 KER 416
             R
Sbjct: 426 LAR 428


>gi|37524503|ref|NP_927847.1| phosphoribosylamine--glycine ligase [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36783927|emb|CAE12789.1| phosphoribosylglycinamide synthetase [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 427

 Score =  342 bits (876), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 197/425 (46%), Positives = 275/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L++GSGGREHALAWK AQSPL  +++  PGN G A  +  + + I   + + ++ F 
Sbjct: 1   MNILIVGSGGREHALAWKAAQSPLADKIYVAPGNAGTALESNLENIDISATDINGLLVFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE+PLV GI DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEVPLVLGIVDAFQTAGLTIFGPTQAAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+    A  Y+    +PIV+KADGL AGKGV+VA T +EA SAI        F   
Sbjct: 121 AYQNFTAIEPALAYLDKVGVPIVIKADGLAAGKGVIVAITREEAQSAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DGK  IP  T++DHKRI DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLTGEEASFIVMVDGKNVIPMATSQDHKRIGDGDSGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  ++++II PT+ GM  E + + G L+AGLMI+    P +IE+N RFGDPE Q +M
Sbjct: 241 NEIHQRIMEEIIYPTVNGMAAEGHVYTGFLYAGLMISQNGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MR+ SD++E+  +   G L     +W    AL VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 MRMRSDLVELCLAGAKGELAGKTSDWDERPALGVVLAAGGYPADYHKGDIIHGLPQQENE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           ++++FHAGTA+ +N++   GGRVL  TALG+TI ++++ AY   E I+W + ++R+DIG 
Sbjct: 361 SSKVFHAGTAMKDNDVITAGGRVLCVTALGETIIDAQKNAYQQAEEIEWNNCFYRKDIGY 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAINR 425


>gi|313888024|ref|ZP_07821702.1| phosphoribosylamine--glycine ligase [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845979|gb|EFR33362.1| phosphoribosylamine--glycine ligase [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 414

 Score =  342 bits (876), Expect = 9e-92,   Method: Composition-based stats.
 Identities = 178/417 (42%), Positives = 246/417 (58%), Gaps = 8/417 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG+GGREHALAWK+ +S  + +++   GN G     + + ID  +   ++ F  E
Sbjct: 1   MKVLVIGNGGREHALAWKLKESKSVDKIYMARGNGGTEDFCENLDIDPTDIEKLLAFAVE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PL  GI DA N  G +VFGP++  A+ E SK F K F  KY IPTA Y
Sbjct: 61  NKIDLTVVGPEDPLCAGIVDAFNEKGLRVFGPNKACARFEKSKEFTKIFLEKYSIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F     A++ ++  S P+VVKADGLC GKGV++    DEA         D+ F    +
Sbjct: 121 KSFESYDHAEKGLEEFSYPLVVKADGLCFGKGVIICRDRDEAVDALEKIFKDKIFGDQGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TV+IEE+L G E S   L       P   A+DHK+I DGD GPNTGG+G  SP     + 
Sbjct: 181 TVVIEEFLTGEEASVLCLVSNNKLFPLERAKDHKQIFDGDKGPNTGGVGTYSPVSASPKL 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
             +  ++KI     +G+ KE   + G+LF G MI +  P ++E+NVRFGDPE + +M RL
Sbjct: 241 EKN--LEKIYKQIEDGLNKEGLHYSGILFVGFMIEDDMPKVLEFNVRFGDPETEVLMPRL 298

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           + D+ E+LN  + G L    I WK E  LTV++ + GYP  Y  G +I  + +      +
Sbjct: 299 DVDLYELLNKTIDGKLERDDIRWKDETCLTVIMCSGGYPGSYEKGKLIEGLDKVDKDIIV 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           FH GT   ++ L  NGGRVLS TALGK + E+R+ AY  VE I ++  Y+R+DIG +
Sbjct: 359 FHNGTKKTDD-LYTNGGRVLSITALGKNLEEARKKAYDNVERISFEGAYYRKDIGSK 414


>gi|78484783|ref|YP_390708.1| phosphoribosylamine--glycine ligase [Thiomicrospira crunogena
           XCL-2]
 gi|78363069|gb|ABB41034.1| phosphoribosylamine--glycine ligase [Thiomicrospira crunogena
           XCL-2]
          Length = 430

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 190/428 (44%), Positives = 271/428 (63%), Gaps = 10/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK  QS  +S+++  PGN G A     + V I +++   ++ F 
Sbjct: 1   MNVLIIGSGGREHALAWKTIQSDKVSKVFVAPGNAGTALEDNIENVDIAVEDLPGLVDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  I+L +VGPE+PLV G+ DA   AG K FGPS+ AA+LE SK+F+K F  K+ IPTA
Sbjct: 61  QKNAIELTIVGPEVPLVLGVVDAFQDAGLKCFGPSKGAAQLEGSKAFSKDFLAKHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y  F++   A  Y++    PIV+KADGL AGKGV++A T  EA +A++       F   
Sbjct: 121 AYSVFTEIPPAVAYIEKMGAPIVIKADGLAAGKGVILAETNAEAIAAVEDMLAGNKFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L G E SF  + DGK  +P  T++DHK  ++GD GPNTGGMGA +PA  ++
Sbjct: 181 GARVVIEEFLVGEEASFIVMADGKNILPMATSQDHKARNNGDTGPNTGGMGAYTPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
           ++++  ++Q++I PTI+GM K+  P+ G L+AG+MI E   P ++E+N RFGDPE Q +M
Sbjct: 241 RKIHDRIMQEVIRPTIDGMAKDGLPYTGFLYAGIMIAEDGTPKVLEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           MRL+SD+ E+  + +   L      W +  AL VV+A  GYP+EY  G II  I      
Sbjct: 301 MRLQSDLSELCLAALDKKLDTVTAKWDSRPALGVVLAAGGYPDEYRKGDIIEGIEDANNT 360

Query: 352 TTQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +     L  +GGRVL  TALG+ +T++++ AY  V  I W   Y+R DIG
Sbjct: 361 DVKVFHAGTRLDEQGQLVTSGGRVLCVTALGENVTDAQKRAYEGVAKIHWNEVYYRTDIG 420

Query: 411 LQKKERNV 418
            +  +R  
Sbjct: 421 HRAVKREA 428


>gi|313673042|ref|YP_004051153.1| phosphoribosylamine--glycine ligase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939798|gb|ADR18990.1| phosphoribosylamine--glycine ligase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 426

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 174/426 (40%), Positives = 265/426 (62%), Gaps = 7/426 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDI--QNHSAIIHFC 58
           M+VL+IGSGGREHA+AWK+++SP +S+++  PGN G A   +C  IDI   +   + +F 
Sbjct: 1   MKVLVIGSGGREHAIAWKLSESPKVSKVYCAPGNGGTANEKKCENIDIKPLDFERLANFV 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           QE +I   +VGPE PL  GISD     G K+FGP +  A LE+SKSFAK+     GIPTA
Sbjct: 61  QENNIYFTIVGPEEPLAKGISDYFEEKGLKIFGPKKDGALLEASKSFAKEIMVSAGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQI 173
            Y+ F +   A ++++ K +PIV+KADGL AGKGV VA   +EA  A+   F      + 
Sbjct: 121 YYREFDNFEGALKFLKEKGVPIVIKADGLAAGKGVTVAHNFNEAEKALREIFIDNLFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L G E SF A+ DGK  +PF +++DHK ++D D GPNTGGMGA SPA  + 
Sbjct: 181 GNKVVIEEFLTGEEASFIAITDGKNILPFASSQDHKTVYDNDTGPNTGGMGAYSPAPVVD 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
             +Y  V+  ++ P +  ++K+   ++G ++AGLMI +  P ++E+N R GDPE Q ++ 
Sbjct: 241 HGVYEKVMNSVMYPLLNELKKKNIDYKGFIYAGLMIDKGEPKVLEFNCRLGDPETQPLLF 300

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT 353
           R++SD+ ++++  ++G L    I W  EY++ VV+ + GYP+EY  G  I+ +   +   
Sbjct: 301 RMKSDLFDLIDCAINGELDKFDITWYDEYSVGVVMTSGGYPKEYEKGFKITGLESVSSDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGT   N     +GGRVL  TA    +  + +  Y  V  I++   ++R+DIGL+ 
Sbjct: 361 KVFHAGTKFQNGEFITDGGRVLCVTARAADLKTAIDKVYGEVSKINFNKCHYRKDIGLKG 420

Query: 414 KERNVK 419
             +N +
Sbjct: 421 LIKNNR 426


>gi|332143332|ref|YP_004429070.1| Phosphoribosylamine-glycine ligase [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327553354|gb|AEB00073.1| Phosphoribosylamine-glycine ligase [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 430

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 276/430 (64%), Gaps = 9/430 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IG GGREHALA+K AQS  +S ++  PGN G A     + VAID+ + + ++ F 
Sbjct: 1   MNVLVIGGGGREHALAFKAAQSSDVSTVFVAPGNAGTATEPKLENVAIDVNDIAGLVSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   + L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QGNDVALTIVGPEAPLVAGVVDAFTNAGLMIFGPTQAAAQLEGSKAFTKDFLARHSIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+ K  PIVVKADGL AGKGV+VA T++EA  AI        F + 
Sbjct: 121 EYQNFTEIDPAIAYVREKGAPIVVKADGLAAGKGVIVAMTLEEAEEAIRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR  DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRAADGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           Q+++  ++Q++I+PT++GM  E N + G L+AGLMI  +  P  IEYN RFGDPE Q +M
Sbjct: 241 QDIHDRIMQEVIMPTVDGMAAEGNDYVGFLYAGLMIMADGTPKAIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+SD++ +  +   G L    I +    ++ VV+A  GYP  Y  G +I+   +    
Sbjct: 301 LRLKSDLVPLCQAACKGELAGKTIEFDERASVGVVLAAGGYPGSYDKGDVITGFEEAAKL 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATALG  +TE+++ AY +++ I +K  Y+R DI  
Sbjct: 361 DGKVFHAGTALQDGEVVTAGGRVLCATALGNNVTEAQQKAYELLKAIQFKDVYYRTDIAH 420

Query: 412 QKKERNVKYR 421
           +   R  + +
Sbjct: 421 RAIAREAEAK 430


>gi|332107497|gb|EGJ08721.1| phosphoribosylamine--glycine ligase [Rubrivivax benzoatilyticus
           JA2]
          Length = 417

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 193/417 (46%), Positives = 266/417 (63%), Gaps = 1/417 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A  A+   + I + +A+  F   
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPRVQHVYVAPGNGGTAADARLRNVAITDPAALADFVVA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + + L VVGPE PL  G+ D   A G ++FGP++ AA+LESSK+FAK F  ++GIPTA Y
Sbjct: 61  EKVALTVVGPEAPLAAGVVDVFRARGLRIFGPTRAAAQLESSKAFAKDFMKRHGIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIE 180
           + F++   A  YV  +  PIVVKADGL AGKGVVVA T+DEA +AID         V+IE
Sbjct: 121 ESFTEAAAAHAYVDAQGAPIVVKADGLAAGKGVVVAMTLDEAHAAIDTMLGIPGGRVVIE 180

Query: 181 EYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYSTV 240
           E++EG E SF  + DG T +P  T++DHKRI DGD GPNTGGMGA SPA  ++  +++ V
Sbjct: 181 EFMEGEEASFIVVADGTTVLPLATSQDHKRIFDGDRGPNTGGMGAYSPAPVVTPNVHAKV 240

Query: 241 IQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMRLESDI 299
           +Q+II PT+ GM K+ +PF G L+AGLMI  Q  P  +E+N R GDPE + ++MRL++D+
Sbjct: 241 MQEIIQPTLAGMAKDGHPFTGFLYAGLMIDAQGQPRTVEFNCRLGDPEAEVILMRLKTDL 300

Query: 300 LEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLFHAG 359
           +E+L +     L +  + W    AL VV+A  GYP E   G +IS +P       +FHAG
Sbjct: 301 VELLLAATEAKLADVALQWDRRVALGVVMAAAGYPAEPRAGDVISGLPAEREDLVVFHAG 360

Query: 360 TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKER 416
           T +V+     +GGRVL  TALG ++  +++ A   V  I +    WR DIG +    
Sbjct: 361 TKVVDGQTVTSGGRVLCVTALGDSVRLAQQRALEGVHAIAFDGAQWRNDIGHRAIRH 417


>gi|116053003|ref|YP_793321.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|115588224|gb|ABJ14239.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa
           UCBPP-PA14]
          Length = 429

 Score =  341 bits (875), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 182/426 (42%), Positives = 271/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P +++++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVAKVFVAPGNAGTATEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  + L +VGPE PLV G+ D     G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  AKN-VQLTIVGPEAPLVAGVVDLFRERGLDIFGPTAGAAQLEGSKAFTKDFLARHRIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y++ +  PIV+KADGL AGKGV+VA  +DEA +A+        F   
Sbjct: 120 AYRNFTEVEPALAYLREQGAPIVIKADGLAAGKGVIVAMNLDEAEAAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  +++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGQNVLPMASSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVLDEVIYPTVRGMAEEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  + +    
Sbjct: 300 VRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGEVIEGLAEAAAL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G++++ +++ AY + E I W   ++R+DIG 
Sbjct: 360 DGKVFHAGTALKDGQVVTSGGRVLCATAIGESVSAAQQQAYRLAEKIRWNGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|167035865|ref|YP_001671096.1| phosphoribosylamine--glycine ligase [Pseudomonas putida GB-1]
 gi|166862353|gb|ABZ00761.1| phosphoribosylamine--glycine ligase [Pseudomonas putida GB-1]
          Length = 431

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 188/426 (44%), Positives = 273/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T+DEA +A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLDEAEAAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +I+ +      
Sbjct: 300 LRLESSLVLLIEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVINGLDAAAKI 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +T NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTALKDGQVTTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|90581300|ref|ZP_01237097.1| phosphoribosylamine--glycine ligase [Vibrio angustum S14]
 gi|90437539|gb|EAS62733.1| phosphoribosylamine--glycine ligase [Vibrio angustum S14]
          Length = 429

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 275/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A     + V I +++ +A++ F 
Sbjct: 1   MKVLIIGNGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVEIGVEDIAALVEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AA   +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNRIGLTIVGPEAPLVIGVVDAFRAAKLPIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T  +A  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVVKADGLAAGKGVIVAMTEQKAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           +E++  V++++I PT+EGM  E  P+ G L+AGLMI ++  P +IEYN RFGDPE Q +M
Sbjct: 241 KEIHDRVMKEVIYPTVEGMAAEGAPYTGFLYAGLMIMSDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R++SD++E+  + +   L      W    ++ VV+A  GYP  Y  G +IS +PQ    
Sbjct: 301 LRMQSDLVELCLAAIDEKLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPQQEIA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAG A  N N+  NGGRVL ATA+G T+ E+++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFHAGAANNNGNIVTNGGRVLCATAMGDTVLEAQQRAYALAKQISWDGMFHRDDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|313500802|gb|ADR62168.1| Phosphoribosylamine--glycine ligase [Pseudomonas putida BIRD-1]
          Length = 431

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 273/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T++EA +A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +I+ +      
Sbjct: 300 LRLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVINGLDAAAKI 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +T NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTALKDGKVTTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRSDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|296160585|ref|ZP_06843400.1| phosphoribosylamine/glycine ligase [Burkholderia sp. Ch1-1]
 gi|295889111|gb|EFG68914.1| phosphoribosylamine/glycine ligase [Burkholderia sp. Ch1-1]
          Length = 432

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 186/423 (43%), Positives = 263/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   IDI + +A+  F ++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQLVYVAPGNGGTAQDERLRNIDITDPAALADFVEQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI +   + G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIAFTLVGPEAPLAAGIVNLFRSRGLKIFGPTREAAQLESSKDFAKAFMKRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F+D   A  Y+  K  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFADVAAAHAYLDAKGAPIVIKADGLAAGKGVVVAQTLEEAHAAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKHVLPLASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPT+ GM+KE   + G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIILPTVRGMEKEGIRYTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D  +++   + G L    + W    AL VV+A   YP+    G  IS IP  T  + 
Sbjct: 301 LKGDYSKVVEQAIAGTLDTVELEWDRRTALGVVLAAYNYPDTPRKGDRISDIPAETADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT +GGRVL    L  ++  ++ +AY  +  I +    +R DIG +  
Sbjct: 361 TFHAGTTLTDGKLTTSGGRVLCVVGLADSVRSAQSVAYETINQISFDGMQYRRDIGYRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|26991503|ref|NP_746928.1| phosphoribosylamine--glycine ligase [Pseudomonas putida KT2440]
 gi|37999613|sp|Q88DK2|PUR2_PSEPK RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|24986584|gb|AAN70392.1|AE016681_1 phosphoribosylamine--glycine ligase [Pseudomonas putida KT2440]
          Length = 431

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 273/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHEIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T++EA +A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +I+ +      
Sbjct: 300 LRLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVINGLDAAAKI 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +T NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTALKDGKVTTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRSDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|117617677|ref|YP_855382.1| phosphoribosylamine--glycine ligase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117559084|gb|ABK36032.1| phosphoribosylamine--glycine ligase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 429

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 189/426 (44%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK  QSPL++ ++  PGN G A     + VAI   +  A++ F 
Sbjct: 1   MKVLIIGNGGREHALAWKAKQSPLVTRVFVAPGNAGTAHEGSIENVAISATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E+ I L +VGPE PLV G+ DA  A G  +FGP+  AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  KEQRIGLTIVGPEAPLVKGVVDAFRAEGLAIFGPTAAAAQLEGSKAFAKDFLARHAIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLSEAEEAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V++++I+PT+ GM  E N + G L+AGLMI  Q  P +IE+N RFGDPE Q +M
Sbjct: 241 ADVHRKVMEQVIMPTVRGMAAEGNVYTGFLYAGLMIDGQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R+ SD++E+  +   G L      +    A+ VV+A  GYP +Y  G  IS +P +   
Sbjct: 301 LRMRSDLVELCLAACAGKLDQVEAIYDPRVAIGVVLAAGGYPGDYQQGKPISGLPVEEAS 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAG+ +  + +   GGRVL ATALG ++ E+++ AY +   I W   ++R DIG 
Sbjct: 361 GEKVFHAGSQLEGDTVVTAGGRVLCATALGHSVAEAQKRAYQLAGRIKWDGVFYRHDIGW 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAIERE 426


>gi|330444953|ref|ZP_08308607.1| phosphoribosylamine--glycine ligase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328493071|dbj|GAA03104.1| phosphoribosylamine--glycine ligase [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 428

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 191/426 (44%), Positives = 276/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHAL WK+AQ+P +  ++  PGN G A     + VAI +++ + ++ F 
Sbjct: 1   MKVLIIGNGGREHALGWKVAQNPQVETVFIAPGNAGTALEPKLENVAIGVEDIAGLVEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q  HI L +VGPE PLV G+ DA  AA   +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNHIALTIVGPEAPLVIGVVDAFRAAKLPIFGPTEAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T  EA  A+        F + 
Sbjct: 121 EYQNFTEIEPALAYLKQKGAPIVVKADGLAAGKGVIVAMTEQEAEDAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR+ +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGNGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
           QE++  V++++I PT+EGM  E  P+ G L+AGLMI ++  P +IEYN RFGDPE Q +M
Sbjct: 241 QEIHDRVMKEVIYPTVEGMAAEGAPYTGFLYAGLMIMSDGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R++SD++++  + + G L      W    ++ VV+A  GYP  Y  G +IS +PQ    
Sbjct: 301 LRMQSDLVKLCLAAIDGKLDTVESKWDPRASIGVVLAAGGYPASYNKGDVISGLPQQEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT     ++  NGGRVL ATA+G ++ E+++ AY + + I W   + R+DIG 
Sbjct: 361 GEKVFHAGTTNNQGDIVTNGGRVLCATAMGDSVLEAQQRAYALAKQISWDGMFHRDDIGY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|253702113|ref|YP_003023302.1| phosphoribosylamine--glycine ligase [Geobacter sp. M21]
 gi|251776963|gb|ACT19544.1| phosphoribosylamine/glycine ligase [Geobacter sp. M21]
          Length = 423

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 186/423 (43%), Positives = 265/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WKIAQSPL+S+++  PGNPG A  AQ V I + N   ++ F ++
Sbjct: 1   MKVLVVGSGGREHALVWKIAQSPLVSQVFCAPGNPGTATLAQNVDIAVDNLQGLLDFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + + L VVGPELPL  G+ D     G K FG  + AA +E+SK+F+K    KY +PTA Y
Sbjct: 61  EGVALTVVGPELPLSMGLVDLFEENGLKAFGARKNAAIIEASKAFSKDLMHKYNVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F++   A  ++    +PIV+KADGL AGKGV++A T DEA +A+        F    S
Sbjct: 121 GVFTEVKPAVSFIDETGIPIVIKADGLAAGKGVIIAQTRDEAVAAVTDMLSGNAFGAAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF A  DG+  IP  +A+DHK + DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLKGEEASFLAFTDGERIIPLASAQDHKAVFDGDQGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   + +++  T++GM+ E   ++GVL+AGLMI       +E+N RFGDPECQ ++MR+
Sbjct: 241 IHDKAMAEVMRRTVDGMKAEGRTYRGVLYAGLMIDGDSVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TGTT 353
           +SDI+ IL +   G+L    I W  + A+ VV+A +GYP +Y  G +I  +         
Sbjct: 301 KSDIVPILMAVATGSLEGVEIEWHDKAAVCVVLAAEGYPADYRKGDVIGGLDAAGKIEDL 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT      +  +GGRVL  TALG T+ E+ + AY  V+ I W   ++R+DIG + 
Sbjct: 361 VVFHAGTKAAGEGVVTSGGRVLGVTALGGTVKEAIDRAYSGVKEITWPGVHYRKDIGAKA 420

Query: 414 KER 416
             R
Sbjct: 421 MNR 423


>gi|56461392|ref|YP_156673.1| phosphoribosylamine-glycine ligase [Idiomarina loihiensis L2TR]
 gi|56180402|gb|AAV83124.1| Phosphoribosylamine-glycine ligase [Idiomarina loihiensis L2TR]
          Length = 427

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 195/426 (45%), Positives = 277/426 (65%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL++G GGREHALAWK AQS  +  ++  PGN G  +      VAI  ++  ++++F 
Sbjct: 1   MKVLVVGGGGREHALAWKAAQSNQVDCVYVAPGNAGTEREPNLTNVAIGAEDIESLLNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           + + I+L +VGPE PLV GI D  N AG   FGP+ +AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  KSEDIELTIVGPEAPLVAGIVDRFNEAGLAAFGPTAKAAQLEGSKAFSKDFLQRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   AK YV  K +PIV+KADGL AGKGV++A + ++A +AID       F   
Sbjct: 121 DYQNFTEVEPAKAYVAEKGLPIVIKADGLAAGKGVIIAESQEQADAAIDDMLAGNRFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DGK AIPF +++DHK   +GD GPNTGGMGA SPA  +S
Sbjct: 181 GHRVVIEEFLRGEEASFIVMVDGKHAIPFASSQDHKARDNGDKGPNTGGMGAYSPAPVVS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             ++  V++ +I PT++GM  E  P++G L+AGLMI E     ++EYN RFGDPE Q +M
Sbjct: 241 PAIHDWVMRHVIKPTVDGMAAEGAPYKGFLYAGLMIAEDGTSKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           MRL+SD++E+    + G L+   IN+    A+ VV+A  GYPE Y  G II  +P  +  
Sbjct: 301 MRLKSDLVELCLQAIDGKLNQAPINFDERAAVGVVMAAGGYPESYAKGDIIHGLPDHSPE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + N  +  +GGRVL  TALG T+TE+++LAY +V+ + W + Y+R DI  
Sbjct: 361 NQKVFHAGTKMDNGKVVTSGGRVLCCTALGDTVTEAQKLAYQLVDQVSWNNVYYRTDIAH 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAINRE 426


>gi|167766237|ref|ZP_02438290.1| hypothetical protein CLOSS21_00740 [Clostridium sp. SS2/1]
 gi|317497590|ref|ZP_07955908.1| phosphoribosylamine-glycine ligase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167712064|gb|EDS22643.1| hypothetical protein CLOSS21_00740 [Clostridium sp. SS2/1]
 gi|291559879|emb|CBL38679.1| phosphoribosylamine--glycine ligase [butyrate-producing bacterium
           SSC/2]
 gi|316895149|gb|EFV17313.1| phosphoribosylamine-glycine ligase [Lachnospiraceae bacterium
           5_1_63FAA]
          Length = 423

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 180/422 (42%), Positives = 268/422 (63%), Gaps = 8/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHA+AW +A+SP + +++  PGN GIA+ A+CV I       ++ F +E
Sbjct: 1   MKVLIVGSGGREHAIAWSVAKSPKVDKIYCAPGNAGIAEFAECVNIKAMEFDKLVAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL ++G + PLV G+ DA  + G +VFGP + AA +E SK+F+K    KY IPTA Y
Sbjct: 61  NAIDLTIIGMDDPLVGGVVDAFESEGLRVFGPRKNAAIIEGSKAFSKDLMKKYKIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           ++F+DP +A +Y++   MPIV+KADGL  GKGV++  T++EA        +D+ F    +
Sbjct: 121 ENFTDPDEAIKYLETAKMPIVLKADGLALGKGVLICNTLEEAKEGVKTLMLDKQFGDAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE++ G EVS  A CDGKT    T+A+DHKR  DGD G NTGGMG  SP+   + E
Sbjct: 181 EIVIEEFMTGREVSVLAFCDGKTIKCMTSAQDHKRAKDGDQGLNTGGMGTFSPSPFYNDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + +   + +   TI+ M  E  PF G+LF GLMITE GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 VEAFCEKYVYQSTIDAMASEGRPFTGILFTGLMITEDGPKVLEYNARFGDPEAQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           ++DI++++ +C+ G L +  + ++   A+ VV+A+ GYPE+Y  G  I  +   ++    
Sbjct: 301 KNDIIDVMEACIDGKLSDVELEFEDNAAVCVVLASDGYPEKYDKGFEIKGLDTFKDKDGY 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT    + +  NGGRVL   A G+ +  +R  AY   E ID+ + Y R DIG + 
Sbjct: 361 YVFHAGTKFDGDKIVTNGGRVLGVVAKGENLKAARANAYKATEWIDFANKYKRNDIG-KA 419

Query: 414 KE 415
            +
Sbjct: 420 ID 421


>gi|219871532|ref|YP_002475907.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis SH0165]
 gi|219691736|gb|ACL32959.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis SH0165]
          Length = 431

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 273/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK+ QSPL  +++  PGN G A  A  + VAI   + +A+++F 
Sbjct: 1   MNILIIGNGGREHALAWKVRQSPLAEKVFVAPGNAGTALEAGIENVAISATDLTALVNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  + L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  KENEVGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFAKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F++   A  Y+  ++ PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQTFTEIEPALAYLYQRNAPIVIKADGLAAGKGVIVAMTLAEAEEAVKDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLAGEEASFIVMIDGKNVEPMATSQDHKRVGEGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+Q+II PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PDVHQRVMQEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MRLESD++E+      G L+     W  + AL +V+A +GYP +Y     I+ +P +   
Sbjct: 301 MRLESDLVELCLKACDGKLNEIQSKWCEQAALGIVLAAEGYPADYRQNDEITGVPTDYCA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG +  N  L   GGRVL ATALG T++++++ A  + E I W+  ++R DIG 
Sbjct: 361 DEKVFLAGVSQQNGKLVTKGGRVLCATALGSTVSDAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +  +R 
Sbjct: 421 RAIQRE 426


>gi|167856537|ref|ZP_02479246.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis 29755]
 gi|167852340|gb|EDS23645.1| phosphoribosylamine--glycine ligase [Haemophilus parasuis 29755]
          Length = 431

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 196/426 (46%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK  QSPL  +++  PGN G A  A  + VAI   + +A+++F 
Sbjct: 1   MNILIIGNGGREHALAWKFRQSPLAEKVFVAPGNAGTALEAGIENVAISATDLTALVNFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +E  + L +VGPE PLV G+ DA  AAG K+FGP+Q AA+LE SK+FAK F  ++ IPTA
Sbjct: 61  KENEVGLTIVGPEAPLVIGVVDAFRAAGLKIFGPTQAAAQLEGSKAFAKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F++   A  Y+  K+ PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 EYQTFTEIEPALAYLHQKNAPIVIKADGLAAGKGVIVAMTLAEAEEAVKDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L G E SF  + DGK   P  T++DHKR+ +GD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLAGEEASFIVMVDGKNVEPMATSQDHKRVGEGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+Q+II PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PDVHQRVMQEIIYPTVRGMASENNEYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MRLESD++E+      G L+     W  + AL +V+A +GYP +Y     I+ IP +   
Sbjct: 301 MRLESDLVELCLKACDGKLNEIQSKWCEQAALGIVLAAEGYPADYRQNDEITGIPTDCCA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG +  N  L   GGRVL ATALG T++++++ A  + E I W+  ++R DIG 
Sbjct: 361 DKKVFLAGVSQQNGKLVTKGGRVLCATALGSTVSDAQQKALKLAEQIQWQGRFYRRDIGY 420

Query: 412 QKKERN 417
           +  +R 
Sbjct: 421 RAIQRE 426


>gi|296100633|ref|YP_003610779.1| phosphoribosylglycineamide synthetase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055092|gb|ADF59830.1| phosphoribosylglycineamide synthetase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 430

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 195/427 (45%), Positives = 278/427 (65%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ DA  AAG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ + D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   + +II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP  Y  G  I  +P + T 
Sbjct: 301 LRMKSDLVELCLAACDGKLDEKTSEWDERASLGVVIAAGGYPGHYNTGDEIHGLPLEETE 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  NGGRVL ATALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GAKVFHAGTKLADDDRVLTNGGRVLCATALGHTVAEAQKRAYALMADIHWNGSFSRQDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|319408208|emb|CBI81861.1| Phosphoribosylamine-glycine ligase [Bartonella schoenbuchensis R1]
          Length = 424

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 224/421 (53%), Positives = 299/421 (71%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VLLIGSGGREHALAWKIA+SPLL++L+  PGNP   +  + + ++I +HS +I+FC+E
Sbjct: 1   MNVLLIGSGGREHALAWKIAESPLLTKLYCAPGNPATIELGENIDLNINDHSLVINFCKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LNAAG  VFGP+Q+AA+LE SKSF K  C +  IPT+ Y
Sbjct: 61  HSIDLVIVGPEGPLVEGITDSLNAAGICVFGPTQKAAQLEGSKSFTKDLCYRNNIPTSIY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           Q F++  +AK Y++ + +PIV+KADGL AGKGVVVA T+ EA  A+D CF+   +     
Sbjct: 121 QCFNNASQAKSYIRQQGVPIVIKADGLAAGKGVVVAMTMQEAFDAVDACFEGTFNDAKKK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++E +LEG E SFF LCDG TAIPF +A+DHKR+ DGD G NTGGMGA SPA  M++E+
Sbjct: 181 IVVEAFLEGEEASFFCLCDGTTAIPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTEEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P +  M     PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALRDMSAMGAPFKGILFTGLMITQKGPELIEFNVRFGDPECQVLMMRLK 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL +L +   GNL N HI W  + ALTVV+A KGYP     G+II  + +       +
Sbjct: 301 DDILSLLLAAAQGNLKNKHIQWSEKTALTVVMAAKGYPNAPQKGSIIRNVDKVNTLPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGTA+ N  L ANGGRVL+ TA G+T+  +++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTALHNGELIANGGRVLNITATGETVAHAQQRAYEAVDCIDWPQGFVRRDIGWRAI 420

Query: 415 E 415
            
Sbjct: 421 A 421


>gi|269215064|ref|ZP_05987668.2| phosphoribosylamine--glycine ligase [Neisseria lactamica ATCC
           23970]
 gi|269208380|gb|EEZ74835.1| phosphoribosylamine--glycine ligase [Neisseria lactamica ATCC
           23970]
          Length = 452

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 191/423 (45%), Positives = 261/423 (61%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   + +  H  +I FC++
Sbjct: 30  MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNVALTAHQDLIEFCRK 89

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 90  ENITFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 149

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 150 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLGNKMGNAGA 209

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 210 RVVIEDFLRGEEASFIVMVDGNHVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTPA 269

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E   F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 270 VYERAMNEIILPTVAGMKAEGYEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 329

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 330 LNSDLADLVEAAIDGKLDSVTAEWNPQTAVGVVLAAQNYPETPKKGDVISGLDAANQIGK 389

Query: 355 LFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGT      ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 390 VFHAGTTANGKGDVLTNGGRVLCVVGLGDDVAQAKAKAYDALEKISFDGMQYRKDIADKA 449

Query: 414 KER 416
             R
Sbjct: 450 INR 452


>gi|148549900|ref|YP_001270002.1| phosphoribosylamine--glycine ligase [Pseudomonas putida F1]
 gi|148513958|gb|ABQ80818.1| phosphoribosylamine--glycine ligase [Pseudomonas putida F1]
          Length = 430

 Score =  341 bits (874), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 273/426 (64%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T++EA +A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +I+ +      
Sbjct: 300 LRLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYAKGDVINGLDAAAKI 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +T NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTALKDGKVTTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRSDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|296391688|ref|ZP_06881163.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa PAb1]
          Length = 429

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 270/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P +++++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVAKVFVAPGNAGTATEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  + L +VGPE PLV G+ D     G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  AKN-VQLTIVGPEAPLVAGVVDLFRERGLDIFGPTAGAAQLEGSKAFTKDFLARHRIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y++ +  PIV+KADGL AGKGV+VA  +DEA +A+        F   
Sbjct: 120 AYRNFTEVEPALAYLREQGAPIVIKADGLAAGKGVIVAMNLDEAEAAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGQNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVLDEVIYPTVRGMAEEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI-PQNTG 351
           +RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  +      
Sbjct: 300 VRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGEVIEGLAEAAVL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G++++ +++ AY + E I W   ++R+DIG 
Sbjct: 360 DGKVFHAGTALKDGQVVTSGGRVLCATAIGESVSAAQQQAYRLAEKIRWNGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|49475224|ref|YP_033265.1| phosphoribosylamine--glycine ligase [Bartonella henselae str.
           Houston-1]
 gi|49238029|emb|CAF27236.1| Phosphoribosylamine-glycine ligase [Bartonella henselae str.
           Houston-1]
          Length = 427

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 222/423 (52%), Positives = 297/423 (70%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA SP+L++L+  PGNP   +  + + +DI +H  +I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAASPMLTKLYCAPGNPATIELGENIDLDINDHHLVIDFCKT 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LN A   VFGP+Q+AA+LE SK+F K  C K  IPT TY
Sbjct: 61  HSIDLVIVGPEAPLVAGITDSLNNANICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTGTY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           Q F+D  KAK Y++ + +PIV+KADGL AGKGVVVA T++EA +A+D C    F    + 
Sbjct: 121 QCFNDAEKAKAYIRQQGVPIVIKADGLAAGKGVVVAMTMEEAFNAVDACFKSAFGDAGNK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           +++E +LEG E SFF LCDGK AIPF +A+DHKR+ DGD G NTGGMGA SPA  M+QE+
Sbjct: 181 IVVESFLEGEEASFFCLCDGKIAIPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTQEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +I+ P +  + +  +PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLNEIVEPVLHSLNQMGSPFKGILFVGLMITKKGPELIEFNVRFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
           +DIL IL +   GNL NT + W  + ALTVV+A KGYP+    GT+I  + +       +
Sbjct: 301 NDILPILLAAARGNLENTSLQWSKKTALTVVMAAKGYPDSPQKGTVIRNVDKVNALPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F A T + N  L ANGGRVL+ TA G+TI ++++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAATVLHNGELIANGGRVLNITATGETILQAQKRAYEAVDFIDWPEGFVRRDIGWRAV 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARE 423


>gi|261340914|ref|ZP_05968772.1| phosphoribosylamine--glycine ligase [Enterobacter cancerogenus ATCC
           35316]
 gi|288316969|gb|EFC55907.1| phosphoribosylamine--glycine ligase [Enterobacter cancerogenus ATCC
           35316]
          Length = 430

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 190/427 (44%), Positives = 275/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK AQSP +  ++  PGN G A       VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHALAWKAAQSPRVETVFVAPGNAGTALEPTLQNVAIGVTDIPALLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q ++IDL +VGPE PLV G+ DA   AG  +FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNENIDLTIVGPEAPLVIGVVDAFREAGLTIFGPTEGAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVQDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ + D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNADTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +   G L      W    +L VV+A  GYP  Y  G  I  +P +   
Sbjct: 301 LRMKSDLVELCLAACEGKLDEKTSEWDERASLGVVIAAGGYPGNYNTGDEIHGLPLEAVD 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  ++ +  NGGRVL ATALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GAKVFHAGTTLSDDDRVLTNGGRVLCATALGHTVAEAQKRAYALMADIHWNGSFSRQDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|312796933|ref|YP_004029855.1| phosphoribosylamine--glycine ligase [Burkholderia rhizoxinica HKI
           454]
 gi|312168708|emb|CBW75711.1| Phosphoribosylamine--glycine ligase (EC 6.3.4.13) [Burkholderia
           rhizoxinica HKI 454]
          Length = 432

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 189/423 (44%), Positives = 260/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WK+AQSP ++ ++  PGN G A   +   +DI +  A+  F + 
Sbjct: 9   MKVLVVGSGGREHALGWKLAQSPRVTAVYVAPGNGGTALQERLHNVDITDLHALADFAER 68

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   VVGPE PL  GI +   + G K+FGPS+ AA+LESSK FAK F  ++GIP+A Y
Sbjct: 69  EQIAFTVVGPEAPLAAGIVNLFRSRGLKIFGPSREAAQLESSKDFAKAFMKRHGIPSAEY 128

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + FSD   A  YV  +  PIV+KADGL AGKGVVVA T+DEA  AI+            +
Sbjct: 129 ETFSDAAAAHAYVDAQGAPIVIKADGLAAGKGVVVAQTLDEAHRAIEMMLADNKLGDAGA 188

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYL+G E SF  + DGK  +   +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 189 RVVIEEYLQGEEASFIVMVDGKHVLALASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 248

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPT+ GM+ E   + G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 249 LHARVMREIILPTVRGMEHEGLRYTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 308

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D   ++   + G L    + W    AL VV+A   YP+    G  I  IP  T T  
Sbjct: 309 LKGDFARVIEHALAGTLDTVELEWDRRTALGVVLAAHHYPDAPRKGDRIDSIPAQTETAV 368

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGTA+V+  L  +GGRVL    L  ++ E++ +AY  + +I +    +R DIG +  
Sbjct: 369 TFHAGTALVDGKLVTSGGRVLCVVGLADSVREAQSIAYETIHHIHFDGMQYRRDIGHRAL 428

Query: 415 ERN 417
            R 
Sbjct: 429 NRK 431


>gi|238785565|ref|ZP_04629546.1| Phosphoribosylamine--glycine ligase [Yersinia bercovieri ATCC
           43970]
 gi|238713550|gb|EEQ05581.1| Phosphoribosylamine--glycine ligase [Yersinia bercovieri ATCC
           43970]
          Length = 428

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 188/427 (44%), Positives = 272/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + VAI   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPRLENVAIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRDAGLTIFGPTQAAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ +II PT+ GM  E + + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEIHQRVMDQIIWPTVRGMAAEGSVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDDRPSLGVVLAAGGYPADYRQGDVIQGLPQQEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +N +  +GGRVL  TALG T+ ++++ AY +  +I W+  + R+DIG
Sbjct: 361 DGKVFHAGTQLNGDNQVVTSGGRVLCVTALGDTVAKAQQRAYQLAADIHWEGSFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|238916494|ref|YP_002930011.1| phosphoribosylamine--glycine ligase [Eubacterium eligens ATCC
           27750]
 gi|238871854|gb|ACR71564.1| phosphoribosylamine--glycine ligase [Eubacterium eligens ATCC
           27750]
          Length = 431

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 172/423 (40%), Positives = 259/423 (61%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHA+ WK+++SP + +++  PGN GIA+ A+CV I       ++ F +E
Sbjct: 8   MKVLVVGSGGREHAICWKLSKSPKVDKIYCAPGNAGIAELAECVDIKAMEFEKLVAFAKE 67

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL V+G + PLV G+ D   A G +VFGP + AA LE SK+F+K    KY IPTA Y
Sbjct: 68  NSIDLTVIGMDDPLVGGVVDVFEAEGLRVFGPRKNAAILEGSKAFSKDLMKKYNIPTAAY 127

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F+   +AK+Y++    PIV+KADGL  GKGV++    ++A +      +D+ F     
Sbjct: 128 ETFTSAEEAKKYLETAEYPIVLKADGLALGKGVLICENKEDALAGVDELMLDKKFGTAGD 187

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           T++IEE++ G EVS  +  DG T    ++A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 188 TIVIEEFMTGREVSVLSFVDGDTIKIMSSAQDHKRAKDGDQGLNTGGMGNFSPSPFYTKE 247

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I   T++ M+ E  PF+GV+F GLM+T +GP ++EYN RFGDPE Q ++ R+
Sbjct: 248 VDEFCKKYIYQATVDAMKSEGRPFKGVIFFGLMLTPKGPKVLEYNARFGDPEAQVVLPRM 307

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           ++DI+++  +C+ G L    + ++    + V++A+ GYP  Y  G  I  +   +     
Sbjct: 308 KNDIVDVFEACIDGTLDKVDLQFEDNACVCVILASDGYPLAYEKGFEIKGMENFKGKDDY 367

Query: 354 QLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            LFHAG+       +  NGGRVL  TALGK + E+R  AY   E +D+ + Y R DIG +
Sbjct: 368 FLFHAGSKFNEEGKVVTNGGRVLGVTALGKDLKEARAKAYEATEWVDFDNKYMRHDIG-K 426

Query: 413 KKE 415
             +
Sbjct: 427 AID 429


>gi|91787845|ref|YP_548797.1| phosphoribosylamine--glycine ligase [Polaromonas sp. JS666]
 gi|91697070|gb|ABE43899.1| phosphoribosylamine--glycine ligase [Polaromonas sp. JS666]
          Length = 433

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 193/432 (44%), Positives = 268/432 (62%), Gaps = 17/432 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A  A+   I+I +  A+  +   
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPKVQAVYVAPGNGGTALDARLENINITDVQALREWAVA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  GI D   A G +VFGP++ AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  EKIALTVVGPEQPLAAGIVDEFRAHGLRVFGPTKAAAQLESSKAFSKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           + F+D + A  YV  K  PIVVKADGL AGKGVVVA T+ EA  AI+             
Sbjct: 121 ETFTDAVAAHAYVDEKGAPIVVKADGLAAGKGVVVAMTLHEAHEAIEFMLATSPDHNVLG 180

Query: 177 ---------VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACS 227
                    V+IEE+L+G E SF  +CDGK   P  T++DHKR+ DGD GPNTGGMGA S
Sbjct: 181 VTHNEGGARVVIEEFLQGEEASFIVMCDGKNVTPMATSQDHKRLLDGDQGPNTGGMGAYS 240

Query: 228 PALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDP 286
           PA  ++ ++++  +++IILPTI+GM+K+  PF G L+AGLMI  Q  P  +E+N R GDP
Sbjct: 241 PAPVVTPDVHARTMREIILPTIKGMEKDGIPFTGFLYAGLMIDAQGRPKTLEFNCRMGDP 300

Query: 287 ECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI 346
           E Q +MMRL++D+ +++ +   G L    ++W    AL VV+A  GYP     G +I  +
Sbjct: 301 ETQPIMMRLKTDLFDVMMAATSGALDQVELDWDRRPALGVVMAAHGYPLNPRKGDVIHGL 360

Query: 347 ---PQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHG 403
               +      +FHAGT   +N     GGRVL  TALG T+  +++ AY + ++I +   
Sbjct: 361 LKPSEAADDAMVFHAGTRKQDNITVTAGGRVLCVTALGSTVKAAQQRAYEVAQSIQFDGA 420

Query: 404 YWREDIGLQKKE 415
            +R+DIG +  +
Sbjct: 421 QYRKDIGYRAIK 432


>gi|301058121|ref|ZP_07199173.1| phosphoribosylamine--glycine ligase [delta proteobacterium NaphS2]
 gi|300447753|gb|EFK11466.1| phosphoribosylamine--glycine ligase [delta proteobacterium NaphS2]
          Length = 429

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 266/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL++GSGGREHALAWK+AQS  + +++  PGN G  + +  + + I   +   +  F 
Sbjct: 1   MKVLVVGSGGREHALAWKLAQSNRVEKVFVAPGNAGTDRESGVENIPIGSDHIEELKDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              +I+L VVGPE PLV  I D    AG K FGPS  AA+LE SK F K F  ++ IPTA
Sbjct: 61  LNNNIELTVVGPEAPLVECIVDRFEQAGLKCFGPSGNAARLEGSKVFCKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y+ F+D   AK ++   S P+VVKADGL AGKGV++A +  EA  A +       F Q 
Sbjct: 121 RYRSFTDFDAAKAFINELSAPLVVKADGLAAGKGVIIATSKAEAIDAAEGMLSGKSFGQA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +I+EE L G E SF  + DG   +P  T++DHK   DGD GPNTGGMGA SPA  ++
Sbjct: 181 GKCIIVEECLIGEEASFIVMVDGLHILPLATSQDHKARDDGDRGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           +EL+  +++++I PT+ GM  E NP++G L+AGLMI+ +  P ++EYN RFGDPE Q ++
Sbjct: 241 RELHDRIMREVIEPTVRGMASEGNPYKGFLYAGLMISGDGTPNVLEYNCRFGDPETQPII 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD+ E+  + +   L    + W    AL VV+A  GYP  Y  G +I+ +P+    
Sbjct: 301 LRLQSDLAEMCLAAMEQRLDQVEVKWDERAALGVVMAAGGYPVAYQKGDVITGLPETEAE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ N+ +  +GGRVL ATALG ++ E++  AY +   I W   Y+R+DIG 
Sbjct: 361 GVKVFHAGTALNNDQVVTSGGRVLCATALGSSVGEAQLRAYDLARTIHWNGVYYRKDIGY 420

Query: 412 QKKERN 417
           +  ER 
Sbjct: 421 RAVERE 426


>gi|225390332|ref|ZP_03760056.1| hypothetical protein CLOSTASPAR_04085 [Clostridium asparagiforme
           DSM 15981]
 gi|225043604|gb|EEG53850.1| hypothetical protein CLOSTASPAR_04085 [Clostridium asparagiforme
           DSM 15981]
          Length = 426

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 181/423 (42%), Positives = 263/423 (62%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+ WK+AQSP + EL+  PGN GIA+ A+CV I + +   +  F ++
Sbjct: 1   MKVLVIGGGGREHAICWKLAQSPKVKELYCAPGNAGIAEIARCVDIGVMDFEKMTEFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +  DLVVVGP+ PL  G+ DAL AAG + FGP + AA LE SK+F+K    KYGIPTA Y
Sbjct: 61  EAFDLVVVGPDDPLAAGLVDALEAAGLRTFGPRKSAAILEGSKAFSKDLMKKYGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F  P  A +Y++   +P+V+KADGL  GKGV++  T +EA        +D+ F     
Sbjct: 121 ETFDTPEAALEYLETAPVPVVLKADGLALGKGVLICNTREEAREGVKTLMLDKQFGSAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE++ G EVS  +  DGKT    T+A+DHKR  DGD G NTGGMG  SP+   + E
Sbjct: 181 RIVVEEFMTGREVSVLSFVDGKTIRIMTSAQDHKRAKDGDQGLNTGGMGTFSPSPFYTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I  PT++ M  E   F+G++F GLM+T  GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 VDQFCREHIYQPTVDAMAAEGREFKGIIFFGLMLTADGPKVLEYNARFGDPETQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           ++DI+++  +CV G L    ++++   A+ VV+A+ GYPE Y  G  I  +   ++    
Sbjct: 301 KNDIVDVFEACVDGTLDQVELDFEDNAAVCVVLASAGYPEHYEKGYRIEGLEKFKDQDGY 360

Query: 354 QLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAG+      N+  NGGRVL  TA GK + E+R  AY   E +++ + Y R DIG +
Sbjct: 361 YVFHAGSKFDAEGNIVTNGGRVLGVTAKGKDLEEARANAYKAAEWVEFGNKYMRGDIG-K 419

Query: 413 KKE 415
             +
Sbjct: 420 AID 422


>gi|238790631|ref|ZP_04634396.1| Phosphoribosylamine--glycine ligase [Yersinia frederiksenii ATCC
           33641]
 gi|238721300|gb|EEQ12975.1| Phosphoribosylamine--glycine ligase [Yersinia frederiksenii ATCC
           33641]
          Length = 428

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK+ QSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKVTQSPLADKIYVAPGNAGTALEPRLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNNDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +R+ SD++E+  +   G L+     W    +L VV+A  GYP +Y  G +I  +PQ  T 
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSEWDERPSLGVVLAAGGYPADYRQGDVIYGLPQQETA 360

Query: 352 TTQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT + + NN+   GGRVL  TALG T+ ++++ AY + E+I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLDDQNNVVTAGGRVLCVTALGATVAQAQQHAYKLAESIQWEGAFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|289207363|ref|YP_003459429.1| phosphoribosylamine/glycine ligase [Thioalkalivibrio sp. K90mix]
 gi|288942994|gb|ADC70693.1| phosphoribosylamine/glycine ligase [Thioalkalivibrio sp. K90mix]
          Length = 429

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 184/428 (42%), Positives = 260/428 (60%), Gaps = 11/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IG+GGREHALAWK+AQSP +  +   PGN G A+ A+C  V I + +   ++   
Sbjct: 1   MNVLVIGNGGREHALAWKLAQSPRVQRVLVAPGNAGTARTAKCENVEIGVTDIDGLLALA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           + + I   VVGPE PLV G+ DA  AAG + FGPS +AA+LE SKSFAK F  ++GIPTA
Sbjct: 61  EREDIAFTVVGPEAPLVAGVVDAFRAAGRRCFGPSAKAAQLEGSKSFAKDFMQRHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y  F D   A  +++    PIVVKADGL AGKGV++A T DEA +A+        F + 
Sbjct: 121 AYGSFEDESAALDFIRAHGAPIVVKADGLAAGKGVILAQTEDEACAAVRDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L G E SF  + DG+  +P  +++DHK   DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLRGEEASFICMVDGEHVLPLASSQDHKARDDGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
             L++ +++++I PT+ GM  +   + G L+AG+MI  E  P ++E+N RFGDPE Q ++
Sbjct: 241 DALHARILREVIEPTVRGMAADGERYTGFLYAGVMIDAEGNPKVLEFNCRFGDPETQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNT 350
            RLESD+ +++ + +   L      W A  AL VV+A  GYP  Y  G +I+ +   +N 
Sbjct: 301 SRLESDLADLVEAALDERLDQIEARWDARVALGVVLAAGGYPGAYRKGDVITGLESVENN 360

Query: 351 GTTQLFHAGTA-IVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
               +FHAGTA   +  +   GGRVL    LG+ +  +++ AY  V  I ++  Y R DI
Sbjct: 361 PEAYVFHAGTATREDGAVVTAGGRVLCVVGLGRDVKSAQKKAYEAVHRIHFEDIYCRTDI 420

Query: 410 GLQKKERN 417
           G +   R 
Sbjct: 421 GYRAVARE 428


>gi|89094588|ref|ZP_01167526.1| phosphoribosylamine--glycine ligase [Oceanospirillum sp. MED92]
 gi|89081187|gb|EAR60421.1| phosphoribosylamine--glycine ligase [Oceanospirillum sp. MED92]
          Length = 427

 Score =  341 bits (873), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 185/425 (43%), Positives = 272/425 (64%), Gaps = 8/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQ--CVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAW +A+   +++++  PGN   AQ  +   VAID+ +   +  F 
Sbjct: 1   MNVLVIGSGGREHALAWSVAKDKKVAQVFVAPGNAATAQEDKMQNVAIDVMDLEGLATFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  ++L +VGPE PLV G+ +   A G ++FGP++ AA+LE SK+F K F  +  IPTA
Sbjct: 61  KDNQVELTIVGPEAPLVEGVVNKFQAEGLRIFGPTEGAAQLEGSKAFTKDFLARQQIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  YV+ K  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 EYENFTEIEPALAYVREKGAPIVVKADGLAAGKGVIVAMTLTEAEDAIKDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E S+  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASYIVMVDGDNVLPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E+   ++ ++I+PT+ GM+ E N + G L+AGLMI  +  P +IEYN RFGDPE Q +M
Sbjct: 241 AEIDQRIMDEVIMPTVNGMKAEGNEYTGFLYAGLMIQADGTPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           +RL+S ++++ N+ +   L +T   W    ++ VV+A  GYP  Y  G +IS   +    
Sbjct: 301 LRLKSSLVDLCNAALDKKLADTTAEWDERKSVGVVMAAGGYPGSYGKGDVISFPAECPEG 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
           T++FHAGT +   N+   GGRVL  TALG+T+TE+++ AY +++ + W+  Y+R+DI  +
Sbjct: 361 TKIFHAGTKLDGENVVTAGGRVLCVTALGETVTEAQKRAYELLDKVSWEGAYFRKDIAYR 420

Query: 413 KKERN 417
              R 
Sbjct: 421 AIARE 425


>gi|330807316|ref|YP_004351778.1| Phosphoribosylamine--glycine ligase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327375424|gb|AEA66774.1| Phosphoribosylamine--glycine ligase [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 431

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 186/426 (43%), Positives = 269/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   A G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRARGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+  +I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AQVHQRVMDLVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +RL+S ++ ++ + +   L      W    ++ VV+A  GYP +Y  G+ I  +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKVEAQWDPRPSVGVVLAAGGYPGDYAKGSAIQGLDAAARL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATA+G ++ E+++ AY +   IDW+  ++R+DIG 
Sbjct: 360 EGKVFHAGTALKDGQVVTAGGRVLCATAMGASVDEAQQQAYKLAAEIDWEGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|218133077|ref|ZP_03461881.1| hypothetical protein BACPEC_00939 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991950|gb|EEC57954.1| hypothetical protein BACPEC_00939 [Bacteroides pectinophilus ATCC
           43243]
          Length = 424

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 183/423 (43%), Positives = 263/423 (62%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHA+AWK+AQS  + +++  PGN GIA+ A+CV I       ++ F ++
Sbjct: 1   MKVLIIGSGGREHAIAWKVAQSSRVDKIYCAPGNAGIAEIAECVNIKAMEFDKLVKFAKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVG + PLV GI DA  A G +VFGP + AA LE SK+F+K    KY IPTA Y
Sbjct: 61  NAIDLTVVGMDDPLVGGIVDAFEAEGLRVFGPRRNAAILEGSKAFSKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F+   +AK+Y++    PIV+KADGL  GKGV++  T +EA   ++            +
Sbjct: 121 ETFTSAEEAKKYLETSEYPIVLKADGLALGKGVLICQTKEEAMEGVNELMLDKKFGSAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           T++IEE++ G EVS  +  DG T    ++A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 181 TIVIEEFMTGREVSVLSFVDGSTIKIMSSAQDHKRAKDGDQGLNTGGMGNFSPSPFYTKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +       I   T++ M+ E  PF+GV+F GLM+T +GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 VDDFCKAHIYQATVDAMKAEGRPFKGVIFFGLMLTPKGPRVLEYNARFGDPEAQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           E+DI+++  +C+ G L    + +  + A+ VV+A+ GYP  Y  G  I+ +   +     
Sbjct: 301 ENDIIDVFEACIDGTLDKIDLKFSDKAAVCVVLASDGYPVSYEKGFEITGMENFKGKDGY 360

Query: 354 QLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            LFHAG+A      +  NGGRVL  TALG T+ E+R  AY  VE +D+K+ Y R DIG +
Sbjct: 361 YLFHAGSAFNAEGKVVTNGGRVLGVTALGDTLKEARANAYKAVEWVDFKNKYMRHDIG-K 419

Query: 413 KKE 415
             +
Sbjct: 420 AID 422


>gi|104783801|ref|YP_610299.1| phosphoribosylamine--glycine ligase [Pseudomonas entomophila L48]
 gi|95112788|emb|CAK17516.1| phosphoribosylglycinamide synthase [Pseudomonas entomophila L48]
          Length = 431

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 267/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVTALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VDLTIVGPEAPLVLGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +IS +      
Sbjct: 300 LRLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYNKGDVISGLDAAAKL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATA+G T+  +++ AY + + + W   + R DIG 
Sbjct: 360 EGKVFHAGTALKDGQVATAGGRVLCATAMGDTVEAAQQQAYRLAKEVTWNGSFHRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|85711857|ref|ZP_01042912.1| Phosphoribosylamine-glycine ligase [Idiomarina baltica OS145]
 gi|85694254|gb|EAQ32197.1| Phosphoribosylamine-glycine ligase [Idiomarina baltica OS145]
          Length = 426

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 192/424 (45%), Positives = 269/424 (63%), Gaps = 8/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L++G GGREHALAWK AQS  ++E++  PGN G A  A  + V+I  ++   +  F 
Sbjct: 1   MKILVVGGGGREHALAWKAAQSKQVTEVFVAPGNAGTADEANLKNVSISAEDIEGLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  +DL +VGPE PLV GI D   +    +FGPS  AA+LE SKSF+K F  ++ IPTA
Sbjct: 61  QKNAVDLTIVGPEAPLVKGIVDLFQSRKLAIFGPSAAAAQLEGSKSFSKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y  F+D   AK YV++  +PIV+KADGL AGKGV++A T+++A +AID       F + 
Sbjct: 121 AYDTFTDIAAAKSYVRDNQLPIVIKADGLAAGKGVIIAETLEQADAAIDDMLAGNKFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L G E SF  + DGKTA+ F +++DHK   DGD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLTGEEASFIVIADGKTAVAFASSQDHKARDDGDKGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+Q +I PTI+GM  E  P+ G L+AGLM+  +    ++EYN RFGDPE Q +M
Sbjct: 241 DEVHEWVMQHVIQPTIDGMAAEGTPYVGFLYAGLMVAPDGSAKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR+ SD++E+    + G L      +    A+ VV+A  GYPE Y  G  I  IP+ T +
Sbjct: 301 MRMRSDLVELCEKAITGQLAGASARFDERTAVGVVMAAGGYPESYHKGDEIKGIPEATES 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            ++FHAGT      L  NGGRVL   ALG  + +++  AY +V++I W + Y+R DI   
Sbjct: 361 YKVFHAGTKYEQGRLLTNGGRVLCCVALGDDVQQAQLEAYQLVKHIHWDNVYYRNDIAHH 420

Query: 413 KKER 416
             +R
Sbjct: 421 AIKR 424


>gi|291562459|emb|CBL41275.1| phosphoribosylamine--glycine ligase [butyrate-producing bacterium
           SS3/4]
          Length = 425

 Score =  340 bits (872), Expect = 2e-91,   Method: Composition-based stats.
 Identities = 181/424 (42%), Positives = 259/424 (61%), Gaps = 10/424 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHA+AWK+AQS  + +++  PGN GI++ A+CV I       ++ F +E
Sbjct: 1   MKVLIVGSGGREHAIAWKVAQSKKVDKIYCAPGNAGISEVAECVPIGAMEFDKLVAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL V+G + PLV GI D     G +VFGP + AA LE SK+F+K    KY IPTA Y
Sbjct: 61  KEIDLTVIGMDDPLVGGIVDVFEKEGLRVFGPRKNAAILEGSKAFSKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F+DP KA +Y++   MPIV+KADGL  GKGV++  T++EA        +D+ F     
Sbjct: 121 ETFTDPEKALEYLETAKMPIVLKADGLALGKGVLICQTLEEAKEGVKTLMMDKKFGSAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE++ G EVS  +  DG      ++A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 181 EIVIEEFMTGREVSVLSFVDGNIVKIMSSAQDHKRAKDGDQGLNTGGMGNFSPSPFYTKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +     + I  PT++ M+ E  PF+GV+F GLM+T  GP ++EYN RFGDPE Q ++ RL
Sbjct: 241 VDEFCKKYIYQPTVDAMKAEGRPFKGVIFFGLMLTPDGPKVLEYNARFGDPEAQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTH-INWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TGT 352
           E+DI+++  +C+ G L             + V++A+ GYP EY  G  I  + +      
Sbjct: 301 ENDIVDVFEACIDGTLDQVDLKFDNDRATVCVILASDGYPVEYKKGFPIEGLEKFKGKDD 360

Query: 353 TQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             +FH+GT    N  +  NGGRVL  TA GK + E+R+ AY   E I +++ Y R DIG 
Sbjct: 361 YYVFHSGTKFNENGQIVTNGGRVLGVTATGKDLKEARKKAYEATEWISFENKYMRHDIG- 419

Query: 412 QKKE 415
           +  E
Sbjct: 420 KAIE 423


>gi|229588160|ref|YP_002870279.1| phosphoribosylamine--glycine ligase [Pseudomonas fluorescens SBW25]
 gi|229360026|emb|CAY46880.1| phosphoribosylamine--glycine ligase [Pseudomonas fluorescens SBW25]
          Length = 430

 Score =  340 bits (872), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 266/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   +     FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRSRNLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+S ++ ++ + +   L      W    ++ +V+A  GYP +Y  G +I  +    T 
Sbjct: 300 LRLQSSLVLLVEAALAQALDKVEAQWDPRPSVGIVLAAGGYPADYAKGDVIEGLDAAATL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATA+G ++  +++ AY +   IDW   ++R+DIG 
Sbjct: 360 EGKVFHAGTALKDGKVVTAGGRVLCATAMGASVDAAQQQAYTLAAKIDWNGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|152989370|ref|YP_001350896.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa PA7]
 gi|150964528|gb|ABR86553.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa PA7]
          Length = 429

 Score =  340 bits (872), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 270/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P +++++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVAKVFVAPGNAGTATEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  + L +VGPE PLV G+ D     G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  AKN-VQLTIVGPEAPLVAGVVDLFRERGLDIFGPTAGAAQLEGSKAFTKDFLARHRIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y++ +  PIV+KADGL AGKGV+VA ++DEA +A+        F   
Sbjct: 120 AYRNFTEVEPALAYLREQGAPIVIKADGLAAGKGVIVAMSLDEAEAAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM +E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVLDEVIYPTVRGMAEEGNVYTGFLYAGLMIDRNGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  + +    
Sbjct: 300 VRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGEVIEGLAEAAAL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G++++ +++ AY +   I W   ++R+DIG 
Sbjct: 360 DGKVFHAGTALKDGQVVTSGGRVLCATAIGESVSAAQQQAYRLAGKIRWNGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|238794944|ref|ZP_04638541.1| Phosphoribosylamine--glycine ligase [Yersinia intermedia ATCC
           29909]
 gi|238725702|gb|EEQ17259.1| Phosphoribosylamine--glycine ligase [Yersinia intermedia ATCC
           29909]
          Length = 428

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 272/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A  +  + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLAGKIYVAPGNAGTALESGLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
               I L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  LSHDIGLTIVGPEAPLVIGVVDAFRTAGLTIFGPTQAAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V++ +I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMESVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NN +  NGGRVL  TALG T+ ++++ AY + ENI W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNNEVVTNGGRVLCVTALGATVAQAQQNAYRLAENIQWEGAFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|313109847|ref|ZP_07795781.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa 39016]
 gi|310882283|gb|EFQ40877.1| phosphoribosylamine--glycine ligase [Pseudomonas aeruginosa 39016]
          Length = 429

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 182/426 (42%), Positives = 271/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P +++++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVAKVFVAPGNAGTATEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            +  + L +VGPE PLV G+ D     G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  AKN-VQLTIVGPEAPLVAGVVDLFRERGLDIFGPTAGAAQLEGSKAFTKDFLARHRIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y++ +  PIV+KADGL AGKGV+VA  +DEA +A+        F   
Sbjct: 120 AYRNFTEVEPALAYLREQGAPIVIKADGLAAGKGVIVAMNLDEAEAAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGQNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVLDEVIYPTVRGMAEEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  + +    
Sbjct: 300 VRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGEVIEGLAEAAAL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATA+G++++ +++ +Y + E I W   ++R+DIG 
Sbjct: 360 DGKVFHAGTALKDGQVVTSGGRVLCATAIGESVSAAQQQSYRLAEKIRWNGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|124266531|ref|YP_001020535.1| phosphoribosylamine--glycine ligase [Methylibium petroleiphilum
           PM1]
 gi|124259306|gb|ABM94300.1| phosphoribosylamine--glycine ligase [Methylibium petroleiphilum
           PM1]
          Length = 430

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 266/430 (61%), Gaps = 14/430 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHALAWK+AQSP +  ++  PGN G A   +   + I    A+ +F Q 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPKVQMVYVAPGNGGTALDVRLKNVAITEVDALANFAQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D   A G +VFGP+Q AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  EKIGLTVVGPEAPLAAGVVDVFRARGLRVFGPTQAAAQLESSKAFSKDFMKRHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN------ 174
           + FSD   A  YV     PIVVKADGL AGKGVVVAAT+DEA  A+D      +      
Sbjct: 121 ETFSDAAAAHAYVDRMGAPIVVKADGLAAGKGVVVAATLDEAHQAVDWMLAGHSGDNKLG 180

Query: 175 -------STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACS 227
                  + V+IEE+L G E SF  L DG+  +P  T++DHKR+ DGD GPNTGGMGA S
Sbjct: 181 VTHNAGGARVVIEEFLAGEEASFIVLADGRHVLPLATSQDHKRLKDGDAGPNTGGMGAYS 240

Query: 228 PALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDP 286
           PA  ++  +++ V+ +II PT++GM ++  P+ G L+AGLMI  Q  P  +E+N R GDP
Sbjct: 241 PAPVVTPNIHAKVMHEIIQPTLDGMARDGIPYTGFLYAGLMIDAQGNPKTLEFNCRMGDP 300

Query: 287 ECQAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI 346
           E Q +MMRL+SD+L++L     G L    + W   +AL VV+A  GYPE+     +I+ +
Sbjct: 301 ETQPIMMRLKSDLLDVLTHAADGTLDQVELQWDRRFALGVVMAAHGYPEQPRKADVITGL 360

Query: 347 PQNTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWR 406
           P  T    +FHAGT+    ++  +GGRVL  TALG +   ++  AY  +  I +    +R
Sbjct: 361 PPETADAVVFHAGTSKPGKDIVTSGGRVLCVTALGDSAKVAQARAYDALSGIAFDGMQFR 420

Query: 407 EDIGLQKKER 416
            DIG +  +R
Sbjct: 421 RDIGHRAIKR 430


>gi|323142084|ref|ZP_08076932.1| phosphoribosylamine--glycine ligase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413471|gb|EFY04342.1| phosphoribosylamine--glycine ligase [Phascolarctobacterium sp. YIT
           12067]
          Length = 425

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 191/425 (44%), Positives = 257/425 (60%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +LLIG GGREHALAWK+AQSP + ++++ PGNPG+A     +C+A+D++N   +  + 
Sbjct: 1   MNILLIGGGGREHALAWKLAQSPKVEKIYAAPGNPGMALLPKCECIALDVENLEGVADYA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK IDL VVGPE PLV G++D     G  VFGPS+ AA+LE SK+F+K+   KY IPTA
Sbjct: 61  EEKSIDLTVVGPEAPLVAGLADVCKRRGLPVFGPSKAAAQLEGSKAFSKELMAKYNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINS--- 175
            ++   D   AK YV+ K  PIVVKADGL AGKGVVVA T  EA  AID           
Sbjct: 121 FFKICEDIETAKAYVEEKGAPIVVKADGLAAGKGVVVAMTKQEALDAIDEMMADHKFGNA 180

Query: 176 --TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EEY+EG E S  A  DGKT +P   ++DHKR+ DGD GPNTGGMG  +PA  M+
Sbjct: 181 GARLVLEEYMEGEEASLLAFTDGKTIVPMIASQDHKRVFDGDEGPNTGGMGTYAPAPVMT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
             L     + I+ P I  M  E  P+QG L+AGLMI      ++E+N RFGDPE Q ++ 
Sbjct: 241 DVLRLKATELILKPVIAAMAAEGMPYQGCLYAGLMIKGDSVKVVEFNCRFGDPETQVVLP 300

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN--TG 351
            L+ D+ EI+ +C  G L      W  + A+ VV+A+ GYPE Y  G  I+ +       
Sbjct: 301 LLDGDLAEIMLACATGTLAQVDFGWYDKAAVCVVMASGGYPESYAKGMEITGLADAAADK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
              +FHAGT      +  NGGRVL  TA+   I  +R+ AY  VE I++   + R+DI  
Sbjct: 361 DVVVFHAGTKADGAKVLTNGGRVLGVTAVDANIKAARDRAYTAVEKINFNGAFCRKDIAW 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RALKR 425


>gi|121635794|ref|YP_976039.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis FAM18]
 gi|120867500|emb|CAM11277.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis FAM18]
 gi|325131235|gb|EGC53947.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis M6190]
 gi|325137409|gb|EGC59997.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           ES14902]
 gi|325143386|gb|EGC65715.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           961-5945]
 gi|325199225|gb|ADY94681.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis G2136]
          Length = 423

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 194/423 (45%), Positives = 264/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G IIS +       +
Sbjct: 301 LNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDIISGLDAANQIGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTAKEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|323525391|ref|YP_004227544.1| phosphoribosylamine/glycine ligase [Burkholderia sp. CCGE1001]
 gi|323382393|gb|ADX54484.1| phosphoribosylamine/glycine ligase [Burkholderia sp. CCGE1001]
          Length = 432

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 184/423 (43%), Positives = 262/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI   +A+  F ++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQLVYVAPGNGGTAQDERLRNVDITEPAALADFVEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI +   + G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIAFTLVGPEAPLAAGIVNLFRSRGLKIFGPTKEAAQLESSKDFAKAFMKRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F+D   A  Y+  K  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFADVAAAHAYLDAKGAPIVIKADGLAAGKGVVVAQTLEEAHAAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKHVLPLASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPT+ GM+KE   + G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIILPTVRGMEKEGIRYTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D  +++   + G L    + W    AL VV+A   YP+    G  I+ IP  T  + 
Sbjct: 301 LKGDYSKVVEQAIAGTLDTVELEWDRRTALGVVLAAHNYPDAPRKGDRINDIPAETADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGTA+ +  L  +GGRVL    L  ++  ++ +AY  +  I +    +R DIG +  
Sbjct: 361 TFHAGTALKDGKLVTSGGRVLCVVGLADSVRSAQSVAYETINQISFDGMQYRRDIGYRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|134296479|ref|YP_001120214.1| phosphoribosylamine--glycine ligase [Burkholderia vietnamiensis G4]
 gi|134139636|gb|ABO55379.1| phosphoribosylamine--glycine ligase [Burkholderia vietnamiensis G4]
          Length = 425

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 186/425 (43%), Positives = 266/425 (62%), Gaps = 6/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI +  A+  F + 
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQMVYVAPGNGGTAQDERLKNVDITSLDALADFAES 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   +VGPE PL  GI +   A G KVFGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVAFTLVGPEAPLAAGIVNLFRARGLKVFGPTREAAQLESSKDFAKAFMKRHGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + FSD   A  Y+  K  PIVVKADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFSDAAAAHAYLDAKGAPIVVKADGLAAGKGVVVAMTLEEAHAAVDMMLSGNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF  + DGK A+   +++DHKR+ D D GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLDGEEASFIVMVDGKHALALASSQDHKRLLDEDRGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II+PT+ GM+K+   F G L+AGLMI  +  P  +E+N R GDPE Q +M R
Sbjct: 241 MHARVMREIIMPTVRGMEKDGIRFTGFLYAGLMIDKDGNPRTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD  +++   + G L    ++W    AL VV+A  GYP+    G  I+ IP  T    
Sbjct: 301 LKSDFSKVVEQAIAGTLDTVELDWDRRTALGVVLAAHGYPDAPRKGDRINGIPAETEQAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT +  + L  +GGRVL    L  ++ E+++ AY  +  I+++   +R DIG +  
Sbjct: 361 TFHAGTTLDGDKLVTSGGRVLCVVGLADSVREAQQHAYDAINQINFEGMQYRRDIGFRAL 420

Query: 415 ERNVK 419
            R   
Sbjct: 421 NRKST 425


>gi|325273607|ref|ZP_08139825.1| phosphoribosylamine--glycine ligase [Pseudomonas sp. TJI-51]
 gi|324101261|gb|EGB98889.1| phosphoribosylamine--glycine ligase [Pseudomonas sp. TJI-51]
          Length = 431

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 186/426 (43%), Positives = 271/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M+VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MKVLIIGSGGREHALAWKVAQDPRVEKVFVAPGNAGTAIEAKCENVAIDVCALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  +DL +VGPE PLV G+ D   + G   FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VDLTIVGPEAPLVIGVVDLFRSRGLDCFGPTKGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y+Q K  PIV+KADGL AGKGV+VA T+DEA +A+        F   
Sbjct: 120 DYQNFTEIEPALAYLQEKGAPIVIKADGLAAGKGVIVAMTLDEAEAAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGHNVLPMATSQDHKRVGDQDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RLES ++ ++ +     L      W    +L VV+A  GYP +Y  G +I+ +      
Sbjct: 300 LRLESSLVLLVEAAFAKALDKVEAQWDPRPSLGVVLAAGGYPGDYARGDVINGLDAAAQI 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT++ +  +  NGGRVL ATA+G T+ ++++ AY + + + W   ++R DIG 
Sbjct: 360 EGKVFHAGTSLKDGQVVTNGGRVLCATAMGSTVADAQQQAYRLAKEVSWNGSFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|300112977|ref|YP_003759552.1| phosphoribosylamine/glycine ligase [Nitrosococcus watsonii C-113]
 gi|299538914|gb|ADJ27231.1| phosphoribosylamine/glycine ligase [Nitrosococcus watsonii C-113]
          Length = 437

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 198/433 (45%), Positives = 273/433 (63%), Gaps = 9/433 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG GGREHALAWK+AQSPL+  ++  PGN G A+   A+ + I   N SA++ F 
Sbjct: 1   MKVLVIGGGGREHALAWKLAQSPLVDRVYVAPGNAGTAREPKAENIPIKSDNISALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
             + I+L VVGPE PLV GI DA   AG   +GP + AA LE SKSFAK+F T++GIPTA
Sbjct: 61  LAEQIELTVVGPEAPLVLGIVDAFEEAGLPCWGPRRGAAHLEGSKSFAKEFLTRWGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ FS    A  Y++ +  PIVVKADGL AGKGVVVA T +EA +A+        F + 
Sbjct: 121 RYQTFSQVEPAIAYIKTEGAPIVVKADGLAAGKGVVVARTEEEAIAAVHSMLGDGVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G E SF  + DG+  +P  +++DHK + +GD G NTGGMGA SPA  ++
Sbjct: 181 GCQVVVEEFLRGEEASFIVMSDGEHVLPLASSQDHKALEEGDRGLNTGGMGAYSPAPVLA 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           + ++  V+Q++I+PT+ GM +E  P++G L+AGLMI     P ++EYN RFGDPE Q ++
Sbjct: 241 EAVHERVMQEVIVPTVRGMAEEGYPYRGFLYAGLMIAENGSPKVLEYNCRFGDPEAQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MRL SD++ +  + + G LH   ++W    AL VV+A KGYP  Y  G  I  +P     
Sbjct: 301 MRLRSDLVALCQAALAGRLHEVSVDWDPRAALGVVMAAKGYPGSYSFGDPIYGLPAPERE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FH GTA     +   GGRVL A  LG ++TE++  AY +V+ I WK  Y+R DIG 
Sbjct: 361 DRKVFHGGTAEEQGRIVTAGGRVLCACGLGNSVTEAQATAYGLVQQITWKEAYYRSDIGY 420

Query: 412 QKKERNVKYRNKS 424
           +   R      +S
Sbjct: 421 RAIAREADSMAES 433


>gi|145641928|ref|ZP_01797502.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae R3021]
 gi|145273407|gb|EDK13279.1| phosphoribosylamine--glycine ligase [Haemophilus influenzae
           22.4-21]
          Length = 429

 Score =  340 bits (871), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 269/427 (62%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL  +++   GN G A     + V I   +  A++ F 
Sbjct: 1   MDILIIGNGGREHALAWKAAQSPLADKVFVASGNTGTALEHKVENVNISATDIPALVKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+K I L +VGPE PLV G+ DA   AG K+FGP++ AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QDKQIGLTIVGPEAPLVIGVVDAFREAGLKIFGPTKAAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK   P  T++DHKR+ + D G NTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGLNTGGMGAYSPAPVIT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++S +++++I PT+ GM  E N + G L+AGLMI     P +IE+N RFGDPE Q +M
Sbjct: 241 PEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ-NTG 351
           +RL+SD++E+      G L      W    +L +V+A +GYP++Y  G  IS +P+    
Sbjct: 301 LRLKSDLVELCLKACDGKLDEVISQWDTRASLGIVLAAEGYPKDYRKGDEISGLPKSAVK 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AG A     L  NGGRVL  TALG+++ E+++ A  + E I W   ++R DIG 
Sbjct: 361 NEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQKALKLAEQIQWSGRFYRRDIGY 420

Query: 412 QKKERNV 418
           +  ER +
Sbjct: 421 RAVEREL 427


>gi|53802473|ref|YP_112893.1| phosphoribosylamine--glycine ligase [Methylococcus capsulatus str.
           Bath]
 gi|53756234|gb|AAU90525.1| phosphoribosylamine--glycine ligase [Methylococcus capsulatus str.
           Bath]
          Length = 427

 Score =  339 bits (870), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 191/427 (44%), Positives = 270/427 (63%), Gaps = 9/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M++L++GSGGREHALAWK AQSP + +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MKILIVGSGGREHALAWKAAQSPRVRKVFVAPGNAGTALEPGVENVTIAADDVAGLLEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +   + L +VGPE PLV GI DA  AAG   FGP+++AA+LE SK+F K F  ++GIPTA
Sbjct: 61  KAAGVTLTIVGPEAPLVAGIVDAFRAAGLACFGPTRQAAQLEGSKAFCKDFLARHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F+D  +A+ Y++ K  PIVVKADGL AGKGV+VA + DEA +A+        F   
Sbjct: 121 AYQVFTDAGEAEDYIRRKGAPIVVKADGLAAGKGVIVAQSEDEAIAAVRDMLAGDAFGSA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V++EE+L G E SF  + DG+ A+P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVVEEFLPGEEASFIVMADGEHALPMATSQDHKARDEGDRGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+++IILPT+ GM+ +  P+ G L+AGLM+  + G  ++E+N RFGDPE Q +M
Sbjct: 241 PEIHQRVMEEIILPTLAGMKADGMPYTGFLYAGLMVAPDGGCKVLEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL SD++++  +   G L     +W    AL VV+A  GYP +Y    +I  +      
Sbjct: 301 MRLRSDLVDLCCAAEEGRLDVVKADWDPRVALGVVMAAGGYPFDYRKDDVIEGLGLAIAP 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +    +   GGRVL  TALGKT+ +++  AY +VE I W   YWR DIG 
Sbjct: 361 GAKVFHAGTRLDGGRVVTAGGRVLCVTALGKTVAQAQAAAYRLVEKIRWPDAYWRRDIGH 420

Query: 412 QKKERNV 418
           +   R V
Sbjct: 421 RAIGRGV 427


>gi|254488045|ref|ZP_05101250.1| phosphoribosylamine--glycine ligase [Roseobacter sp. GAI101]
 gi|214044914|gb|EEB85552.1| phosphoribosylamine--glycine ligase [Roseobacter sp. GAI101]
          Length = 421

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 198/421 (47%), Positives = 276/421 (65%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P   +L   PGN GIA  A C   DI N +A++ F  E
Sbjct: 1   MNILILGSGGREHSLAWAVLQNPKCDKLIVAPGNAGIAAIADCATFDINNGAAVVEFVAE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +ID V++GPE PL  G++D L AAG   FGPS+ AA LE+SK+F K+ C     PTA Y
Sbjct: 61  NNIDFVIIGPEAPLAAGVADDLRAAGVLTFGPSKAAAALEASKAFTKEICDAANAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
            HF+D   A+ Y+ +   PIV+KADGL AGKGV++A T  EA +A+D      F    + 
Sbjct: 121 GHFTDAASARAYLADHPAPIVIKADGLAAGKGVIIAETDAEALAAVDTMFDGTFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E SFF LCDG T +P  TA+DHKR+ DGD GPNTGGMGA SPA  ++  +
Sbjct: 181 VVIEEFMDGEEASFFVLCDGDTVLPIGTAQDHKRVGDGDTGPNTGGMGAYSPAPVLTDAI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT+  M +   P+QGVL+AGLMI +  P L+EYN RFGDPECQ +MMRL 
Sbjct: 241 AERALDEIIRPTMAEMAERGMPYQGVLYAGLMIKDGAPRLVEYNARFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           + + ++L++   G L    +NW  ++A+TVV+A  GYP +Y  G++I  +      +   
Sbjct: 301 AQLFDLLHATAEGRLSEMRVNWAEDHAVTVVMAALGYPGDYAKGSVIGGLDDLPEDSRNM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  +  + ANGGRVL+ TA G+++ E++  AY MV+ IDW  G++R DIG +  
Sbjct: 361 VFHAGTAQQDGQIVANGGRVLNVTARGESLAEAQARAYRMVDAIDWPGGFFRRDIGWRAL 420

Query: 415 E 415
           +
Sbjct: 421 D 421


>gi|289548781|ref|YP_003473769.1| phosphoribosylamine/glycine ligase [Thermocrinis albus DSM 14484]
 gi|289182398|gb|ADC89642.1| phosphoribosylamine/glycine ligase [Thermocrinis albus DSM 14484]
          Length = 430

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 178/420 (42%), Positives = 264/420 (62%), Gaps = 7/420 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G+GGREHA+AWKI QS L   L+S  GN GI + A  V +D  +   I+ F  +
Sbjct: 1   MKVLVVGNGGREHAIAWKILQSDLRPILYSARGNAGIWKIATKVDLDPTDVEGIVRFAVK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID VV+GPE PLV G+ DAL   G   FGP++ AA+LE SK FAK F  KYG+PTA +
Sbjct: 61  EKIDFVVIGPEAPLVEGLVDALEREGVPAFGPNRIAAQLEGSKVFAKNFMAKYGVPTANF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F DP KAK++V++ S P+V+KADGL +GKG +V  T  EA        I + F +   
Sbjct: 121 EVFDDPQKAKRFVEDVSAPLVIKADGLASGKGAIVCRTRQEAIKAIDLLMIRKVFGKAGE 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE+LEG E S+  + +G   IP  T +DHKR+ D D GPNTGGMGA SP   +++E
Sbjct: 181 RIVVEEFLEGEEASYIVMVNGDRYIPLPTTQDHKRLLDNDEGPNTGGMGAYSPNPFITKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   + ++II  T+EG+++E   F+G L+AGLM+T +GP ++E+NVR GDPE QA+++R 
Sbjct: 241 MEERIKKEIIERTLEGLKREGIYFRGFLYAGLMLTSEGPKVLEFNVRLGDPEAQAILLRW 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           +SD+L  L     G   +  +  K  +++ VV+A+KGYPE +  G +I  +        +
Sbjct: 301 KSDMLRDLLDFYQG--KDVTLKVKDCHSICVVIASKGYPESWEKGKVIEGLETVEEDVVI 358

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT  +       GGRVL+  A  K +T ++E  Y+ ++ I ++   +R DIG +  +
Sbjct: 359 FHAGTNELEGKTVTWGGRVLNVCACEKDLTLAKEKVYNAIQKIKFEGMQYRRDIGDRAIK 418


>gi|300690891|ref|YP_003751886.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Ralstonia
           solanacearum PSI07]
 gi|299077951|emb|CBJ50591.1| phosphoribosylglycinamide synthetase (GAR synthetase) [Ralstonia
           solanacearum PSI07]
          Length = 422

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 183/422 (43%), Positives = 262/422 (62%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V+++GSGGREHALAWK+A+SP +  ++  PGN G A   +   + I +   +  F + 
Sbjct: 1   MKVMVVGSGGREHALAWKLARSPKVQVVYVAPGNGGTALDKRLQNVPITDPEVLAAFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   VVGPE PL  G+ D   A G ++FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVHFTVVGPEAPLAAGLVDLFRAKGLRIFGPTRAAAQLESSKDFAKAFMQRHGIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDE-----ATSAIDRCFQQINS 175
           Q FS+  +A  YV  +  PIV+KADGL AGKGVVVA +++E          D       +
Sbjct: 121 QTFSNAAEAHAYVDREGAPIVIKADGLAAGKGVVVAMSLEEAHGAIDMMLADNRLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  +CDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEEFLAGEEASFIVVCDGKDVVAMATSQDHKRLLDGDAGPNTGGMGAYSPAPVVTPT 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPTI GM+K+  P+ G L+AGLMI  +  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVLREIILPTIRGMEKDGIPYTGFLYAGLMIDADGTPKTLEFNCRMGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           +++D+ ++L+  + G L    + W    AL VV+A  GYP+    G  I+ IP+ T  + 
Sbjct: 301 MKTDLFDVLDRAIDGKLDGMELEWDRRTALGVVMAAHGYPDVPRKGDTITGIPRETEDSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  L+ +GGRVL    L  T+  ++  AY  VE I +    +R+DIG +  
Sbjct: 361 TFHAGTTLKDGVLSTSGGRVLCVVGLADTVKAAQRAAYGAVEQIQFDGAQYRKDIGHRAI 420

Query: 415 ER 416
            R
Sbjct: 421 RR 422


>gi|119468078|ref|ZP_01611204.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Alteromonadales bacterium TW-7]
 gi|119448071|gb|EAW29335.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Alteromonadales bacterium TW-7]
          Length = 427

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 271/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQ+  ++ ++  PGN G A     + VAI++++   ++ F 
Sbjct: 1   MNVLVIGSGGREHALAFKAAQNSKVNTVFVAPGNAGTALEPKLENVAINVEDLDGLLKFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ +++L +VGPE+PLV G+ D        +FGP+  AA+LE SKSF K F  ++ IPTA
Sbjct: 61  QQNNVELTIVGPEVPLVLGVVDKFREHDMAIFGPTAGAAQLEGSKSFTKDFLARHDIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F     A  Y++ K  PIV+KADGL AGKGV+VA T  EA  AI        F   
Sbjct: 121 DYQTFEQIDPALAYLKEKGAPIVIKADGLAAGKGVIVAMTHQEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DGK  +PF T++DHKR ++GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGDAGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT+EGM  E +P+ G L+AGLMI     P +IEYN RFGDPE Q MM
Sbjct: 241 NEIHQRIMDEVITPTVEGMASEGHPYTGFLYAGLMIDSSGTPKVIEYNCRFGDPETQPMM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E++ +     L  T I +    A+ VV+A KGYP +YP G  IS +  N   
Sbjct: 301 LRLQSDLVELIEAANREELDKTTIEFDPRAAVGVVLAAKGYPGDYPKGDAISGLKVNYPA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    +++   GGRVL ATALG ++TE+++ AY +V+ I W    +R DI  
Sbjct: 361 DEKVFHAGTKQSGDDVVTAGGRVLCATALGNSVTEAQQRAYELVKQISWDGMEYRTDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|227824854|ref|ZP_03989686.1| phosphoribosylamine-glycine ligase [Acidaminococcus sp. D21]
 gi|226905353|gb|EEH91271.1| phosphoribosylamine-glycine ligase [Acidaminococcus sp. D21]
          Length = 424

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 186/424 (43%), Positives = 263/424 (62%), Gaps = 8/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREH + WK+AQSP + +L++IPG PG+   A+CV +D+ N   +  + + 
Sbjct: 1   MNVLVIGGGGREHTIVWKLAQSPKVKKLYAIPGGPGMMGLAECVPMDVTNLEGLAQWAET 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PLV G+ D   A G K FGP  +AA++E SK F+K+   KY +PTA +
Sbjct: 61  HAIDLTVVGPEAPLVAGLVDVFEAHGLKAFGPKAKAAEIEGSKIFSKELMEKYHVPTAFF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           +      +AK YV+ K  PIV+KADGL AGKGVVVA T  EA  A++    Q +      
Sbjct: 121 KVCDSLDEAKAYVREKGAPIVIKADGLAAGKGVVVAMTEKEALEALEEMMGQEHRFGSAG 180

Query: 177 --VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
             V+IEE++EG E S     DGKT +P   A+DHKR+ DGD GPNTGGMGA +PA  M++
Sbjct: 181 SRVVIEEFMEGEECSLLCFTDGKTIVPMIPAQDHKRVFDGDKGPNTGGMGAYAPAPVMTE 240

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMR 294
            L    +  II P I+ ++KE  P+ G L+AGLMI+     ++E+N RFGDPE QA++  
Sbjct: 241 ALKQKTLDTIIRPVIDALEKEGRPYSGCLYAGLMISGDSIKVVEFNCRFGDPETQAVLPL 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GT 352
            + D+ E++ +C  G L    + WK+  A+ VV+A+ GYP  YP G  I+ + + +    
Sbjct: 301 FDGDLAEVMYACATGTLRPDMVKWKSGAAVCVVMASGGYPGSYPKGIAITGLEEASKLED 360

Query: 353 TQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
             +FHAGT  V+  +  NGGRVL  TA+ +TI +++E AY  VE I ++   +R+DI  +
Sbjct: 361 VVVFHAGTKEVDGQIVTNGGRVLGVTAVDETIAKAKERAYGAVERIHFEGAQYRKDIAWR 420

Query: 413 KKER 416
              R
Sbjct: 421 ALNR 424


>gi|308048134|ref|YP_003911700.1| phosphoribosylamine--glycine ligase [Ferrimonas balearica DSM 9799]
 gi|307630324|gb|ADN74626.1| phosphoribosylamine--glycine ligase [Ferrimonas balearica DSM 9799]
          Length = 428

 Score =  339 bits (870), Expect = 4e-91,   Method: Composition-based stats.
 Identities = 189/424 (44%), Positives = 275/424 (64%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHALAWK+AQ+P + +++  PGN G A   +   + +  + A++ F +E
Sbjct: 2   MKVLVIGSGGREHALAWKVAQNPAVEQVFVAPGNAGTATEPKVENVAVSGNEALVAFARE 61

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             + L +VGPE PLV G+ DA +AAG  +FGP+  AA+LE SK+F K F  ++ IPTA Y
Sbjct: 62  NGVGLTIVGPEAPLVEGVVDAFDAAGLTIFGPTAAAAQLEGSKAFTKDFLARHAIPTAEY 121

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q+F++   A  Y++ K  PIVVKADGL AGKGV+VA T+ EA +A++       F     
Sbjct: 122 QNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLAEAEAAVEDMLAGNAFGDAGH 181

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++Q 
Sbjct: 182 RVVIEEFLEGEEASFIVMVDGDNILPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTQA 241

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           ++  ++ ++I PT++GM+ E +P++G L+AGLMI  +  P +IEYN RFGDPE Q +M+R
Sbjct: 242 IHDRIMAEVIRPTVDGMKAEGHPYKGFLYAGLMIDADGTPKVIEYNCRFGDPETQPIMLR 301

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKI-PQNTGTT 353
           ++SD++E+  +   G L      +    A+ VV+A+ GYP  Y  G  IS +  +     
Sbjct: 302 MQSDLVELCLAACEGKLDQHTAEFDPRAAVGVVLASGGYPASYEKGFAISGLRTEYAEGE 361

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA  +  +   GGRVL ATALG T+TE+++ AY + + I W+  + R DI  + 
Sbjct: 362 KVFHAGTAEQDGAIVNTGGRVLCATALGHTVTEAQQRAYALADQISWQGMFTRRDIAYRA 421

Query: 414 KERN 417
             R 
Sbjct: 422 IARE 425


>gi|302037884|ref|YP_003798206.1| phosphoribosylamine-glycine ligase [Candidatus Nitrospira defluvii]
 gi|300605948|emb|CBK42281.1| Phosphoribosylamine-glycine ligase [Candidatus Nitrospira defluvii]
          Length = 425

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 177/425 (41%), Positives = 260/425 (61%), Gaps = 7/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHA+ WKIAQSP   E++  PGN GI   A CV I   +   +  F  +
Sbjct: 1   MKILVVGGGGREHAMVWKIAQSPRKPEIFCAPGNAGIEGLAICVPIKADDIEGLKAFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI+D    A  K+FGP++ AA+LESSKSF+K       IPTA  
Sbjct: 61  EQIDLTVVGPEAPLALGIADEFRKARLKIFGPTKAAARLESSKSFSKDIMAANRIPTAAA 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F    +A  Y+  + +PIVVKADGL  GKGVVVA T +EAT A+          Q   
Sbjct: 121 RSFERMEQALAYLDEQPVPIVVKADGLAQGKGVVVATTREEATQAVRDAMEKSVFGQAGH 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E++  A  DGKT +P   A+DHKR+ DGD GPNTGGMGA +PA   +  
Sbjct: 181 RVLIEEFLDGEELTLMAFTDGKTVVPMVPAQDHKRVGDGDSGPNTGGMGAYAPAPIATAA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   V ++++ PT++ + +  +PFQGVL+AGLM+ +  PY++E+N R GDPE + ++  L
Sbjct: 241 LREQVTRQVLQPTVDALARLGSPFQGVLYAGLMVVKGTPYVLEFNARMGDPETEVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ- 354
           ++D++E++ + V   L    + W  + A+ VV+ + GYP  YP G  I  +P  +G ++ 
Sbjct: 301 KTDLVEVMEAVVEHRLDELTVEWHPDTAVCVVMTSPGYPGAYPTGLPIQGLPTPSGDSRV 360

Query: 355 -LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT   +  +   GGRVL+ TA G ++ ++R   Y  V +I ++  ++R DI  + 
Sbjct: 361 AVFHAGTKRDSGRVVTAGGRVLAVTAWGPSLLDARAQVYQAVPSIVFEGRHYRTDIAHRA 420

Query: 414 KERNV 418
               +
Sbjct: 421 LPHKI 425


>gi|83590873|ref|YP_430882.1| phosphoribosylamine--glycine ligase [Moorella thermoacetica ATCC
           39073]
 gi|83573787|gb|ABC20339.1| phosphoribosylamine--glycine ligase [Moorella thermoacetica ATCC
           39073]
          Length = 421

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 192/419 (45%), Positives = 267/419 (63%), Gaps = 4/419 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L++G GGREHAL WKIA+SP ++E++  PGN GIA  A CV I   + + ++ F + 
Sbjct: 1   MRILVVGGGGREHALVWKIARSPRVTEIYCAPGNAGIAGLAYCVPIAADDITGLLDFARR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDL VVGPE PLV GI DA  AAG  +FGPS+ AA+LE SK FAK+   + GIPTA +
Sbjct: 61  AAIDLTVVGPEAPLVAGIVDAFQAAGLPIFGPSRGAARLEGSKIFAKELMQEAGIPTAAH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQIN----ST 176
             F++P  A  Y++    P+VVKADGL AGKGVVVA     A +A+   F          
Sbjct: 121 ATFTEPGPALAYLEEHPGPVVVKADGLAAGKGVVVAPDAATARAAVRDMFGGKFGPAGRR 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           VI+EE LEG EVS  ALCDGKTAIP   ++DHKR+ +GD GPNTGGMGA +P    + E+
Sbjct: 181 VILEERLEGEEVSILALCDGKTAIPLLPSQDHKRVGEGDTGPNTGGMGAYAPVPFYTPEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + V ++++ P I  M    +P++GVL+AGLM+T +GP ++E+N RFGDPE Q +M+ L 
Sbjct: 241 AAQVEERVLRPVIRTMAAAGHPYRGVLYAGLMLTREGPKVLEFNCRFGDPETQPLMLLLA 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQLF 356
           SD++E++ + V+G L  T I W    A  VV+A  GYP  Y  G  I+ +       ++F
Sbjct: 301 SDLVELMLAAVNGELAGTRIAWYPGAAAGVVLAAGGYPGPYAKGDFITGLEAVAPGVEVF 360

Query: 357 HAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           HAGTA+V+  +  +GGRV+  TA GK +  + +  Y  +  I ++  ++R DIG +  E
Sbjct: 361 HAGTALVDGQVVTSGGRVVCVTARGKDLRAALDRVYDSIRAIHFQGMHYRRDIGRRALE 419


>gi|77359309|ref|YP_338884.1| phosphoribosylglycinamide synthetase [Pseudoalteromonas
           haloplanktis TAC125]
 gi|76874220|emb|CAI85441.1| phosphoribosylglycinamide synthetase (GAR synthetase)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 429

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 273/426 (64%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQ+  ++ ++  PGN G A     + VAI++ +   ++ F 
Sbjct: 1   MNVLVIGSGGREHALAFKAAQNTKVNTVFVAPGNAGTALEPKLENVAINVDDLDGLLQFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ +++L +VGPE+PLV G+ D     G  +FGP+  AA+LE SKSF K F  ++ IP+ 
Sbjct: 61  QQNNVELTIVGPEIPLVLGVVDKFREHGLAIFGPTAGAAQLEGSKSFTKDFLARHNIPSG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F     A  Y++ K  PIV+KADGL AGKGV+VA T  EA  AI        F   
Sbjct: 121 DYQTFEQVAPALAYLKEKGAPIVIKADGLAAGKGVIVAMTEAEAEDAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DGK  +PF T++DHKR ++GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGDAGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT+EGM  E +P+ G L+AGLMI T+  P +IEYN RFGDPE Q MM
Sbjct: 241 DEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDTDGTPKVIEYNCRFGDPETQPMM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E++ +     L  T I +    A+ VV+A KGYP +YP G +IS +  +   
Sbjct: 301 LRLQSDLVELIEAANRVELDKTTIEFDPRAAVGVVLAAKGYPGDYPKGDVISGLQVDYPA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    N++   GGRVL ATALG T+TE+++ AY +++ + W    +R DI  
Sbjct: 361 GEKVFHAGTKQNGNDVVTAGGRVLCATALGNTVTEAQQRAYELIKQLSWDGMEYRTDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|125973760|ref|YP_001037670.1| phosphoribosylamine--glycine ligase [Clostridium thermocellum ATCC
           27405]
 gi|256004490|ref|ZP_05429469.1| phosphoribosylamine/glycine ligase [Clostridium thermocellum DSM
           2360]
 gi|281417916|ref|ZP_06248936.1| phosphoribosylamine/glycine ligase [Clostridium thermocellum JW20]
 gi|125713985|gb|ABN52477.1| phosphoribosylamine--glycine ligase [Clostridium thermocellum ATCC
           27405]
 gi|255991495|gb|EEU01598.1| phosphoribosylamine/glycine ligase [Clostridium thermocellum DSM
           2360]
 gi|281409318|gb|EFB39576.1| phosphoribosylamine/glycine ligase [Clostridium thermocellum JW20]
 gi|316940047|gb|ADU74081.1| phosphoribosylamine/glycine ligase [Clostridium thermocellum DSM
           1313]
          Length = 419

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 186/419 (44%), Positives = 261/419 (62%), Gaps = 7/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHAL WKI QSP + +++  PGN GI+  A+CV I   +   I++F +E
Sbjct: 1   MKVLVVGSGGREHALVWKIVQSPRVEKVYCAPGNGGISAIAECVPIKAMDIEGIVNFSKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K ID+VVV P+ PL  G+ DAL  AG + FGP++ AA +ESSK+FAK    KY IPTA Y
Sbjct: 61  KKIDMVVVAPDDPLAAGMVDALEEAGIRAFGPNKAAAVIESSKAFAKNLMKKYNIPTARY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F +   A  Y+Q++  P+VVKADGL  GKGV++A   DEA         D+ F +  +
Sbjct: 121 EIFENSADAINYLQDQKYPVVVKADGLALGKGVIIAQNFDEAKQAVQSIMEDKVFGEAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G EVS  A  DGKT     +++DHKR  D D G NTGGMG  SP+   ++E
Sbjct: 181 KVVIEEFLVGQEVSMLAFTDGKTIKTMVSSQDHKRALDNDQGLNTGGMGTFSPSRIYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    +++I  PTIE M+KE   F+GVL+ GL+IT+ GP ++EYN RFGDPE Q ++ RL
Sbjct: 241 IDRYCMERIYKPTIEAMEKEGRKFKGVLYFGLIITKDGPKVLEYNARFGDPETQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
            +DI++I  + +   L    I+W     + V++A+ GYP+EY  G  IS I         
Sbjct: 301 NTDIIDIFEAVIDERLDEVEISWNDSACVCVIMASGGYPKEYKTGYEISGIEDAERDANI 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAGT   N      GGRVL  TA+  T+ E+ + AY  V  I ++  ++R+DIG +
Sbjct: 361 VVFHAGTKRENGKYYTAGGRVLGVTAMENTLDEAIKKAYEGVGKIKFQDMHYRKDIGKK 419


>gi|90415240|ref|ZP_01223174.1| phosphoribosylamine-glycine ligase [marine gamma proteobacterium
           HTCC2207]
 gi|90332563|gb|EAS47733.1| phosphoribosylamine-glycine ligase [marine gamma proteobacterium
           HTCC2207]
          Length = 429

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 194/428 (45%), Positives = 269/428 (62%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK AQS  +  ++  PGN G A+ A  + +A+ I +  A+  F 
Sbjct: 1   MNVLVIGSGGREHALAWKAAQSTDVETVFVAPGNAGSAREAKVENIALGIDDFGALADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
              ++ L +VGPE PLV+GI D  N     +FGPS+ AA+LE SK+F K F  +  IPT 
Sbjct: 61  ASNNVGLTIVGPEQPLVDGIVDFFNQRELPIFGPSKGAAQLEGSKAFTKDFLLRQNIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D  +A  Y+     PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 121 FYQNFTDIAEATAYLHKVGAPIVIKADGLAAGKGVIVAMTLAEAEDAVQDMLAGNAFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+L+G E SF  + DGK  +P  T++DHKR  DGD GPNTGGMGA SPA  + 
Sbjct: 181 GHRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRASDGDTGPNTGGMGAYSPAPVVD 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
             +Y  V+ ++I PT++GM +E N + G L+AGLMI  +  P +IEYN RFGDPE Q ++
Sbjct: 241 DVIYQRVMDEVIYPTVKGMAEEGNDYTGFLYAGLMIMADGTPKVIEYNCRFGDPETQPIL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           MRL+SD++    + + G LH    NW    A+ +V+A  GYP  Y  G  I+ +  +++ 
Sbjct: 301 MRLKSDLVGHCLAALDGGLHKEQANWDPRPAVGIVLAAGGYPGSYTKGDAITGLETESSE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           T ++FHAGTAI +  +  NGGRVL ATALGKT+ ++++ AY +   I++   Y R DI  
Sbjct: 361 TAKVFHAGTAIKDGQVVTNGGRVLCATALGKTVAKAQQAAYEVAAGIEFTGLYKRSDIAW 420

Query: 412 QKKERNVK 419
           +  ER  K
Sbjct: 421 RAIEREQK 428


>gi|238765546|ref|ZP_04626460.1| Phosphoribosylamine--glycine ligase [Yersinia kristensenii ATCC
           33638]
 gi|238696241|gb|EEP89044.1| Phosphoribosylamine--glycine ligase [Yersinia kristensenii ATCC
           33638]
          Length = 428

 Score =  339 bits (869), Expect = 5e-91,   Method: Composition-based stats.
 Identities = 188/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPGLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGSKAFTKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  YV+    PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 FYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEEAETAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDNDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMDQVIWPTVRGMAAEGNVYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G II  +PQ    
Sbjct: 301 LRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDIIHGLPQQEVA 360

Query: 352 TTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  NN++  +GGRVL  TALG T+ ++++ AY + ++I W+  + R+DIG
Sbjct: 361 EGKVFHAGTKLNSNNDVVTSGGRVLCVTALGATVAQAQQNAYKLAKDIQWEGAFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARE 427


>gi|51594654|ref|YP_068845.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           32953]
 gi|170022614|ref|YP_001719119.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           YPIII]
 gi|186893656|ref|YP_001870768.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           PB1/+]
 gi|51587936|emb|CAH19539.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           32953]
 gi|169749148|gb|ACA66666.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           YPIII]
 gi|186696682|gb|ACC87311.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis
           PB1/+]
          Length = 428

 Score =  339 bits (869), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 274/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T++EA +A++       F   
Sbjct: 121 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTLEEAETAVNDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|330501706|ref|YP_004378575.1| phosphoribosylamine--glycine ligase [Pseudomonas mendocina NK-01]
 gi|328915992|gb|AEB56823.1| phosphoribosylamine--glycine ligase [Pseudomonas mendocina NK-01]
          Length = 429

 Score =  339 bits (869), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 263/426 (61%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ   + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDKRVEKVFVAPGNAGTAVEAKCENVAIDVLAIEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE PLV G+ D   + G  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EQN-VQLTIVGPEAPLVKGVVDLFRSRGLDIFGPTAAAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLSEAEDAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDADSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+ ++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHKRVMDEVIYPTVRGMAAEGNVYTGFLYAGLMIDKSGAPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
            RLES ++ ++ + +   L      W     + VV+A  GYP +Y  G +I  + +    
Sbjct: 300 CRLESSLVLLVEAALAKALDKVEATWDPRPTVGVVLAAGGYPGDYAKGDVIEGLDEAAKL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +   GGRVL ATA+G ++ ++++ AY + E I W   + R DIG 
Sbjct: 360 DGKVFHAGTALKDGQIVTAGGRVLCATAIGASVADAQQQAYRLAEKIRWNGMFHRNDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|254672628|emb|CBA06393.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           alpha275]
          Length = 423

 Score =  339 bits (869), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 191/423 (45%), Positives = 263/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  G+ D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGVVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ G++ E   F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGVKAEGYEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDVISGLDAANQVGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|253998092|ref|YP_003050155.1| phosphoribosylamine--glycine ligase [Methylovorus sp. SIP3-4]
 gi|253984771|gb|ACT49628.1| phosphoribosylamine/glycine ligase [Methylovorus sp. SIP3-4]
          Length = 422

 Score =  339 bits (869), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 186/421 (44%), Positives = 268/421 (63%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHALAWK+ Q+P +S ++  PGN G A +   V + + + + ++ F  +
Sbjct: 1   MKVLVIGSGGREHALAWKVTQNPNISRVYVAPGNAGTALNPDMVNVPVSSVADLLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L +VGPE PL  G+ DA  A   K+FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EQIALTIVGPEAPLSQGVVDAFRANDLKIFGPTKAAAQLESSKDFAKAFMIRHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F+D   A  YV+ +  PIV+KADGL AGKGVVVA   DEA +AID            +
Sbjct: 121 ATFTDAAAAHDYVREQGAPIVIKADGLAAGKGVVVAMDEDEAHAAIDAMLADNKLGAAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLTGEEASFIVMVDGKNILPLATSQDHKRLLDGDQGPNTGGMGAYSPAPVVTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II PT+ GM K+  P+ G L+AGLMIT E     +E+N R GDPE Q +M+R
Sbjct: 241 IHAKVMREIIAPTVAGMAKDGIPYTGFLYAGLMITPEGDVKTLEFNCRMGDPETQPIMLR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L++D++ +    V+G L    ++W    AL VV+A   YP+    G  I+ +P++     
Sbjct: 301 LKTDLVGLAEHAVNGTLDQATVDWDRRTALGVVMAAANYPDTPRTGDEITGLPRDLQDAH 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT + +  +  +GGRVL  TALG+T+  ++  AY + E I +     R+DIG +  
Sbjct: 361 VFHAGTRLEDGRVLTSGGRVLCVTALGETVKYAQSRAYQIAEEIRFDGAQMRKDIGYRAV 420

Query: 415 E 415
           +
Sbjct: 421 K 421


>gi|330963421|gb|EGH63681.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 431

 Score =  339 bits (868), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 184/426 (43%), Positives = 268/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLTEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G +I  +      
Sbjct: 300 LRLQSSLVLLIEAALAQALDKVEAQWDPRPSLGIVLAAGGYPGDYAKGAVIEGLDAAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R DIG 
Sbjct: 360 EGKVFHAGTTLQDDRVVTSGGRVLCATALGDSVGSAQKNAYALAAKVDWQGCFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|149185203|ref|ZP_01863520.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. SD-21]
 gi|148831314|gb|EDL49748.1| phosphoribosylamine-glycine ligase [Erythrobacter sp. SD-21]
          Length = 425

 Score =  339 bits (868), Expect = 6e-91,   Method: Composition-based stats.
 Identities = 206/422 (48%), Positives = 277/422 (65%), Gaps = 5/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWK+AQSP   +LW  PGNPG+ + AQCVA+D  +H+A++ FC+E
Sbjct: 1   MNILLLGSGGREHALAWKVAQSPRCDKLWVSPGNPGMEECAQCVALDSSDHAAVVKFCEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             + LVV+GPE+PLV G++D+L  A    FGPS+ AA+LE SKSF K+ C + GIPTA +
Sbjct: 61  NAVQLVVIGPEVPLVEGLADSLKTADILSFGPSKAAAQLEGSKSFTKELCQRAGIPTARF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           +  +    A   ++    P V+KADGL AGKGVV+A T DEA  A+       F    S 
Sbjct: 121 ERCTSLEAAWGALKKFDAPFVLKADGLAAGKGVVIAETRDEAQEALSEMFDGKFGSAGSE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IE++L G E SFFAL DG+T +P  +A+DHKR+ DGD GPNTGGMGA SPA  ++  L
Sbjct: 181 VVIEQFLTGEEASFFALTDGETIVPLASAQDHKRVGDGDEGPNTGGMGAYSPAPVLTDTL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               I++II PT+  M++E  P+ GVL+AGLM+T  GP LIEYNVRFGDPECQ +MMRLE
Sbjct: 241 REQAIREIIEPTVRTMREEGMPYSGVLYAGLMLTNTGPQLIEYNVRFGDPECQVLMMRLE 300

Query: 297 SDILE-ILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           SD++E +L                 ++ALTVV+A +GYP     G  I          ++
Sbjct: 301 SDLVELMLACAKRRLGEIEAPKMSDDFALTVVMAAEGYPGTPKKGGSIDLGKAEANGAKV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT+   + L ++GGRVL+ TA G + TE++  AY  V+ ID+  G+ R DIG ++  
Sbjct: 361 FHAGTSREGDQLVSSGGRVLNVTAKGSSATEAQRAAYAAVDAIDFADGFCRRDIGQREVR 420

Query: 416 RN 417
           R 
Sbjct: 421 RE 422


>gi|330873662|gb|EGH07811.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 431

 Score =  339 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 268/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNILIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLTEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G +I  +      
Sbjct: 300 LRLQSSLVLLIEAALAQALDKVEAQWDPRPSLGIVLAAGGYPGDYAKGAVIEGLDAAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R DIG 
Sbjct: 360 EGKVFHAGTTLQDDRVVTSGGRVLCATALGDSVGSAQKNAYALAAKVDWQGCFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|313200157|ref|YP_004038815.1| phosphoribosylamine/glycine ligase [Methylovorus sp. MP688]
 gi|312439473|gb|ADQ83579.1| phosphoribosylamine/glycine ligase [Methylovorus sp. MP688]
          Length = 422

 Score =  339 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 186/421 (44%), Positives = 268/421 (63%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHALAWK+ Q+P +S ++  PGN G A +   V + + + + ++ F  +
Sbjct: 1   MKVLVIGSGGREHALAWKVTQNPNISRVYVAPGNAGTALNPDMVNVPVSSVADLLEFALK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L +VGPE PL  G+ DA  A   K+FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EQIALTIVGPEAPLSQGVVDAFRANDLKIFGPTKAAAQLESSKDFAKAFMIRHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F+D   A  YV+ +  PIV+KADGL AGKGVVVA   DEA +AID            +
Sbjct: 121 ATFTDAAAAHDYVRAQGAPIVIKADGLAAGKGVVVAMDEDEAHAAIDAMLADNKLGAAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLTGEEASFIVMVDGKNILPLATSQDHKRLLDGDQGPNTGGMGAYSPAPVVTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II PT+ GM K+  P+ G L+AGLMIT E     +E+N R GDPE Q +M+R
Sbjct: 241 IHAKVMREIIAPTVAGMAKDGIPYTGFLYAGLMITPEGDVKTLEFNCRMGDPETQPIMLR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L++D++ +    V+G L    ++W    AL VV+A   YP+    G  I+ +P++     
Sbjct: 301 LKTDLVGLAEHAVNGTLDQATVDWDRRTALGVVMAAANYPDTPRTGDEITGLPRDLQDAH 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT + +  +  +GGRVL  TALG+T+  ++  AY + E I +     R+DIG +  
Sbjct: 361 VFHAGTRLEDGRVLTSGGRVLCVTALGETVKYAQSRAYQIAEEIRFDGAQMRKDIGYRAV 420

Query: 415 E 415
           +
Sbjct: 421 K 421


>gi|330960011|gb|EGH60271.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 431

 Score =  339 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 183/426 (42%), Positives = 267/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  V ID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVNIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EQN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM +E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVMDLVIWPTVRGMAEEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G +I  +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKVEARWDPRPSLGIVLAAGGYPGDYAKGAVIEGLDAAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ ++ +  +GGRVL ATALG ++  ++  AY +   ++W+  ++R DIG 
Sbjct: 360 EGKVFHAGTALQDDRVVTSGGRVLCATALGDSVGSAQNNAYALASKVNWEGCFYRNDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|307730384|ref|YP_003907608.1| phosphoribosylamine/glycine ligase [Burkholderia sp. CCGE1003]
 gi|307584919|gb|ADN58317.1| phosphoribosylamine/glycine ligase [Burkholderia sp. CCGE1003]
          Length = 432

 Score =  339 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 183/423 (43%), Positives = 260/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI    A+  F ++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQLVYVAPGNGGTAQDERLRNVDITELDALADFVEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI +   + G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIAFTLVGPEAPLAAGIVNLFRSRGLKIFGPTREAAQLESSKDFAKAFMKRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F+D   A  Y+  K  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFADVAAAHAYLDAKGAPIVIKADGLAAGKGVVVAQTLEEAHAAVDMMLADNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKHVLPLASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPT+ GM+KE   + G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIILPTVRGMEKEGIRYTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D  +++   + G L    + W    AL VV+A   YP+    G  I+ IP  T  + 
Sbjct: 301 LKGDYSKVVEQAIAGTLDTVELEWDRRTALGVVLAAHNYPDTPRKGDRINDIPAETADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  L  +GGRVL    L  ++  ++ +AY  +  I +    +R DIG +  
Sbjct: 361 TFHAGTTLTDGKLLTSGGRVLCVVGLADSVRSAQSVAYETINQISFDGMQYRRDIGYRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|254477088|ref|ZP_05090474.1| phosphoribosylamine--glycine ligase [Ruegeria sp. R11]
 gi|214031331|gb|EEB72166.1| phosphoribosylamine--glycine ligase [Ruegeria sp. R11]
          Length = 421

 Score =  339 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 199/421 (47%), Positives = 273/421 (64%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A C A DI++  A+ +F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIADCAAFDIEDGGAVANFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG  VFGPS+ AAKLE+SKSF K+ C     PTA Y
Sbjct: 61  NAIDFVIIGPEAPLAAGVADRLREAGLLVFGPSEAAAKLEASKSFTKEICDAANAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
            HF+D   AK +V+    P VVKADGL AGKGV++A +  EA  AID  F          
Sbjct: 121 GHFTDAEAAKAHVRQHGAPTVVKADGLAAGKGVIIAMSEAEAIDAIDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   +A+DHKR+ +GD GPNTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLVDGENVLAIGSAQDHKRVGEGDTGPNTGGMGAYSPAPVLSAEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT++ M +   P+QGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EARAMEEIVKPTMKVMAERGMPYQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           +  L+++ +   G L    +NW  ++A+TVV+A  GYP  Y  G+ I  +      +   
Sbjct: 301 AQALDLMQAAAEGRLGEAQVNWADDHAITVVMAAAGYPGSYEKGSEIKGLDTLPEDSSNM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT   +  + A GGRVL+ TA G T+ E+R+ AY MV+ +DW  G++R DIG +  
Sbjct: 361 VFHAGTKAEDGKVLAVGGRVLNVTARGDTLQEARDRAYAMVDGVDWPQGFFRRDIGWRAL 420

Query: 415 E 415
           +
Sbjct: 421 K 421


>gi|15677964|ref|NP_275136.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis MC58]
 gi|20139757|sp|Q9JXA3|PUR2_NEIMB RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|7227409|gb|AAF42459.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis MC58]
 gi|316984514|gb|EFV63480.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis H44/76]
 gi|325139461|gb|EGC62001.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis CU385]
 gi|325201187|gb|ADY96642.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis H44/76]
          Length = 423

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 194/423 (45%), Positives = 264/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G IIS +       +
Sbjct: 301 LNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDIISGLDAANQIGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|108809593|ref|YP_653509.1| phosphoribosylamine--glycine ligase [Yersinia pestis Antiqua]
 gi|108810402|ref|YP_646169.1| phosphoribosylamine--glycine ligase [Yersinia pestis Nepal516]
 gi|153950785|ref|YP_001402795.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           31758]
 gi|153997237|ref|ZP_02022344.1| phosphoribosylamine--glycine ligase [Yersinia pestis CA88-4125]
 gi|165928312|ref|ZP_02224144.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938184|ref|ZP_02226743.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166012044|ref|ZP_02232942.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166214394|ref|ZP_02240429.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167402425|ref|ZP_02307885.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167422936|ref|ZP_02314689.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426824|ref|ZP_02318577.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|218930734|ref|YP_002348609.1| phosphoribosylamine--glycine ligase [Yersinia pestis CO92]
 gi|229837476|ref|ZP_04457638.1| phosphoribosylamine-glycine ligase [Yersinia pestis Pestoides A]
 gi|229839411|ref|ZP_04459570.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229899973|ref|ZP_04515113.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900578|ref|ZP_04515704.1| phosphoribosylamine-glycine ligase [Yersinia pestis Nepal516]
 gi|270488933|ref|ZP_06206007.1| phosphoribosylamine--glycine ligase [Yersinia pestis KIM D27]
 gi|294505400|ref|YP_003569462.1| phosphoribosylamine--glycine ligase [Yersinia pestis Z176003]
 gi|20139500|sp|Q8ZAR2|PUR2_YERPE RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|108774050|gb|ABG16569.1| phosphoribosylamine--glycine ligase [Yersinia pestis Nepal516]
 gi|108781506|gb|ABG15564.1| phosphoribosylamine--glycine ligase [Yersinia pestis Antiqua]
 gi|115349345|emb|CAL22316.1| phosphoribosylamine--glycine ligase [Yersinia pestis CO92]
 gi|149289345|gb|EDM39424.1| phosphoribosylamine--glycine ligase [Yersinia pestis CA88-4125]
 gi|152962280|gb|ABS49741.1| phosphoribosylamine--glycine ligase [Yersinia pseudotuberculosis IP
           31758]
 gi|165913845|gb|EDR32463.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165919651|gb|EDR36984.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165989039|gb|EDR41340.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166204398|gb|EDR48878.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166957147|gb|EDR55168.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167048205|gb|EDR59613.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167054206|gb|EDR64031.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|229682398|gb|EEO78488.1| phosphoribosylamine-glycine ligase [Yersinia pestis Nepal516]
 gi|229686958|gb|EEO79034.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695777|gb|EEO85824.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229704164|gb|EEO91175.1| phosphoribosylamine-glycine ligase [Yersinia pestis Pestoides A]
 gi|262363466|gb|ACY60187.1| phosphoribosylamine--glycine ligase [Yersinia pestis D106004]
 gi|262367394|gb|ACY63951.1| phosphoribosylamine--glycine ligase [Yersinia pestis D182038]
 gi|270337437|gb|EFA48214.1| phosphoribosylamine--glycine ligase [Yersinia pestis KIM D27]
 gi|294355859|gb|ADE66200.1| phosphoribosylamine--glycine ligase [Yersinia pestis Z176003]
 gi|320013671|gb|ADV97242.1| phosphoribosylamine-glycine ligase [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 428

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T +EA +A++       F   
Sbjct: 121 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|302059947|ref|ZP_07251488.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           tomato K40]
          Length = 431

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 267/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            E ++ L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  +  IPTA
Sbjct: 61  -ENNVSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARQKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLTEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G II  +      
Sbjct: 300 LRLQSSLVLLIEAALAQALDKVEAQWDPRPSLGIVLAAGGYPGDYAKGAIIEGLDAAALL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R DIG 
Sbjct: 360 EGKIFHAGTTLQDDRVVTSGGRVLCATALGDSVGSAQKNAYALAAKVDWQGCFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|261393463|emb|CAX51109.1| phosphoribosylamine--glycine ligase (GARS; glycinamide
           ribonucleotide synthetase; phosphoribosylglycinamide
           synthetase) [Neisseria meningitidis 8013]
          Length = 423

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 191/423 (45%), Positives = 264/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RIVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   P+ IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPHTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDVISGLDAANQVGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|28871982|ref|NP_794601.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|37999557|sp|Q87VR8|PUR2_PSESM RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|28855235|gb|AAO58296.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 431

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 268/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            E ++ L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  -ENNVSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLTEAEDAVQDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G II  +      
Sbjct: 300 LRLQSSLVLLIEAALAQALDKVEAQWDPRPSLGIVLAAGGYPGDYAKGAIIEGLDAAALL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R DIG 
Sbjct: 360 EGKIFHAGTTLQDDRVVTSGGRVLCATALGDSVGSAQKNAYALAAKVDWQGCFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|282883185|ref|ZP_06291784.1| phosphoribosylamine--glycine ligase [Peptoniphilus lacrimalis
           315-B]
 gi|281296997|gb|EFA89494.1| phosphoribosylamine--glycine ligase [Peptoniphilus lacrimalis
           315-B]
          Length = 416

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 171/415 (41%), Positives = 243/415 (58%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG+GGRE+ALAWKI++S  + +++   GN G    A  V I   +   ++ F ++
Sbjct: 1   MKVLIIGTGGRENALAWKISKSKNIDKIYMAKGNGGSQDFATNVDISPTDIDGLLDFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI D       K+FGP +  A+ E SK F KKF  KY IPTA Y
Sbjct: 61  EKIDLTVVGPEDPLCAGIVDKFKENNLKIFGPDKACARFEGSKEFTKKFLEKYNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F D   AK  ++  S P+V+KADGLC GKGV +     EA        ID+ F+    
Sbjct: 121 KSFIDYDSAKNSLEEFSYPLVIKADGLCLGKGVFICQDKKEALESLEKIFIDKIFKDQGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+GFE S   +       P  T +DHK+I DG++GPNTGG+G  SP    SQ+
Sbjct: 181 KVVIEEFLKGFEASLLCIVSNNKLFPLQTCKDHKQIFDGNMGPNTGGVGTYSPGDKFSQK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               + +KI+     G  KE+  + G+LF G MI    P ++E+NVRFGDPE + +M RL
Sbjct: 241 TEEEI-RKILKGIEIGFNKEKISYYGILFIGFMIENDIPKVLEFNVRFGDPETEVLMPRL 299

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           + D+LEI+   +   L    I WK E +LT ++ + GYP  Y  G  I+ + +  G   +
Sbjct: 300 KGDLLEIMMKTLDNTLSEDDIKWKDEVSLTTILCSGGYPNSYQKGKEITGLDKVDGDVII 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FH GT   +     +GGRVLS T+LGK + E+R+  Y  +E I+++  Y+R+DIG
Sbjct: 360 FHNGTVKKDGKYYTDGGRVLSVTSLGKDLIEARKKVYKNIEKINFQDMYYRKDIG 414


>gi|315127808|ref|YP_004069811.1| phosphoribosylglycinamide synthetase [Pseudoalteromonas sp. SM9913]
 gi|315016322|gb|ADT69660.1| phosphoribosylglycinamide synthetase [Pseudoalteromonas sp. SM9913]
          Length = 428

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 194/426 (45%), Positives = 272/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQ+  ++ ++  PGN G A     + VAI++++   ++ F 
Sbjct: 1   MNVLVIGSGGREHALAFKAAQNTKVNTVYVAPGNAGTALEPKLENVAINVEDLDGLLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+ +++L +VGPE+PLV G+ D     G  +FGP+  AA+LE SKSF K F  ++ IPTA
Sbjct: 61  QKNNVELTIVGPEVPLVLGVVDKFREHGLAIFGPTAGAAQLEGSKSFTKDFLARHAIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F     A  Y++ K  PIV+KADGL AGKGV+VA    EA  AI        F   
Sbjct: 121 DYQTFEQIDPALAYLKEKGAPIVIKADGLAAGKGVIVAMDEREAEEAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+LEG E SF  + DGK  +PF T++DHKR ++GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLEGEEASFIVMVDGKNVLPFATSQDHKRAYNGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT+EGM  E +P+ G L+AGLMI +   P +IEYN RFGDPE Q MM
Sbjct: 241 DEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDDTGTPKVIEYNCRFGDPETQPMM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E++ +     L  T I + +  A+ VV+A KGYP+ YP G  IS +      
Sbjct: 301 LRLQSDLVELIEAANRVELDKTTIEFDSRAAVGVVLAAKGYPDNYPKGDAISGLKVTYPE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    +N+   GGRVL ATALG T+T++++ AY +V+ I W    +R DI  
Sbjct: 361 GEKVFHAGTKQDGDNVVTAGGRVLCATALGNTVTQAQQRAYKLVDEISWDGMEYRTDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|269137543|ref|YP_003294243.1| phosphoribosylamine-glycine ligase [Edwardsiella tarda EIB202]
 gi|267983203|gb|ACY83032.1| phosphoribosylamine-glycine ligase [Edwardsiella tarda EIB202]
 gi|304557617|gb|ADM40281.1| Phosphoribosylamine--glycine ligase [Edwardsiella tarda FL6-60]
          Length = 425

 Score =  338 bits (867), Expect = 8e-91,   Method: Composition-based stats.
 Identities = 191/425 (44%), Positives = 269/425 (63%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQSPL   ++  PGN G A     + + I   +  A++ F 
Sbjct: 1   MNILIIGSGGREHALAWKAAQSPLAERVFVAPGNAGTALEPALENIDIAATDIDALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
               + L +VGPE PLV G+ DA  AAG  +FGPSQ AA+LE SK+F+K F  +  IPTA
Sbjct: 61  LRHQVGLTIVGPEAPLVLGVVDAFRAAGLPIFGPSQSAARLEGSKAFSKDFLARQRIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  YV+ +  PIV+KADGL AGKGV+VA T +EA +A+        F   
Sbjct: 121 AYRNFTEVEPALAYVREQGAPIVIKADGLAAGKGVIVAMTREEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+LEG E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  +S
Sbjct: 181 GHRIVIEEFLEGEEASFIVMVDGEHVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
             ++  V++++I PT+ GM +E  P+ G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DAVHQRVMEQVIWPTVRGMAQEGAPYTGFLYAGLMISADGAPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR++SD++ +  +  +G L      W    AL VV+A  GYP +Y  G +I  + Q T  
Sbjct: 301 MRMQSDLVALCLAGANGTLDQQSSAWDPRPALGVVLAAGGYPGDYRQGDVIHGLTQGTAQ 360

Query: 353 TQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGT +     +   GGRVL ATALG+ I E++  AY + + + W+ G+ R DIG 
Sbjct: 361 AKVFHAGTRLNAQGEVETCGGRVLCATALGEDIAEAQRNAYRLADALSWEGGFCRRDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RALQR 425


>gi|238028184|ref|YP_002912415.1| phosphoribosylamine--glycine ligase [Burkholderia glumae BGR1]
 gi|237877378|gb|ACR29711.1| Hypothetical protein bglu_1g26360 [Burkholderia glumae BGR1]
          Length = 425

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 180/423 (42%), Positives = 264/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ A+   I++ +   +  F + 
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQTVYVAPGNGGTAQDARLKNIELSSLDDLADFAEA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   +VGPE PL  GI +   + G KVFGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EQVAFTLVGPEAPLAAGIVNHFRSRGLKVFGPTREAAQLESSKDFAKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F+D   A  Y+  K  PIVVKADGL AGKGVVVA +++EA  A+D            +
Sbjct: 121 ETFTDAAAAHAYLDAKGAPIVVKADGLAAGKGVVVAMSLEEAHEAVDMMLSGNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF  + DGK A+   +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLDGEEASFIVMVDGKHALALASSQDHKRLLDGDRGPNTGGMGAYSPAPIITPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II+PT+ GM+ +   F G L+AGLMI  +  P  +E+N R GDPE Q +M R
Sbjct: 241 MHARVMREIIMPTVRGMENDGIRFTGFLYAGLMIDKDGNPRTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD  +++   + G L    ++W    AL VV+A  GYP+    G  I+ +P+ T    
Sbjct: 301 LKSDFSKVVEQAIAGTLDTVELDWDRRTALGVVLAAHGYPDTPRKGDRINGVPEETAHAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT    + L  +GGRVL    L  ++  +++ AY  +  I+++   +R DIG +  
Sbjct: 361 TFHAGTRFDGDKLVTSGGRVLCVVGLSDSVRGAQQAAYDAINQINFEGMQYRRDIGHRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 ARK 423


>gi|212709051|ref|ZP_03317179.1| hypothetical protein PROVALCAL_00083 [Providencia alcalifaciens DSM
           30120]
 gi|212688340|gb|EEB47868.1| hypothetical protein PROVALCAL_00083 [Providencia alcalifaciens DSM
           30120]
          Length = 428

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 267/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG GGREHALAWK AQSPL  +++  PGN G A     + V I   +   ++ F 
Sbjct: 1   MNILIIGGGGREHALAWKAAQSPLADKVYVAPGNAGTALEPALENVDISATDIDGLLQFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++K + L +VGPE PLV G+ DA   AG  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KDKQVGLTIVGPEAPLVIGVVDAFKQAGLTIFGPTQGAAQLEGSKAFTKDFLARHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  Y+     PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 AYENFTEIEPALAYLDKVGAPIVIKADGLAAGKGVIVAMTLQEAKDAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  IP  T++DHKR+ DGD G NTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGENVIPMATSQDHKRVGDGDTGLNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V++++I PT++GM +E N +QG L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 241 DEVHQRVMEQVIYPTVKGMDQEGNRYQGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           MRL+SD++ +  +   G L      W    AL VV+A  GYP +Y +G +IS +P +   
Sbjct: 301 MRLQSDLVALCLAGAKGELAGKDSLWDERPALGVVIAAGGYPGDYRNGDVISGLPTSEAA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
            +++FHAGT +     +   GGRVL  TALG  I +++  AY + + I+W   ++R DIG
Sbjct: 361 DSKVFHAGTKLNQAGEVVTAGGRVLCVTALGNDIAKAQAKAYEVAKTINWSGSFYRNDIG 420

Query: 411 LQKKER 416
            +   R
Sbjct: 421 YRAIAR 426


>gi|162418161|ref|YP_001605069.1| phosphoribosylamine--glycine ligase [Yersinia pestis Angola]
 gi|162350976|gb|ABX84924.1| phosphoribosylamine--glycine ligase [Yersinia pestis Angola]
          Length = 428

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 272/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T +EA +A++       F   
Sbjct: 121 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGGNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|22124416|ref|NP_667839.1| phosphoribosylamine--glycine ligase [Yersinia pestis KIM 10]
 gi|45442846|ref|NP_994385.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Microtus str. 91001]
 gi|21957200|gb|AAM84090.1|AE013651_3 phosphoribosylglycinamide synthetase [Yersinia pestis KIM 10]
 gi|45437712|gb|AAS63262.1| phosphoribosylamine--glycine ligase [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 436

 Score =  338 bits (867), Expect = 9e-91,   Method: Composition-based stats.
 Identities = 189/427 (44%), Positives = 273/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 9   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 68

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 69  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 128

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T +EA +A++       F   
Sbjct: 129 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDA 188

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 189 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 248

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 249 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 308

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 309 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 368

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  NGGRVL  TALG+T+ ++++ AY + E I W+  + R+DIG
Sbjct: 369 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALGETVAQAQQYAYQLAEGIQWEGVFCRKDIG 428

Query: 411 LQKKERN 417
            +   R 
Sbjct: 429 YRAIARG 435


>gi|171463874|ref|YP_001797987.1| phosphoribosylamine--glycine ligase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171193412|gb|ACB44373.1| phosphoribosylamine--glycine ligase [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 425

 Score =  338 bits (867), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 180/425 (42%), Positives = 260/425 (61%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH----AQCVAIDIQNHSAIIH 56
           M++LLIGSGGREHALAWK+AQSP +  ++  PGN G A      A    + I     +  
Sbjct: 1   MKILLIGSGGREHALAWKLAQSPQVQTVYVAPGNGGTATAKHATASIENLPITGLQELAD 60

Query: 57  FCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIP 116
           F + + I L VVGPE PL  GI D     G ++FGP+Q AA+LESSK F+K F  ++GIP
Sbjct: 61  FAKREKIHLTVVGPEAPLAAGIVDVFRNNGLRIFGPTQLAAQLESSKDFSKAFMKRHGIP 120

Query: 117 TATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----Q 171
           TA YQ FS+ ++A  Y+  K  PIVVKADGL AGKGVVVA +++EA +A+D         
Sbjct: 121 TADYQTFSNALEAHAYIDAKGAPIVVKADGLAAGKGVVVAMSLEEAHAAVDMMLADNKLG 180

Query: 172 QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG 231
              + V+IEE+L G E SF  L DGK  +   T++DHKR+ D D GPNTGGMGA SP   
Sbjct: 181 NAGARVVIEEFLTGEEASFIVLVDGKNVLALATSQDHKRLLDADQGPNTGGMGAYSPTPV 240

Query: 232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQA 290
           ++ E+++  ++++I+PT++GMQ +  P+ G L+AGLMI  +     +E+N R GDPE Q 
Sbjct: 241 VTPEIHACALREVIMPTVKGMQADGIPYTGFLYAGLMIAPDGKIKTLEFNCRMGDPETQP 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           +M RL +D++  L+  + G L+   + W    AL VV+A   YP+    G +I+ IP +T
Sbjct: 301 IMARLRNDLVNALDHAIDGTLNEVELEWDRRTALGVVLAAHNYPDTPRAGDVITGIPADT 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
                FHAGT + +  +  +GGRV+    L  T+  +++ AY  + +I +    +R+DIG
Sbjct: 361 EDQLTFHAGTKLQDGKVVTSGGRVMCVVGLADTVRGAQQKAYDAINHIQFDGMQYRKDIG 420

Query: 411 LQKKE 415
            +  +
Sbjct: 421 YRAIK 425


>gi|260433214|ref|ZP_05787185.1| phosphoribosylamine--glycine ligase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417042|gb|EEX10301.1| phosphoribosylamine--glycine ligase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 420

 Score =  338 bits (867), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 202/420 (48%), Positives = 273/420 (65%), Gaps = 6/420 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P    L   PGN GIAQ A C A+DI+N SA++ F +E
Sbjct: 1   MNILILGSGGREHSLAWAVMQNPKCDRLIVAPGNAGIAQIADCAALDIENGSAVVSFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V++GPE PL  G++D L  AG  VFGPS  AA+LE+SKSF K+ C   G PTA Y
Sbjct: 61  NAIDFVIIGPEAPLAAGVADRLREAGILVFGPSAEAARLEASKSFTKEICDAAGAPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
             F++   AK Y++ +  PIVVKADGL AGKGV+VA     A  A+D  F          
Sbjct: 121 ARFTEAEPAKAYIRQQGAPIVVKADGLAAGKGVIVAMDEATALEAVDDMFGGAFGGAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE+++G E S F LCDG+  +   TA+DHKR+ +GD G NTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMDGEEASLFVLCDGENILSAGTAQDHKRVGEGDTGLNTGGMGAYSPAPVLSSEI 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               +++I+ PT+  M++   PFQGVL+AGLMI +  P L+EYNVRFGDPECQ +MMRL 
Sbjct: 241 EERAMEQIVRPTMAEMKRRGTPFQGVLYAGLMIKDGQPRLVEYNVRFGDPECQVLMMRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           +  L+++++   G L    +NW  ++A+TVV+A KGYP  Y  G+ I  + +    +   
Sbjct: 301 AQALDLMHAAAEGRLDEARVNWADDHAMTVVMAAKGYPGAYEKGSEIKGLDKLPEDSRNM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGT      + A GGRVL+ TA G T+ E+R+ AY MVE IDW  G++R DIG +  
Sbjct: 361 VFHAGTKEEGGAILAVGGRVLNVTARGATLREARDNAYAMVEAIDWPGGFYRRDIGWRAL 420


>gi|118581003|ref|YP_902253.1| phosphoribosylamine--glycine ligase [Pelobacter propionicus DSM
           2379]
 gi|118503713|gb|ABL00196.1| phosphoribosylamine--glycine ligase [Pelobacter propionicus DSM
           2379]
          Length = 423

 Score =  338 bits (867), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 185/423 (43%), Positives = 256/423 (60%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREHAL WKIAQSPL+ +++  PGNPG A  A+ + I       ++ F   
Sbjct: 1   MKILVVGGGGREHALVWKIAQSPLVKKVYCAPGNPGTAGLAENLPIRADEVGKLLEFAWN 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI D       K+FGP Q+AA +E SK+F+K    KY +PTA Y
Sbjct: 61  EGIDLTVVGPEQPLSLGIVDTFENHDLKIFGPHQQAALIEGSKAFSKDLMRKYNVPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             FSD  +A+ ++    +PIV+KADGL AGKGV++A T  EA   +        F    S
Sbjct: 121 GVFSDIGEAEAFIDRTGLPIVIKADGLAAGKGVIIAQTRQEAVDTVTDMLSGNAFGSAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF A+ DGK  IP  +A+DHK I DGD GPNTGGMGA SPA  +++E
Sbjct: 181 RVVIEEFLTGEEASFLAITDGKNIIPLASAQDHKAIFDGDQGPNTGGMGAYSPAPVVTRE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           ++   ++ ++ PT++GM  E  P++GVL+AGLM+ +     +E+N RFGDPECQ ++MR+
Sbjct: 241 IHEIAMRDVLRPTVDGMAAEGRPYRGVLYAGLMVKDGKVKTLEFNARFGDPECQPLLMRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           +SDI+ +L +   G++    I W    A+ VV+A +GYP EY  G  IS +         
Sbjct: 301 KSDIVPLLLAAASGDISGMDIEWHDRAAVCVVMAAEGYPGEYRKGDAISGLADAAKLDDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA        NGGRVL  TA+  T+ ++   AY     I W    +R DIG + 
Sbjct: 361 YVFHAGTAQDGGRCVTNGGRVLGVTAMDDTVEQAIARAYQAASVISWPGVQFRTDIGRKA 420

Query: 414 KER 416
             R
Sbjct: 421 IGR 423


>gi|288940559|ref|YP_003442799.1| phosphoribosylamine/glycine ligase [Allochromatium vinosum DSM 180]
 gi|298286851|sp|Q46482|PUR2_ALLVD RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|288895931|gb|ADC61767.1| phosphoribosylamine/glycine ligase [Allochromatium vinosum DSM 180]
          Length = 428

 Score =  338 bits (867), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 181/426 (42%), Positives = 266/426 (62%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M++L++GSGGREHALAWK AQSP + +++  PGN G A     + VAI   + + ++ F 
Sbjct: 1   MKILIVGSGGREHALAWKAAQSPQVEQVFVAPGNGGTASEPGVENVAIAADDIAGLVEFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           + + I L +VGPE PLV G+ DA   AG   FGP Q +A+LE SK+FAK F  ++GIPTA
Sbjct: 61  RRESIGLTIVGPEAPLVLGLVDAFAEAGLPCFGPRQASAQLEGSKAFAKDFLHRHGIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y  F++   A  Y++    P+VVKADGL AGKGV++A  +  A +A+        F + 
Sbjct: 121 AYGVFTELEPALAYLRQVGAPVVVKADGLAAGKGVILADDLATAEAAVHDMLGGGRFGRA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L G E SF A+ DG+  +P  +++DHK   DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLTGEEASFIAMVDGRHILPLASSQDHKARDDGDRGPNTGGMGAYSPAPIVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  ++++++ PT+ G+  E  P+ G L+AGLMI  +  P ++E+N R GDPE Q ++
Sbjct: 241 PEIHDRIMREVMEPTVAGLAAEGLPYLGFLYAGLMIGADGTPKVLEFNCRLGDPETQPLL 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           MRL+SD++E+  + + G L     +W A  AL VV+A  GYP++Y  G +IS +    + 
Sbjct: 301 MRLQSDLVELCLAALDGRLDQVTADWDARPALGVVMAAGGYPDDYETGHVISGLDAVPSS 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++F AGT    + +  NGGRVL  TALG  + E++ LAY  V+ I W   + R DIG 
Sbjct: 361 EAKVFQAGTRCEGDAILTNGGRVLCVTALGANVAEAQHLAYQAVDRIQWTDAFCRRDIGH 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|171058635|ref|YP_001790984.1| phosphoribosylamine--glycine ligase [Leptothrix cholodnii SP-6]
 gi|170776080|gb|ACB34219.1| phosphoribosylamine--glycine ligase [Leptothrix cholodnii SP-6]
          Length = 427

 Score =  338 bits (867), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 187/427 (43%), Positives = 264/427 (61%), Gaps = 11/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+V++IGSGGREHA+AWK+AQSP + +++  PGN G A+H Q V + +   S +  F Q 
Sbjct: 1   MKVMVIGSGGREHAIAWKLAQSPKVQKVFVAPGNGGTARHGQIVNMPLTGVSELADFAQS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D     G ++FGP+Q AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  EKIGLTVVGPEGPLAAGVVDEFRRRGLRIFGPTQAAAQLESSKAFSKDFMRRHGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC---------FQ 171
           + FSD   A  YV     PIVVKADGL AGKGVVVA T++EA  A+D             
Sbjct: 121 ETFSDVAAAHAYVDRLGAPIVVKADGLAAGKGVVVATTLEEAHQAVDWMLLDNSLGVTHN 180

Query: 172 QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG 231
              + V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  
Sbjct: 181 AGGARVVIEEFLDGEEASFIVMVDGRNILPLATSQDHKRVGDGDTGPNTGGMGAYSPAPV 240

Query: 232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQA 290
           ++  +++ V+ +II PT++GM ++  PF G L+AGLMI  +     +E+N R GDPE Q 
Sbjct: 241 VTPNVHARVMHEIIQPTVDGMARDGIPFTGFLYAGLMIDARGHAKTLEFNTRLGDPETQP 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           ++MRL+SD++++      G L    ++W    AL VV+A  GYP+    G  I  +P  T
Sbjct: 301 ILMRLKSDLVDVFMHATSGTLDQVQLDWDRRVALGVVLAAAGYPQSPRKGDTIRGLPAET 360

Query: 351 GTTQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
               +FHAGT       +  +GGRVL  TALG ++  +++ AY     I +   ++R DI
Sbjct: 361 EDCMVFHAGTTTGPTGEVLTSGGRVLCVTALGDSVRTAQQRAYQGAHGIQFDGMHYRHDI 420

Query: 410 GLQKKER 416
           G +  +R
Sbjct: 421 GYRAIKR 427


>gi|49473990|ref|YP_032032.1| phosphoribosylamine--glycine ligase [Bartonella quintana str.
           Toulouse]
 gi|49239493|emb|CAF25846.1| Phosphoribosylamine-glycine ligase [Bartonella quintana str.
           Toulouse]
          Length = 424

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 226/423 (53%), Positives = 297/423 (70%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LLIGSGGREHALAWKIA+SPLL++L+  PGNP   +  + + ++I +H  +I FC+ 
Sbjct: 1   MNILLIGSGGREHALAWKIAKSPLLTKLYCAPGNPATIELGENIDLNIDDHLLVIDFCKM 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGPE PLV GI+D+LN A   VFGP+Q+AA+LE SK+F K  C K  IPTATY
Sbjct: 61  HSIDLVIVGPEAPLVAGITDSLNNANICVFGPTQKAAQLEGSKAFTKDLCRKNNIPTATY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINST---- 176
           Q F+D  KAK Y+  + +PIV+KADGL AGKGVVVA T++EA SA+D CF+  ++     
Sbjct: 121 QCFNDAAKAKAYIHQQGVPIVIKADGLAAGKGVVVAMTMEEAFSAVDACFKSTSNDVGEK 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           ++IE +LEG E SFF LCDGK A+PF +A+DHKR+ DGD G NTGGMGA SPA  M+QE+
Sbjct: 181 IVIESFLEGEEASFFCLCDGKIALPFGSAQDHKRVGDGDTGANTGGMGAYSPAPIMTQEM 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ P +  M +   PF+G+LF GLMIT++GP LIE+NVRFGDPECQ +MMRL+
Sbjct: 241 VNRTLKEIVEPALRSMDEMGAPFKGILFVGLMITQKGPELIEFNVRFGDPECQVLMMRLQ 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTTQ 354
            DIL IL     GNL N  + W  + ALTVV+A  GYP     GT+I  + +       +
Sbjct: 301 DDILPILLGAAQGNLENKPLQWSEKTALTVVMAANGYPNSPQKGTVIRNVDKVNALPDVK 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +F AGT + N  L ANGGRVLS TA G+TIT++++ AY  V+ IDW  G+ R DIG +  
Sbjct: 361 VFQAGTILCNGELIANGGRVLSITATGETITKAQKRAYEAVDYIDWPEGFVRHDIGWRAV 420

Query: 415 ERN 417
            R 
Sbjct: 421 VRE 423


>gi|87198198|ref|YP_495455.1| phosphoribosylamine--glycine ligase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87133879|gb|ABD24621.1| phosphoribosylamine--glycine ligase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 429

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 218/424 (51%), Positives = 290/424 (68%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+GSGGREHALAWK+AQSPL  +L++ PGNPGIAQHA  VA+D+ +H++++ FC+ 
Sbjct: 1   MNILLLGSGGREHALAWKLAQSPLTGKLYAAPGNPGIAQHADLVALDLTDHASVVTFCET 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVVVGPE PLV+G++D+L AAGF VFGPS+ AA+LE SK F K  C +  IPTA Y
Sbjct: 61  NRIGLVVVGPEAPLVDGLTDSLRAAGFSVFGPSRAAAQLEGSKGFTKDLCARADIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
                  +A+  +     P+V+KADGL AGKGVVVA T++EA +A+D      F    + 
Sbjct: 121 VRAKSLEEARAALAEFGAPVVIKADGLAAGKGVVVAMTMEEAEAAVDDMFDGAFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EE+L G E SFFAL DG T +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL
Sbjct: 181 VVVEEFLTGEEASFFALTDGATIVPFASAQDHKRVGDGDTGPNTGGMGAYSPARVLTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  + +II PT++ M  E  P+ GVL+AGLM+TEQGP LIEYN RFGDPECQ +MMRLE
Sbjct: 241 EAQALSQIIAPTVKAMADEGMPYSGVLYAGLMLTEQGPKLIEYNARFGDPECQVLMMRLE 300

Query: 297 SDILEILNSCVHGNLHNTHINWK-AEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQ 354
           SD++E+L +C    L +        E A+TVV+A +GYP     G  I  IP    G  +
Sbjct: 301 SDLVELLLACADNKLSSIQPPRFSNEVAMTVVMAAQGYPGTPKKGGRIDHIPAAEAGGAK 360

Query: 355 LFHAGTAIVNNNLTA-NGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGT +  + + + NGGRVL+ TA G T+  +R+ AY  V+ I +  G+ R DIG ++
Sbjct: 361 VFHAGTVLSGDGVLSANGGRVLNVTAKGPTVKSARDAAYAAVDAISFPEGFCRRDIGWRE 420

Query: 414 KERN 417
            ER 
Sbjct: 421 IERE 424


>gi|160938634|ref|ZP_02085986.1| hypothetical protein CLOBOL_03529 [Clostridium bolteae ATCC
           BAA-613]
 gi|158438333|gb|EDP16092.1| hypothetical protein CLOBOL_03529 [Clostridium bolteae ATCC
           BAA-613]
          Length = 428

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 183/423 (43%), Positives = 266/423 (62%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHA+AWKI+QSP + +L+  PGN GIA+ A+CV I + +   ++ F  E
Sbjct: 1   MKVLIVGGGGREHAIAWKISQSPKVEKLYCAPGNAGIAKVAECVDIGVMDFEKLVAFAGE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDLVVVGP+ PL  G  DA   AG +VFGP + AA LE+SK+F+K    KY IP+A Y
Sbjct: 61  QAIDLVVVGPDDPLAAGAVDAFENAGIRVFGPRKNAAILEASKAFSKDLMKKYNIPSAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F  P  A  Y++   MPIV+KADGL  GKGV++ +T +EA        +D+ F     
Sbjct: 121 ETFDSPEAALAYLETAPMPIVLKADGLALGKGVLICSTREEAKEGVKTLMLDKQFGSAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            ++IEE++ G EVS  +  DGKT    T+A+DHKR  DGD G NTGGMG  SP+   + E
Sbjct: 181 RIVIEEFMTGREVSVLSFVDGKTIKIMTSAQDHKRAKDGDQGLNTGGMGTFSPSPFYTDE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + +   + +  PT++ M+ E   F+G++F GLM+TE GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 VDAFCRKYVYQPTVDAMKAEGREFKGIIFFGLMLTENGPKVLEYNARFGDPETQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           ++DI+++  +CV G L    + ++   A+ VV+A+ GYPE Y  G  I  + +       
Sbjct: 301 KNDIVDVFEACVDGTLDQIELEFEDNAAVCVVLASDGYPEHYDKGYKIDGLDRFDGQDGY 360

Query: 354 QLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAG+    + N+  NGGRVL  TA G T+ E+RE AY   E +++ + Y R DIG +
Sbjct: 361 YVFHAGSRFDKDGNIVTNGGRVLGVTAKGNTLKEARENAYKATEWVEFGNKYMRHDIG-K 419

Query: 413 KKE 415
             +
Sbjct: 420 AID 422


>gi|213968000|ref|ZP_03396146.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           tomato T1]
 gi|301383684|ref|ZP_07232102.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           tomato Max13]
 gi|302131613|ref|ZP_07257603.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|213927343|gb|EEB60892.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           tomato T1]
          Length = 431

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 268/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            E ++ L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  -ENNVSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLTEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPIM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G II  +      
Sbjct: 300 LRLQSSLVLLIEAALAQALDKVEAQWDPRPSLGIVLAAGGYPGDYAKGAIIEGLDAAALL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R DIG 
Sbjct: 360 EGKIFHAGTTLQDDRVVTSGGRVLCATALGDSVGSAQKNAYALAAKVDWQGCFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|56696230|ref|YP_166587.1| phosphoribosylamine--glycine ligase [Ruegeria pomeroyi DSS-3]
 gi|56677967|gb|AAV94633.1| phosphoribosylamine--glycine ligase [Ruegeria pomeroyi DSS-3]
          Length = 420

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 198/420 (47%), Positives = 269/420 (64%), Gaps = 6/420 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREHALAW + Q+P   +L   PGN GIAQ A+C  +DI +   +  F +E
Sbjct: 1   MNILILGSGGREHALAWAVMQNPKCDKLIVAPGNAGIAQIAECAELDIMDGGLVATFAEE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AGF VFGPS  AA+LE+SKSF K+ C   G PTA Y
Sbjct: 61  NAIDFVIVGPEAPLAAGVADRLREAGFLVFGPSAAAARLEASKSFTKEICDAAGAPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
             F+    AK Y++ +  PIV+KADGL AGKGV+VA     A  AID      F    + 
Sbjct: 121 ARFTQAGPAKDYIRAQGAPIVIKADGLAAGKGVIVAMDEATALEAIDDMLGGAFGDAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E S F L DG+  +   TA+DHKR+ +GD GPNTGGMGA SPA  +S E+
Sbjct: 181 VVIEEFMEGEEASLFVLVDGEEVLSIGTAQDHKRVGEGDTGPNTGGMGAYSPAPVLSAEV 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            +  +++I+ PT+  M +   PFQGVL+ GLMI +  P L+EYNVRFGDPECQ +M+RL 
Sbjct: 241 EARAMEEIVKPTMAEMARRGVPFQGVLYVGLMIKDGAPRLVEYNVRFGDPECQVLMLRLG 300

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTT--Q 354
           +  ++++++   G L    +NW  ++A+TVV+A  GYP  Y  G+ I  +      +   
Sbjct: 301 AQAMDLMHATAEGRLREARVNWAEDHAITVVMAANGYPGSYQKGSEIKGLDTLPEDSRNM 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA     + A GGRVL+ TA G ++ E+R+ AY MVE IDW  G++R DIG +  
Sbjct: 361 VFHAGTAAREGAIVATGGRVLNVTARGDSLAEARDRAYAMVEAIDWPGGFYRRDIGWRAL 420


>gi|150388756|ref|YP_001318805.1| phosphoribosylamine--glycine ligase [Alkaliphilus metalliredigens
           QYMF]
 gi|149948618|gb|ABR47146.1| phosphoribosylamine--glycine ligase [Alkaliphilus metalliredigens
           QYMF]
          Length = 419

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 177/415 (42%), Positives = 256/415 (61%), Gaps = 5/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG+GGREHA+ WK+ QSP + E++  PGNPGI + A+ V ID  +   ++ F +E
Sbjct: 1   MKVLVIGNGGREHAIIWKLNQSPDVKEIFCAPGNPGIGKIAKNVDIDPDDIQKLVEFSRE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            +IDL +VGPE PLV GI +    +G K+ GPS  AA+LE SKSFAK F  KY IPTA  
Sbjct: 61  INIDLTIVGPEAPLVEGIVEVFQESGLKIIGPSSHAAQLEGSKSFAKAFLKKYKIPTALS 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSA-----IDRCFQQINS 175
              +D  + K  + N + P+V+KADGL  GKGV +  +  EA         +    +   
Sbjct: 121 HEVTDLAEGKSILSNYTFPVVIKADGLAGGKGVFICQSEGEAIEQLRLLLEENVLGKAGQ 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+LEG EVS     DGKT  P  +++DHK+I +G+ GPNTGGMG C+P L  ++E
Sbjct: 181 RVVIEEFLEGIEVSILCFVDGKTIKPMISSQDHKQIFEGNRGPNTGGMGTCAPNLLYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   V ++I++PT+ G+Q E+  ++G++F G+M+T +GP ++EYNVRFGDPE Q ++  L
Sbjct: 241 IAKRVEKEILMPTLGGIQAEEMDYRGIIFVGIMLTNEGPKVLEYNVRFGDPETQVVLPCL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+L I      G L    I W+  YAL VV+A+KGYPE+Y     I+ I +      L
Sbjct: 301 KTDLLSIFLHVESGRLGELEIQWQDAYALCVVLASKGYPEDYEKNKEITGIEKIEDEILL 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FH+GT      L  NGGRVL  T + +    +++  Y  ++ I +    +R DIG
Sbjct: 361 FHSGTVEREGKLYTNGGRVLGVTVVAENQKVAQKKVYENIDKIHYHGKTYRRDIG 415


>gi|218767260|ref|YP_002341772.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis Z2491]
 gi|20139756|sp|Q9JWU6|PUR2_NEIMA RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|121051268|emb|CAM07544.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis Z2491]
 gi|319411466|emb|CBY91882.1| phosphoribosylamine-glycine ligase (GARS; glycinamide
           ribonucleotide synthetase; phosphoribosylglycinamide
           synthetase) [Neisseria meningitidis WUE 2594]
          Length = 423

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 191/423 (45%), Positives = 264/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  G+ D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGVVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   P+ IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPHTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDVISGLDAANQVGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|330817836|ref|YP_004361541.1| hypothetical protein bgla_1g29740 [Burkholderia gladioli BSR3]
 gi|327370229|gb|AEA61585.1| hypothetical protein bgla_1g29740 [Burkholderia gladioli BSR3]
          Length = 425

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 180/423 (42%), Positives = 264/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ A+   I++ +   +  F + 
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQTVYVAPGNGGTAQDARLKNIELSSLDDLADFAEN 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   +VGPE PL  GI +     G KVFGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EQVAFTLVGPEAPLAAGIVNHFRQRGLKVFGPTKEAAQLESSKDFAKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F++   A  Y+  K  PIVVKADGL AGKGVVVA +++EA  A+D            +
Sbjct: 121 ETFTEAAAAHAYIDAKGAPIVVKADGLAAGKGVVVAMSLEEAHEAVDMMLSGNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF  + DGK A+   +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLDGEEASFIVMVDGKHALALASSQDHKRLLDGDRGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II+PT+ GM+ +   F G L+AGLMI  +  P  +E+N R GDPE Q +M R
Sbjct: 241 MHARVMREIIMPTVRGMENDGIRFTGFLYAGLMIDKDGNPRTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD  +++   + G L    + W    AL VV+A  GYP+    G  I+ IP+  G + 
Sbjct: 301 LKSDFSKVVEQAIAGTLDTVELEWDRRTALGVVLAAHGYPDAPRKGDRINDIPEENGHSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT+   + L  +GGRVL    L  ++  +++ AY  +  I+++   +R DIG +  
Sbjct: 361 TFHAGTSFDGDKLVTSGGRVLCVVGLSDSVRGAQQAAYDAINQINFEGMQYRRDIGHRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|307824228|ref|ZP_07654454.1| phosphoribosylamine/glycine ligase [Methylobacter tundripaludum
           SV96]
 gi|307734608|gb|EFO05459.1| phosphoribosylamine/glycine ligase [Methylobacter tundripaludum
           SV96]
          Length = 426

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 193/424 (45%), Positives = 278/424 (65%), Gaps = 9/424 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M++L++GSGGREHALAWK  QS  + +++  PGN G A     + +AI + + +A++ F 
Sbjct: 1   MKILIVGSGGREHALAWKAKQSAKVEKVFVAPGNAGTALEPSVENIAIAVDDIAALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q++ IDL ++GPE+PLV GI D    AG K FGP+ +AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QQQAIDLTIIGPEVPLVLGIVDRFQEAGLKCFGPTAKAAQLEGSKTFCKDFMIRHNIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F+D  +A  Y++ +  PIVVKADGL AGKGV+VA T  EA +A++       F + 
Sbjct: 121 KYQSFTDKQQAIDYIKQQGAPIVVKADGLAAGKGVIVAQTEQEAIAAVEDMLSGNVFGEA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V++EE+L G E SF  + DGK A+P  T++DHK   +GD GPNTGGMGA SPA  ++
Sbjct: 181 GNRVVVEEFLTGEEASFIVIADGKHALPMATSQDHKARDNGDQGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            E++  V++ +I PT++GM ++  P+ G L+AGLMI+ +    ++EYN RFGDPE Q +M
Sbjct: 241 PEIHDKVMRDVIEPTLKGMAEDGLPYTGFLYAGLMISADGSVKVLEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           MRL+SD++E+  + + GNL NT  +W    AL VV+A  GYP+ Y  G +IS +P     
Sbjct: 301 MRLKSDLVELCEAALAGNLDNTTSDWDERAALGVVLAAGGYPDAYQSGAVISGLPAEEHE 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            +++FHA T  V N+L   GGRVL A ALG  I E++  AY +   I W + Y+R DIG 
Sbjct: 361 DSKVFHAATKQVGNDLVTTGGRVLCACALGHDIKEAQSKAYKLANGIHWDNVYYRTDIGF 420

Query: 412 QKKE 415
           +  +
Sbjct: 421 KAIK 424


>gi|330887991|gb|EGH20652.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 431

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 270/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVMDLVIWPTVRGMADESNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G +I  +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKIEAQWDPRPSLGIVLAAGGYPGDYAKGAVIEGLEAAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R+DIG 
Sbjct: 360 EGKIFHAGTALQDDRVVTSGGRVLCATALGDSVGNAQQNAYALAAKVDWQGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|326316864|ref|YP_004234536.1| phosphoribosylamine--glycine ligase [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323373700|gb|ADX45969.1| Phosphoribosylamine--glycine ligase [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 426

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 185/425 (43%), Positives = 268/425 (63%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG GGREHA+AWK++QSP +++++  PGN G A +++   I + +  A+  + QE
Sbjct: 1   MKVLVIGGGGREHAMAWKLSQSPKVTKVYVAPGNGGTALNSKLENIPVTDVRALRAWAQE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D   A G ++FGP++ AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  QKIQLTVVGPEAPLAAGVVDEFRAHGLRIFGPTKAAAQLESSKAFSKAFMRRHGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC---------FQ 171
             F+DP  A  ++     PIVVKADGL AGKGVVVA T  EA  A+D             
Sbjct: 121 DTFTDPALAHAFIDRLGAPIVVKADGLAAGKGVVVAMTAQEAHDAVDFMLVDNKYGVSHN 180

Query: 172 QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG 231
           +  + V+IE++LEG E SF  LCDGK      T++DHKR+ DGD GPNTGGMGA SPA  
Sbjct: 181 EGGARVVIEQFLEGEEASFIVLCDGKNVAALATSQDHKRLKDGDQGPNTGGMGAYSPAPV 240

Query: 232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQA 290
           ++ ++++  +++IILPTI GM+K+  P+ G L+AGLMI  +  P  +E+N R GDPE Q 
Sbjct: 241 VTADVHARAMREIILPTIRGMEKDGIPYTGFLYAGLMIDAKGHPKTLEFNCRMGDPETQP 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           ++MRL+SD++++L + V G L    + W    AL VV+A  GYPE    G  I+ +P + 
Sbjct: 301 ILMRLKSDLVDVLGAGVDGKLDQVELQWDRRPALGVVMAAHGYPESPRKGDAITGLPADA 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
               +FHAGT + +  +   GGRVL  TAL  ++  +++  Y +   I +    +R DIG
Sbjct: 361 DDAMVFHAGTELQDGVVRTTGGRVLCVTALADSVKLAQQRVYDVARGIHFDGAQYRRDIG 420

Query: 411 LQKKE 415
            +  +
Sbjct: 421 HRAVK 425


>gi|226310194|ref|YP_002770088.1| phosphoribosylamine--glycine ligase [Brevibacillus brevis NBRC
           100599]
 gi|226093142|dbj|BAH41584.1| phosphoribosylamine--glycine ligase [Brevibacillus brevis NBRC
           100599]
          Length = 425

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 185/428 (43%), Positives = 265/428 (61%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++G GGREH +AWK+ QS  +++++  PGN G AQ AQ V I + + +A++ F ++
Sbjct: 1   MKILVVGGGGREHTIAWKLLQSSKVTKVYCAPGNGGTAQIAQNVPIGVHDFAALVQFVKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL+ GI D        ++GP+Q+AA +E SKSFAK    +Y IPT+ Y
Sbjct: 61  EGIDLTVVGPEDPLLAGIVDFFQERNLPIYGPNQKAAMIEGSKSFAKSLMKRYEIPTSAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F D   A  YV+ +  PIVVKADGL AGKGVVVA TV+EA  A+ +        +  +
Sbjct: 121 ESFLDYESASAYVREQGAPIVVKADGLAAGKGVVVAETVEEAEEALRQIMQESVFGEAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE + G E+S  +  DG+T  P  T++DHKRI + D GPNTGGMG  +P   MS E
Sbjct: 181 RVVIEECMFGEELSLLSFVDGETVKPMITSQDHKRIFNEDRGPNTGGMGTYAPVPQMSAE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L   +++ I+ P   GM K+  PF+G+L+ GLMITEQGP ++E+N RFGDPE Q ++  L
Sbjct: 241 LVDEIVKTIVQPMASGMAKDGIPFKGILYTGLMITEQGPKVVEFNARFGDPETQVLLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           E+D+L+I    ++G L    + W+   A+ VV+A  GYP EYP G +I  + Q      +
Sbjct: 301 ETDLLDIFVGTINGELDAVDVTWQKGSAVCVVMAAPGYPGEYPKGALIHGLGQANEGATV 360

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKE 415
           FHAGT      +  +GGRVL   A G  + ++RE AY  V+ I +    +R DI  +   
Sbjct: 361 FHAGTKETEEGIVTSGGRVLGVVATGADLAQARETAYAKVQGISFDGAQYRTDIAARA-- 418

Query: 416 RNVKYRNK 423
             +KY+ K
Sbjct: 419 --MKYQQK 424


>gi|254804055|ref|YP_003082276.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           alpha14]
 gi|254667597|emb|CBA03355.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           alpha14]
          Length = 423

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 193/423 (45%), Positives = 263/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   I +  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIALTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIAFTVVGPEAPLAAGIVDEFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLGNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNHVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E   F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGYEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLADLVEAAIDGKLDSVTAEWNPQTAVGVVLAAQNYPETPKKGDVISGLDAANQIGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVVQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|147421|gb|AAA24455.1| purD (EC 6.3.4.13) [Escherichia coli]
          Length = 429

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 190/427 (44%), Positives = 274/427 (64%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHA  WK AQSPL+  ++  PGN G A     Q VAI + +  A++ F 
Sbjct: 1   MKVLVIGNGGREHAWRWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + IDL +VGPE PLV G+ D   AAG K+FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAVAAQLEGSKAFTKDFLARHKIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T++EA +A+        F   
Sbjct: 121 EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L+G E SF  + DG+  +P  T++DHKR+ D D GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++   +++II PT++GM  E N + G L+AGLMI +Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP-QNTG 351
           +R++SD++E+  +     L      W    +L VV+A  GYP +Y  G +I  +P +   
Sbjct: 301 LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA 360

Query: 352 TTQLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  +  +  NGGRVL  TALG T+ E+++ AY ++ +I W   + R+DIG
Sbjct: 361 GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG 420

Query: 411 LQKKERN 417
            +  ER 
Sbjct: 421 WRAIERE 427


>gi|20807088|ref|NP_622259.1| phosphoribosylamine--glycine ligase [Thermoanaerobacter
           tengcongensis MB4]
 gi|25091076|sp|Q8RC54|PUR2_THETN RecName: Full=Phosphoribosylamine--glycine ligase; AltName:
           Full=GARS; AltName: Full=Glycinamide ribonucleotide
           synthetase; AltName: Full=Phosphoribosylglycinamide
           synthetase
 gi|20515579|gb|AAM23863.1| Phosphoribosylamine-glycine ligase [Thermoanaerobacter
           tengcongensis MB4]
          Length = 417

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 166/415 (40%), Positives = 256/415 (61%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHA+  K++QS  + +++  PGN GI Q A+CV I ++    +  F  +
Sbjct: 1   MKVLVVGGGGREHAIVHKLSQSDRVEKIYCAPGNAGIGQLAECVNISVEEIEKLKEFALQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID+ +VGPELPLV GI D     G K+FGPS++AA +E SK FAK+   KY IPT  +
Sbjct: 61  NKIDITIVGPELPLVEGIVDEFERTGLKIFGPSKKAAMIEGSKYFAKQIMAKYEIPTGRF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F    +A ++++    P+V+KADGL  GKGV +     EA          R F     
Sbjct: 121 KAFDRYQEALKFLKETWYPVVIKADGLAQGKGVFIVRDFIEAKEVLDLMMKKRVFGPSGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            VI+EE L G E S FA  DG+  +   TA D+K++++ D GPNTGGMG+ +P   + ++
Sbjct: 181 IVIVEEMLYGKEASIFAFVDGENVLTMMTAMDYKKVYEKDEGPNTGGMGSIAPNPHIDKK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
             + + +KI+ P +  ++KE   ++GVL+AGLM+T++GP ++E+N RFGDPE QA++  L
Sbjct: 241 TLNEIEEKILKPVVYALKKEGIVYKGVLYAGLMLTKEGPKVLEFNARFGDPETQAILPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D LEI+ + + G L N  + W+ + A+ V+ A+KGYP EY  G  I  + +      +
Sbjct: 301 KTDFLEIIEATLEGKLKNLKLEWEDKKAVCVIAASKGYPGEYKKGFEIRGLEEVKE-AFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           +HAGT+  +  +  +GGRV    ALG +  E+RE+AY  +E I ++  Y+R+DI 
Sbjct: 360 YHAGTSFKDGKIVTSGGRVFGIVALGDSYKEAREIAYREIEKISFEGIYYRKDIA 414


>gi|302185205|ref|ZP_07261878.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           syringae 642]
          Length = 431

 Score =  338 bits (866), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 187/426 (43%), Positives = 269/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VALTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G +I  +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKIEAQWDPRPSLGIVMAAGGYPGDYAKGAVIEGLDAAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ +  +  +GGRVL ATALG T+ +++E AY +   +DW+  ++R+DIG 
Sbjct: 360 EGKIFHAGTALQDERVVTSGGRVLCATALGDTVGKAQENAYALAAKVDWQGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|288576076|ref|ZP_05978146.2| phosphoribosylamine--glycine ligase [Neisseria mucosa ATCC 25996]
 gi|288566352|gb|EFC87912.1| phosphoribosylamine--glycine ligase [Neisseria mucosa ATCC 25996]
          Length = 444

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 192/423 (45%), Positives = 263/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   I +  H  +I FC++
Sbjct: 22  MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIALTAHQDLIEFCRK 81

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 82  ENIAFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 141

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 142 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLGNKMGNAGA 201

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++  
Sbjct: 202 RVVIEDFLQGEEASFIVMVDGNHVLPMATSQDHKRLLDDDKGPNTGGMGAYSPAPVVTPA 261

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 262 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 321

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 322 LNSDLSDLVEAAIDGKLDSVTAEWNPQTAVGVVLAAQNYPETPKKGDVISGLDAANQIGK 381

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 382 VFHAGTTANEKGDVLTNGGRVLCVVGLGDDVAQAKAKAYGALEKISFDGMQYRKDIADKA 441

Query: 414 KER 416
             R
Sbjct: 442 INR 444


>gi|163797949|ref|ZP_02191891.1| phosphoribosylamine--glycine ligase [alpha proteobacterium BAL199]
 gi|159176743|gb|EDP61314.1| phosphoribosylamine--glycine ligase [alpha proteobacterium BAL199]
          Length = 424

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 211/423 (49%), Positives = 269/423 (63%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL++GSGGREHAL W I+ SPL+  L+  PGN GIA+ A CV I + +   ++ F Q 
Sbjct: 1   MRVLVVGSGGREHALCWAISASPLVDALYCAPGNAGIAREATCVPIPVDDLDGLVAFAQS 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + ID VVVGPE PLV G+ D L  AG K FGP+  AA LE SK+F K FC ++ IPTA Y
Sbjct: 61  ERIDFVVVGPEGPLVAGLVDRLTDAGIKAFGPTAAAAALEGSKAFTKDFCARHNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
             F+D   AK Y++ +  PIVVKADGL AGKGVVVA T+D+A +A+D         +  +
Sbjct: 121 GRFTDADAAKTYIRQQGAPIVVKADGLAAGKGVVVAETLDDALAAVDAMMADKAFGEAGT 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE++ G E SFFAL DG++ +P   A+DHKR+ DGD GPNTGGMGA SPA  +   
Sbjct: 181 EIVVEEFMTGEEASFFALADGESVLPLAGAQDHKRVGDGDTGPNTGGMGAYSPAPVVDHA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +   ++ +II PT+ GM+ E   F+GVLFAGLMI   GP LIEYN RFGDPECQA+MMRL
Sbjct: 241 MAKRIMAEIIEPTVAGMKSEGRTFKGVLFAGLMIGPDGPRLIEYNARFGDPECQALMMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQ 354
           +SD+L  L +   G L +  + W    AL VV+A  GYP +Y  GT I          T 
Sbjct: 301 KSDLLPALIAVSDGQLAHVDLRWDDRAALCVVMAANGYPGDYRKGTEIFGADAAETDGTV 360

Query: 355 LFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGT    +  L A GGRVL  TALG    E+   AY  V+ IDW  G+ R DIG + 
Sbjct: 361 VFHAGTTRDPDGRLRAIGGRVLGVTALGADAAEAGRRAYAAVDRIDWPSGFCRRDIGWRA 420

Query: 414 KER 416
             R
Sbjct: 421 VAR 423


>gi|298370471|ref|ZP_06981787.1| phosphoribosylamine--glycine ligase [Neisseria sp. oral taxon 014
           str. F0314]
 gi|298281931|gb|EFI23420.1| phosphoribosylamine--glycine ligase [Neisseria sp. oral taxon 014
           str. F0314]
          Length = 423

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 194/423 (45%), Positives = 269/423 (63%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G +   +   + +  H+ +I FC++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPKVETVFVAPGNAGTSIEPKLKNLTLTAHADLIDFCKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +HI   VVGPE PL  GI D   A G K FGP+Q AA+LESSK FAK F  KYGIPTA Y
Sbjct: 61  EHIAFTVVGPEAPLAAGIVDDFRAEGLKAFGPTQYAAQLESSKDFAKAFMKKYGIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +  KA +YV  K  PIV+KADGL AGKGVVVAAT+ EA  AID            +
Sbjct: 121 QTFENAEKAHEYVNQKGAPIVIKADGLAAGKGVVVAATLHEAHVAIDDMLLGNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ D D GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGDNVLPMATSQDHKRLLDDDCGPNTGGMGAYSPAPVVTSD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   PY +E+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVNGMKAEGHKFTGFLYAGLMIDKTGAPYTVEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD++++L + + G L++T   W  + A+ VV+A + YP+    G II+ + +     +
Sbjct: 301 LNSDLVDLLEAAIDGKLNSTIAEWNPQTAVGVVLAAENYPDTPKKGDIITGLDEADRIGK 360

Query: 355 LFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGTA+  N  +  NGGRVL    LG  +  ++  AY  V+ I +    +R+DI  + 
Sbjct: 361 VFHAGTALNENGKVVTNGGRVLCVVGLGDNVAAAKTKAYQAVQKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|308390231|gb|ADO32551.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           alpha710]
 gi|325135373|gb|EGC57994.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis M0579]
 gi|325203124|gb|ADY98578.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           M01-240149]
 gi|325207045|gb|ADZ02498.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           M04-240196]
 gi|325208993|gb|ADZ04445.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis
           NZ-05/33]
          Length = 423

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 192/423 (45%), Positives = 264/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  G+ D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGVVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLADLVEAAIDGKLDSVAAEWNPQTAVGVVLAAQNYPETPKKGDVISGLDAANQVGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|289625296|ref|ZP_06458250.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289647821|ref|ZP_06479164.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           aesculi str. 2250]
          Length = 431

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 270/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G +I  +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKIEAQWDPRPSLGIVLAAGGYPGDYAKGAVIEGLEAAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R+DIG 
Sbjct: 360 EGKIFHAGTALQDDRVVTSGGRVLCATALGDSVGNAQQNAYALAAKVDWQGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|222110897|ref|YP_002553161.1| phosphoribosylamine--glycine ligase [Acidovorax ebreus TPSY]
 gi|221730341|gb|ACM33161.1| phosphoribosylamine/glycine ligase [Acidovorax ebreus TPSY]
          Length = 428

 Score =  337 bits (865), Expect = 1e-90,   Method: Composition-based stats.
 Identities = 188/425 (44%), Positives = 271/425 (63%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK++QSP  S+++  PGN G A   +   + I + +A+  + Q 
Sbjct: 1   MKILVIGGGGREHALAWKLSQSPKTSKVYVAPGNGGTALSPKYENVPISDVTALREWAQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D     G ++FGP+Q AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  QKIALTVVGPEAPLAAGVVDEFRTHGLRIFGPTQAAAQLESSKAFSKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC---------FQ 171
           + F+DP  A  YV     PIV+KADGL AGKGVVVA T+ EA  A+D             
Sbjct: 121 ETFTDPQAAHAYVNRLGAPIVIKADGLAAGKGVVVAMTLQEAHDAVDFMLVDNKYGVAHN 180

Query: 172 QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG 231
           +  + V+IE++LEG E SF  LCDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  
Sbjct: 181 EGGARVVIEQFLEGEEASFIVLCDGKNVLALATSQDHKRLKDGDQGPNTGGMGAYSPAPV 240

Query: 232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQA 290
           ++ ++++  ++++ILPTI GM+K+  P+ G L+AGLMI     P  +E+N R GDPE Q 
Sbjct: 241 VTADVHARAMREVILPTIRGMEKDGIPYTGFLYAGLMIDATGHPKTLEFNCRMGDPETQP 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           ++MRL+SD++E+L + V G L    + W    AL VV+A +GYPE    G  I+ +PQ+ 
Sbjct: 301 ILMRLKSDLVEVLGAAVDGKLDQVELQWDRRTALGVVMAAQGYPENPRKGDAITGLPQDA 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
               +FHAGT +V+  +  +GGRVL  TAL  ++ ++++  Y +   I +    +R DIG
Sbjct: 361 DDAMVFHAGTQLVDGVVRTSGGRVLCVTALADSVKQAQQRVYDVARGIHFDGAQYRHDIG 420

Query: 411 LQKKE 415
            +  +
Sbjct: 421 HRAVK 425


>gi|330989160|gb|EGH87263.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 431

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 270/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 AEVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G +I  +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKIEAQWDPRPSLGIVLAAGGYPGDYAKGAVIEGLEAAAQL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R+DIG 
Sbjct: 360 EGKIFHAGTALQDDRVVTSGGRVLCATALGDSVGNAQQNAYALAAKVDWQGCFYRKDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|121594259|ref|YP_986155.1| phosphoribosylamine--glycine ligase [Acidovorax sp. JS42]
 gi|120606339|gb|ABM42079.1| phosphoribosylamine--glycine ligase [Acidovorax sp. JS42]
          Length = 428

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 188/425 (44%), Positives = 271/425 (63%), Gaps = 10/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK++QSP  S+++  PGN G A   +   + I + +A+  + Q 
Sbjct: 1   MKILVIGGGGREHALAWKLSQSPKTSKVYVAPGNGGTALSPKYENVPISDVTALREWAQA 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ D     G ++FGP+Q AA+LESSK+F+K F  ++GIPTA Y
Sbjct: 61  QKIALTVVGPEAPLAAGVVDEFRTHGLRIFGPTQAAAQLESSKAFSKAFMKRHGIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC---------FQ 171
           + F+DP  A  YV     PIV+KADGL AGKGVVVA T+ EA  A+D             
Sbjct: 121 ETFTDPQAAHAYVDRLGAPIVIKADGLAAGKGVVVAMTLQEAHDAVDFMLVDNKYGVAHN 180

Query: 172 QINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG 231
           +  + V+IE++LEG E SF  LCDGK  +   T++DHKR+ DGD GPNTGGMGA SPA  
Sbjct: 181 EGGARVVIEQFLEGEEASFIVLCDGKNVLALATSQDHKRLKDGDQGPNTGGMGAYSPAPV 240

Query: 232 MSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQA 290
           ++ ++++  ++++ILPTI GM+K+  P+ G L+AGLMI     P  +E+N R GDPE Q 
Sbjct: 241 VTADVHARAMREVILPTIRGMEKDGIPYTGFLYAGLMIDATGHPKTLEFNCRMGDPETQP 300

Query: 291 MMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT 350
           ++MRL+SD++E+L + V G L    + W    AL VV+A +GYPE    G  I+ +PQ+ 
Sbjct: 301 ILMRLKSDLVEVLGAAVDGKLDQVELQWDRRTALGVVMAAQGYPENPRKGDAITGLPQDA 360

Query: 351 GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
               +FHAGT +V+  +  +GGRVL  TAL  ++ ++++  Y +   I +    +R DIG
Sbjct: 361 DDAMVFHAGTQLVDGVVRTSGGRVLCVTALADSVKQAQQRVYDVARGIHFDGAQYRHDIG 420

Query: 411 LQKKE 415
            +  +
Sbjct: 421 HRAVK 425


>gi|323699732|ref|ZP_08111644.1| phosphoribosylamine/glycine ligase [Desulfovibrio sp. ND132]
 gi|323459664|gb|EGB15529.1| phosphoribosylamine/glycine ligase [Desulfovibrio desulfuricans
           ND132]
          Length = 425

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 180/423 (42%), Positives = 258/423 (60%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHAL WK+AQ+P +  +   PGN G AQ    + +   +   ++   ++
Sbjct: 1   MKILVVGSGGREHALCWKLAQNPKVETILCAPGNGGTAQVGTNIPVKDDDIPGLVKLARD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +DLVV GPELPLV G+ +AL   G   FGP+  AA LE SK+F+K    + G+PTA +
Sbjct: 61  EEVDLVVAGPELPLVLGLENALRQEGIPCFGPNAFAANLEGSKAFSKNVMAEAGVPTAPF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F +   A  +++ +  P+VVKADGL AGKGVVVAAT +EA  A++             
Sbjct: 121 RVFEEYEDAVTFIKERGAPLVVKADGLAAGKGVVVAATEEEALEAVEHMMVKKAFGSAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE L+G E SF   CDG       +++DHK  H+GD GPNTGGMGA SPA  + ++
Sbjct: 181 RVVIEEALKGEEASFLCFCDGVHYAMLPSSQDHKAAHEGDTGPNTGGMGAYSPAPILPKD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
            Y+   +  I P +  +  +  PF+GVL+AGLM TE GP ++EYNVRFGDPECQ ++MRL
Sbjct: 241 KYAETAELCIKPILRHLAAKGEPFKGVLYAGLMYTENGPSVLEYNVRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           E+D+LEI+ +C+ G L    +    + A  VV+A +GYP  YP G  I+ I Q       
Sbjct: 301 ETDLLEIMFACIDGKLDQVEVTSSQQTACGVVMAAEGYPGPYPKGMEITGIDQADAMEGV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++F AGT + +  +   GGRVL  TALG  +  +++ AY  V  I + H Y+R DI  + 
Sbjct: 361 KVFQAGTKLEDGKILTTGGRVLCVTALGDDLAAAQKRAYEAVAKIHFDHSYYRRDIADKG 420

Query: 414 KER 416
            +R
Sbjct: 421 LKR 423


>gi|295094991|emb|CBK84082.1| phosphoribosylamine--glycine ligase [Coprococcus sp. ART55/1]
          Length = 423

 Score =  337 bits (865), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 179/422 (42%), Positives = 264/422 (62%), Gaps = 8/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHA+   I++S  +S+++  PGN GIA  A+CV I + +   ++ F ++
Sbjct: 1   MKVLVVGSGGREHAIVTSISKSDKVSKIYCAPGNAGIAALAECVDIGVMDFDKLVAFAKD 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K +DLVVV P+ PLV G  DA  AAG + FGP   AA +E SK+F+K    KYGIPTA Y
Sbjct: 61  KAVDLVVVAPDDPLVAGAVDAFEAAGIRAFGPRANAAIIEGSKAFSKDLMKKYGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           ++F+D   A +Y++  + PIV+KADGL  GKGV++   ++EA +      +D+ F    +
Sbjct: 121 ENFTDADSALKYLETATFPIVLKADGLALGKGVLICNDLEEAKAGVKEIMLDKHFGSAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           T++IEE++ G EVS    CDG T  P T+A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 181 TMVIEEFMTGREVSVLCFCDGTTIKPMTSAQDHKRAKDGDQGLNTGGMGTFSPSPFYTKE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++ I  PT+  M+ E   F+GVLF GLM+T  G  ++EYN RFGDPE Q ++ R+
Sbjct: 241 IDEYCMENIYKPTMAAMKAEGREFKGVLFCGLMMTPNGVKVLEYNARFGDPEAQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIP--QNTGTT 353
           ++DI++++ +C+ G L    + ++   A+ VV+A+ GYP  Y  G  IS +   +     
Sbjct: 301 KNDIIDVMEACIDGTLDKVDLQFEDNAAVCVVLASDGYPVSYKKGYPISGLEKFEGKDDY 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT    + +  NGGRVL  TA GK + E+R  AY   E I + + Y R DIG + 
Sbjct: 361 FVFHAGTKFDGDQIVTNGGRVLGVTAKGKDLFEARANAYAATEWITFDNKYMRHDIG-KA 419

Query: 414 KE 415
            +
Sbjct: 420 ID 421


>gi|329117983|ref|ZP_08246696.1| phosphoribosylamine-glycine ligase [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465871|gb|EGF12143.1| phosphoribosylamine-glycine ligase [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 456

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 190/422 (45%), Positives = 268/422 (63%), Gaps = 6/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK+AQSP +  ++  PGN G A   +   + +  H+ +I FC+ 
Sbjct: 35  MKLLVIGGGGREHALAWKLAQSPDVETVFVAPGNAGTAVEPKLRNVPLLPHAGLIAFCRA 94

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI D   AAG  VFGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 95  EKIAFTLVGPEAPLAAGIVDDFRAAGLPVFGPTRAAAQLESSKDFAKAFMQRHGIPTAAY 154

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F +  +A  YV+ K  PIV+KADGL AGKGV+VA   DEA +AID         +  +
Sbjct: 155 RTFENAGEAHAYVKEKGAPIVIKADGLAAGKGVIVAMNEDEAHAAIDDMLLANKMGEAGA 214

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  +CDG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++ E
Sbjct: 215 RVVIEDFLQGEEASFIVMCDGENVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTDE 274

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y  V+ +I+LP + GM+ +  PF G L+AGLMI     P +IE+N RFGDPE Q +M R
Sbjct: 275 VYRRVMDEIVLPAVRGMKADGIPFTGFLYAGLMIDASGAPSVIEFNCRFGDPETQPVMSR 334

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD   ++ + + G L+     WK + A+ VV+A  GYP+      II  I     T +
Sbjct: 335 LDSDFAALVQAGIEGRLNEATAQWKPQTAVGVVLAAAGYPDSPRKRDIIEGIDAANETGK 394

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA+ + +  +NGGRVL    LG T+ ++++ AY  V+ I +    +R+DI  +  
Sbjct: 395 VFHAGTALSDGHTVSNGGRVLCVVGLGDTVEQAQQTAYQAVQKIRFDGMQYRKDIAAKAI 454

Query: 415 ER 416
            R
Sbjct: 455 GR 456


>gi|71279844|ref|YP_267313.1| phosphoribosylamine--glycine ligase [Colwellia psychrerythraea 34H]
 gi|71145584|gb|AAZ26057.1| phosphoribosylamine--glycine ligase [Colwellia psychrerythraea 34H]
          Length = 431

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 198/429 (46%), Positives = 278/429 (64%), Gaps = 10/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M++L+IG GGREHALAWK AQS  +++++  PGN G A  A  + VAID+ +++A++ F 
Sbjct: 1   MKILVIGGGGREHALAWKAAQSSQVTKVFVAPGNAGTATEAKLENVAIDVSDNAALVAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q + + L +VGPE PLV+G+ DA  A G  +FGPS +AA+LE SKSF K F  +  IP+ 
Sbjct: 61  QSEDVALTIVGPEQPLVDGVVDAFQAQGLAIFGPSAKAAQLEGSKSFTKDFLARNKIPSG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
           +Y  F++   A  YV+ +  PIVVKADGL AGKGV+VA T+ EA  AI        F   
Sbjct: 121 SYAKFTEVEPALAYVREQGAPIVVKADGLAAGKGVIVALTLTEAEDAITDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+LEG E SF  + DGK  +P  T++DHKR  +GD+GPNTGGMGA SPA  ++
Sbjct: 181 GHRVVIEEFLEGEEASFIVMVDGKNVLPMATSQDHKRALNGDLGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I+PT+EGM  E  P+ G L+AGLMI E   P +IEYN RFGDPE Q +M
Sbjct: 241 PEIHDRIMAEVIMPTVEGMANEDAPYSGFLYAGLMIAEDGTPNVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MRL+SD++E+  +   G L    I + +  A+ VV+A + YP +YP G +IS +  N   
Sbjct: 301 MRLQSDLVELCLAATRGELDKVTIEFDSRAAVGVVLAAQSYPADYPKGDVISGLDTNNNV 360

Query: 353 -TQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             + FHAGT +     +  NGGRVL ATALG T+TE+++ AY ++  I W+   +R DI 
Sbjct: 361 LAKTFHAGTKLNEQGEVVTNGGRVLCATALGNTVTEAQQTAYELLHQISWQGVEFRTDIA 420

Query: 411 LQKKERNVK 419
            +  ER  +
Sbjct: 421 YRAIEREQE 429


>gi|145300328|ref|YP_001143169.1| phosphoribosylamine--glycine ligase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853100|gb|ABO91421.1| phosphoribosylamine-glycine ligase [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 429

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 188/428 (43%), Positives = 271/428 (63%), Gaps = 9/428 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M+VL+IG+GGREHALAWK   SPL+  ++  PGN G       + VAI+  +   ++ F 
Sbjct: 1   MKVLIIGNGGREHALAWKAKHSPLVHHVFVAPGNAGTQLEPGVENVAIEATDIEGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +EK + L +VGPE PLV G+ DA  AAG  +FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KEKQVGLTIVGPEAPLVKGVVDAFRAAGQPIFGPTAAAAQLEGSKAFTKDFLARHAIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 121 DYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLQEAEDAVRDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + V+IEE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GARVVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
             +++ V++++I+PT+ GM  E N + G L+AGLMI  Q  P +IE+N RFGDPE Q +M
Sbjct: 241 DAVHNKVMEQVIMPTVRGMAAEGNVYTGFLYAGLMIDGQGNPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R++SD++E+  +   G L      +    A+ VV+A  GYP +Y     IS +P +   
Sbjct: 301 LRMQSDLVELCLAACEGKLDQKEAIYDPRAAIGVVLAAGGYPGDYSSNHPISGLPVDEVA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT +  +     GGRVL ATALG T+ E+++ AY +   I W   ++R+DIG 
Sbjct: 361 GEKVFHAGTRLEGDTSLTQGGRVLCATALGYTVAEAQQRAYQLAGRIKWDGIFYRKDIGW 420

Query: 412 QKKERNVK 419
           +  ER  +
Sbjct: 421 RAIEREQE 428


>gi|298530255|ref|ZP_07017657.1| phosphoribosylamine/glycine ligase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509629|gb|EFI33533.1| phosphoribosylamine/glycine ligase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 421

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 191/421 (45%), Positives = 266/421 (63%), Gaps = 7/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MRVL++GSGGREHALAWKI QSP +  L+  PGN G A   + VA+D+ +   ++   + 
Sbjct: 1   MRVLIVGSGGREHALAWKIRQSPRVERLFIAPGNGGTALEGENVAVDVDDIPGLVKLART 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K +DLV+VGPELPLV G++DAL       FGP    A+LE SK+FAK   ++  +PTA Y
Sbjct: 61  KKVDLVIVGPELPLVLGLTDALEKENILCFGPGAYPAQLEGSKAFAKSLMSQAEVPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F D  +A +YVQ +  P+V+KADGL AGKGVVVA   ++A  A+D       F +   
Sbjct: 121 RVFEDFNQAVKYVQGRDFPVVIKADGLAAGKGVVVADDFEQAREALDDMLVKQVFGKAGE 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE L G E SF ALCDG+  +   +++DHKRI + D GPNTGGMGA SPA  +   
Sbjct: 181 RVVIEEALSGEEASFLALCDGRNFLLLPSSQDHKRIGENDTGPNTGGMGAYSPAPVLPAA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
            Y      +I P ++ +++   PF+GVL+AGL+ +E GP ++EYNVRFGDPECQ ++MRL
Sbjct: 241 KYQETADLVIRPMLQHLEQTDQPFKGVLYAGLIFSEDGPRVLEYNVRFGDPECQPLLMRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           +SD+LE++ +CVHG      +  K E ++ VV++  GYP  Y  G  I+ I +       
Sbjct: 301 DSDLLEVIMACVHGRAAERSLQIKDEASVCVVLSAGGYPARYTKGHEITGIEEAETDPLV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           ++FHAGTA  +  L  +GGRVL  TALG  + ++ E  Y  VE I ++  Y+R DIG + 
Sbjct: 361 RVFHAGTAYKDGRLVTSGGRVLGVTALGTDLGDAIERCYRAVEKISFEGMYYRRDIGQKG 420

Query: 414 K 414
            
Sbjct: 421 L 421


>gi|170718522|ref|YP_001783732.1| phosphoribosylamine--glycine ligase [Haemophilus somnus 2336]
 gi|168826651|gb|ACA32022.1| phosphoribosylamine--glycine ligase [Haemophilus somnus 2336]
          Length = 432

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 269/430 (62%), Gaps = 13/430 (3%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH------AQCVAIDIQNHSAI 54
           M +L+IG+GGREHAL WK+AQSPL S+++  PGN G A         + VAI   +  A+
Sbjct: 1   MNILIIGNGGREHALVWKVAQSPLASKIFVAPGNAGTAMETDGKCAVENVAISATDIDAL 60

Query: 55  IHFCQEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYG 114
           ++F QE  I L +VGPE PLV G+ DA  A+G K+FGP+Q AA+LE SK+F K F  ++ 
Sbjct: 61  VNFAQENQIGLTIVGPEAPLVLGVVDAFRASGLKIFGPTQAAAQLEGSKAFTKDFLARHH 120

Query: 115 IPTATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----- 169
           IPTA Y+ F+D  KA  YV+ K  PIVVKADGL  GKGV+VA T+ EA  AI        
Sbjct: 121 IPTAEYRSFTDAEKAIAYVREKDAPIVVKADGLATGKGVIVAMTLAEAEKAIQDMLSGNA 180

Query: 170 FQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA 229
           F +  S V+IEE+LEG E SF  + DGK   P  T++DHKR+ + D GPNTGGMGA SPA
Sbjct: 181 FGKAGSKVVIEEFLEGEEASFIVMVDGKNVEPMATSQDHKRVGENDTGPNTGGMGAYSPA 240

Query: 230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPEC 288
             ++ E+++ ++Q+II PT+ GM KE N + G L+AGLMI +   P +IE+N RFGDPE 
Sbjct: 241 PVVTPEIHTRIMQQIIYPTVNGMAKEGNIYTGFLYAGLMIDKHGQPKVIEFNCRFGDPET 300

Query: 289 QAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ 348
           Q +MMR+ SD++E+  +   G L      W  + AL +V+A +GYP  Y  G  I  +P 
Sbjct: 301 QPVMMRMRSDLVELCLNACEGKLDQVKSEWSEQAALGIVLAAEGYPNNYRKGDEIQGLPI 360

Query: 349 NT-GTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRE 407
           +     ++F AG       L  NGGRVL  TA+G+ +  +++ A  + + I W   ++R+
Sbjct: 361 SAGENQKVFLAGVEQKGERLLTNGGRVLCVTAMGENVFAAQQQALKLAKQIQWSGRFYRQ 420

Query: 408 DIGLQKKERN 417
           DIG +   R 
Sbjct: 421 DIGYRAVARE 430


>gi|91774704|ref|YP_544460.1| phosphoribosylamine--glycine ligase [Methylobacillus flagellatus
           KT]
 gi|91708691|gb|ABE48619.1| phosphoribosylamine--glycine ligase [Methylobacillus flagellatus
           KT]
          Length = 422

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 192/421 (45%), Positives = 270/421 (64%), Gaps = 6/421 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG GGREHALAWK+AQS  +S ++  PGN G A     V + I     ++ F Q+
Sbjct: 1   MKILVIGGGGREHALAWKLAQSERISRVFVAPGNAGTALDPDMVNVPITKVPELVEFAQQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I L VVGPE PL  G+ DA  AAG K+FGP+Q AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIGLTVVGPEAPLSQGVVDAFRAAGLKIFGPTQAAAQLESSKDFAKAFMIRHNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
             F+D   A  YV+ +  PIV+KADGL AGKGVVVA   DEA +AID            +
Sbjct: 121 ATFTDAAAAHDYVKQQGAPIVIKADGLAAGKGVVVAMNEDEAHAAIDAMLADNKLGAAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLTGEEASFIVMVDGKHILPLATSQDHKRLLDGDQGPNTGGMGAYSPAPVVTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II PT+ GM K+  P+ G L+AGLMI+E      +E+N R GDPE Q +M+R
Sbjct: 241 IHAKVMREIIDPTVAGMAKDGIPYTGFLYAGLMISEDGSVKTLEFNCRMGDPETQPIMLR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD++++L   V G L+ T  +W    AL VV+A+  YP+    G  I+ +P++     
Sbjct: 301 LKSDLVDLLEHAVDGTLNETQADWDRRCALGVVLASANYPDTPRLGDEITGLPKDLVDAY 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAG+AI ++ +  +GGRVL   ALG+T+  ++  AY + E I +    +R DIG +  
Sbjct: 361 VFHAGSAIKDDKVVTSGGRVLCVAALGETVKYAQSQAYKVAEGIKFDGMQFRTDIGYRAV 420

Query: 415 E 415
           +
Sbjct: 421 K 421


>gi|119773534|ref|YP_926274.1| phosphoribosylamine--glycine ligase [Shewanella amazonensis SB2B]
 gi|119766034|gb|ABL98604.1| phosphoribosylamine--glycine ligase [Shewanella amazonensis SB2B]
          Length = 431

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 189/429 (44%), Positives = 272/429 (63%), Gaps = 12/429 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQH--AQCVAIDIQNHSAIIHFC 58
           M +L+IGSGGREHALAWK AQ+  ++ ++  PGN G +     + VAID  +  A++ F 
Sbjct: 1   MNILVIGSGGREHALAWKAAQNADVNTVFVAPGNAGSSLEPKVENVAIDATDIPALLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++ +I L +VGPE PLV G+ DA  A G  +FGP+Q AA+LE SK+F K F  ++ IPTA
Sbjct: 61  KQSNIALTIVGPEAPLVIGVVDAFRAEGLTIFGPTQGAAQLEGSKAFTKDFLARHQIPTA 120

Query: 119 TYQHFSDPMKAKQY----VQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----- 169
            YQ+F++   AK +          P+V+KADGL AGKGV++A +  EA +AID       
Sbjct: 121 DYQNFTEIPPAKAFVAELACKTGFPVVIKADGLAAGKGVIIAQSQAEADAAIDDMLAGNK 180

Query: 170 FQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA 229
           F +  S V++EE+L+G E SF  + DGK  +P  T++DHK   + D GPNTGGMGA SPA
Sbjct: 181 FGEAGSRVVVEEFLKGEEASFIVMVDGKNILPMATSQDHKARDNADHGPNTGGMGAYSPA 240

Query: 230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPEC 288
             ++Q+++  V+  +I PT++GM  E N + G L+AGLM+  Q    ++EYN RFGDPE 
Sbjct: 241 PVVTQDVHDWVMANVIRPTVDGMAAEGNVYTGFLYAGLMVDPQGQAKVLEYNCRFGDPET 300

Query: 289 QAMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ 348
           Q +MMRL+SD++E+  +   G L      + +  A+ VV+A  GYP+EY  G +I  +  
Sbjct: 301 QPIMMRLKSDLVELCLAACRGELDQVTAEYDSRAAVGVVLAAGGYPDEYRKGDVIEGLSL 360

Query: 349 NTGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
                ++FHAGT +V+  +  NGGRVL ATALG T+TE+++ AY +V+ I W   Y+R D
Sbjct: 361 GNNDAKVFHAGTKMVDGRVVTNGGRVLCATALGNTVTEAQKAAYALVDEIHWDDVYFRTD 420

Query: 409 IGLQKKERN 417
           IG +   R 
Sbjct: 421 IGYRAIARE 429


>gi|145600974|ref|YP_001165050.1| phosphoribosylamine--glycine ligase [Yersinia pestis Pestoides F]
 gi|145212670|gb|ABP42077.1| phosphoribosylamine--glycine ligase [Yersinia pestis Pestoides F]
          Length = 428

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 188/427 (44%), Positives = 272/427 (63%), Gaps = 10/427 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHAL WK AQSPL  +++  PGN G A     + V I   + + ++ F 
Sbjct: 1   MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q   I L +VGPE PLV G+ DA  AAG  +FGP+Q AA+LE SK+F K F  ++ IP+A
Sbjct: 61  QSHDIGLTIVGPEAPLVIGVVDAFRAAGLAIFGPTQAAAQLEGSKAFTKDFLARHNIPSA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F+D   A  YV+ K  PIV+KADGL AGKGV+VA T +EA +A++       F   
Sbjct: 121 EYQNFTDVEAALAYVRQKGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              +++EE+L+G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 181 GHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 DDVHQRVMDQVIWPTVRGMAAEGNIYTGFLYAGLMISADGQPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-G 351
           +R+ SD++E+  +   G L+    +W    +L VV+A  GYP +Y  G +I  +PQ    
Sbjct: 301 LRMRSDLVELCLAGTQGKLNEKTSDWDERPSLGVVLAAGGYPADYRQGDVIHGLPQQEVK 360

Query: 352 TTQLFHAGTAIVNN-NLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
             ++FHAGT +  N  +  NGGRVL  TAL +T+ ++++ AY + E I W+  + R+DIG
Sbjct: 361 DGKVFHAGTKLNGNHEVVTNGGRVLCVTALAETVAQAQQYAYQLAEGIQWEGVFCRKDIG 420

Query: 411 LQKKERN 417
            +   R 
Sbjct: 421 YRAIARG 427


>gi|332038750|gb|EGI75192.1| phosphoribosylamine--glycine ligase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 427

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 193/426 (45%), Positives = 269/426 (63%), Gaps = 9/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALA+K AQ+  ++ ++  PGN G A     + VAI++ +   ++ F 
Sbjct: 1   MNVLVIGSGGREHALAFKAAQNTKVNTVFVAPGNAGTALEPKLENVAINVDDLDGLLSFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           Q+  ++L +VGPE+PLV G+ D        +FGP+  AA+LE SKSF K F  ++ IPT 
Sbjct: 61  QQNKVELTIVGPEIPLVLGVVDKFREHNMAIFGPTAGAAQLEGSKSFTKDFLARHKIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ F     A  Y++ K  PIVVKADGL AGKGV+VA T  +A  AI        F   
Sbjct: 121 DYQTFEQIEPALAYLKEKGAPIVVKADGLAAGKGVIVAMTEADAEEAIRDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +PF T++DHKR ++GD GPNTGGMGA SPA  ++
Sbjct: 181 GSRVVIEEFLDGEEASFIVMVDGKNVLPFATSQDHKRAYNGDAGPNTGGMGAYSPAPVVT 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            E++  ++ ++I PT+EGM  E +P+ G L+AGLMI E   P +IEYN RFGDPE Q MM
Sbjct: 241 DEIHQRIMNEVIYPTVEGMASEGHPYTGFLYAGLMIDETGTPKVIEYNCRFGDPETQPMM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++E++ +     L  T I +    A+ VV+A KGYP +YP G  IS +  +   
Sbjct: 301 LRLQSDLVELIEAANRVELDKTTIEFDPRAAVGVVLAAKGYPGDYPKGDAISGLKVDYPA 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    N++   GGRVL ATALG T+T++++ AY +V+ I W    +R DI  
Sbjct: 361 GEKVFHAGTKQSGNDVVTTGGRVLCATALGNTVTQAQQRAYELVKQISWDGMEYRTDIAY 420

Query: 412 QKKERN 417
           +   R 
Sbjct: 421 RAIARE 426


>gi|217969863|ref|YP_002355097.1| phosphoribosylamine--glycine ligase [Thauera sp. MZ1T]
 gi|217507190|gb|ACK54201.1| phosphoribosylamine/glycine ligase [Thauera sp. MZ1T]
          Length = 426

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 191/424 (45%), Positives = 272/424 (64%), Gaps = 7/424 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IGSGGREHALAWK+AQSP ++ +   PGNPG A       + + +   ++   + 
Sbjct: 1   MKVLVIGSGGREHALAWKLAQSPKVTRVLVAPGNPGTAAEKLLQNVPVTDIKVLVELAKH 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           +H+   VVGPE PL  G+ DA  AAG  +FGP++ AA+LESSK FAK+F  ++ IPTA Y
Sbjct: 61  EHVAFTVVGPEAPLAAGVVDAFRAAGLPIFGPTKAAAQLESSKDFAKQFLVRHNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F+D   A  YV  +  PIV+KADGL AGKGVVVA T DEA +AID            +
Sbjct: 121 QTFADAAAAHAYVDAEGAPIVIKADGLAAGKGVVVAMTADEAHAAIDMMLLDNRMGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE++EG E SF  + DGK A+   T++DHKR+HDGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFMEGEEASFIVMADGKHALALATSQDHKRLHDGDQGPNTGGMGAYSPAPVVTPD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V++++I PT+ GM  E  P+ G L+AGLMI  E  P ++E+N R GDPE Q +MMR
Sbjct: 241 VHARVMREVINPTLTGMAAEGLPYTGFLYAGLMIDGEGKPRVVEFNCRMGDPETQPIMMR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTT 353
           L++D+ +++ + + G L  T   W   +AL VV+A  GYPE    G +I+ +P +     
Sbjct: 301 LKTDLADLIEAAIAGKLDQTEAEWDRRFALGVVLAAAGYPESPRKGDVITGLPASEQEDV 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGTA+ ++ +   GGRVL  TALG  +  +++ AY + + I ++   +R DIG + 
Sbjct: 361 HVFHAGTALQDSQVVTAGGRVLCVTALGDNVRSAQKRAYEVADGIVFEGRQYRRDIGHRA 420

Query: 414 KERN 417
             R 
Sbjct: 421 IGRK 424


>gi|170691719|ref|ZP_02882883.1| phosphoribosylamine--glycine ligase [Burkholderia graminis C4D1M]
 gi|170143003|gb|EDT11167.1| phosphoribosylamine--glycine ligase [Burkholderia graminis C4D1M]
          Length = 432

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 183/423 (43%), Positives = 260/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI   +A+  F ++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQLVYVAPGNGGTAQDERLRNVDITEPAALADFVEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI +   + G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIAFTLVGPEAPLAAGIVNLFRSRGLKIFGPTKEAAQLESSKDFAKAFMKRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F+D   A  Y+  K  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFADVAAAHAYLDAKGAPIVIKADGLAAGKGVVVAQTLEEAHAAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKHVLPLASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPT+ GM+KE   + G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIILPTVRGMEKEGIRYTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D  +++   + G L    + W    AL VV+A   YP+    G  I+ IP  T  + 
Sbjct: 301 LKGDYSKVVEQAIAGTLDTVELEWDRRTALGVVLAAYNYPDTPRKGDRINDIPAETADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT   +  L  +GGRVL    L  ++  ++ +AY  +  I +    +R DIG +  
Sbjct: 361 TFHAGTTYADGKLVTSGGRVLCVVGLADSVRSAQSVAYETINQISFDGMQYRRDIGYRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|220929593|ref|YP_002506502.1| phosphoribosylamine--glycine ligase [Clostridium cellulolyticum
           H10]
 gi|219999921|gb|ACL76522.1| phosphoribosylamine/glycine ligase [Clostridium cellulolyticum H10]
          Length = 419

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 183/419 (43%), Positives = 262/419 (62%), Gaps = 7/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREH + WK++QSP +S+L+  PGN GI+  A+CV I   +   I+ F +E
Sbjct: 1   MKVLVVGGGGREHTIVWKLSQSPKISKLYCAPGNGGISGLAECVPIKAMDMDEIVKFSKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D+VVV P+ PL  G+ D L  AG + FGP + AA +E SK+F+K    KY IPTA Y
Sbjct: 61  NKVDMVVVAPDDPLAAGLVDKLTEAGVRAFGPVKAAAIIEGSKAFSKDLMKKYNIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
             F +  +A QY+   S PIVVKADGL  GKGV++A T+ EA         D+ F +  S
Sbjct: 121 MVFDNCTEALQYLDTCSAPIVVKADGLALGKGVIIAKTIQEAREAVKGMMNDKIFGEAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+++G EVS  A  DGKT +P  +++DHKR+ D D GPNTGGMG  SP+    ++
Sbjct: 181 RVVIEEFIQGPEVSILAFTDGKTIVPMVSSQDHKRVFDNDQGPNTGGMGTFSPSPLYDKK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    +++I  PT+E M KE   F+GVL+ GLMIT+ GP ++EYN RFGDPE Q ++ RL
Sbjct: 241 LNDYCMKEIFTPTVEAMNKEGRKFKGVLYFGLMITKDGPKVLEYNARFGDPETQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           ++D+L I  + +   L + HI W    A+ V+ A+ GYP +Y  G  IS I        T
Sbjct: 301 KTDLLVIFEAIIDERLCDIHIKWDDNSAVCVIAASGGYPRKYSTGLEISGIDNAEANGET 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FH+GT+  +      GGRVL  TA+  T+ ++ E AY  +E I ++  ++R+DIG +
Sbjct: 361 IVFHSGTSCKDGKYYTAGGRVLGVTAVESTMDKAIEKAYAGIEKIQFEGMHYRKDIGRK 419


>gi|331014692|gb|EGH94748.1| phosphoribosylamine--glycine ligase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 431

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 267/426 (62%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGTAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
            E ++ L +VGPE+PLV G+ D     G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  -ENNVSLTIVGPEVPLVAGVVDLFRIRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F + 
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLTEAEDAVQDMLAGNAFGEA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+  +I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDLVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    +L +V+A  GYP +Y  G II  +      
Sbjct: 300 LRLQSSLVLLIEAALAQALDKVEAQWDPRPSLGIVLAAGGYPGDYAKGAIIEGLDAAALL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT + ++ +  +GGRVL ATALG ++  +++ AY +   +DW+  ++R DIG 
Sbjct: 360 EGKIFHAGTTLQDDRVVTSGGRVLCATALGDSVGSAQKNAYALAAKVDWQGCFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|163815426|ref|ZP_02206799.1| hypothetical protein COPEUT_01589 [Coprococcus eutactus ATCC 27759]
 gi|158449063|gb|EDP26058.1| hypothetical protein COPEUT_01589 [Coprococcus eutactus ATCC 27759]
          Length = 423

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 180/422 (42%), Positives = 263/422 (62%), Gaps = 8/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++GSGGREHA+   I++S  +S+++  PGN GIA  A+CV I + +   ++ F +E
Sbjct: 1   MKVLVVGSGGREHAIVTSISKSDKVSKIYCAPGNAGIAALAECVDIGVMDFDKLVAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDLVVV P+ PLV G  DA  AAG + FGP   AA +E SK+F+K    KYGIPTA Y
Sbjct: 61  KEIDLVVVAPDDPLVAGAVDAFEAAGIRAFGPRANAAIIEGSKAFSKDLMKKYGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           ++F+DP  A +Y++  + PIV+KADGL  GKGV++   ++EA +      +D+ F    +
Sbjct: 121 ENFTDPDSAIKYLETATFPIVLKADGLALGKGVLICNDLEEAKAGVKEIMLDKHFGSAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           T++IEE++ G EVS    CDG T  P T+A+DHKR  DGD G NTGGMG  SP+   +++
Sbjct: 181 TMVIEEFMTGREVSVLCFCDGTTIKPMTSAQDHKRAKDGDQGLNTGGMGTFSPSPFYTKD 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +    ++ I  PT+  M+ E   F+GVLF GLM+T  G  ++EYN RFGDPE Q ++ R+
Sbjct: 241 IDEYCMENIYKPTMAAMKAEGREFKGVLFCGLMMTPNGVKVLEYNARFGDPEAQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           ++DI++++ +C+ G L    + ++   A+ VV+A+ GYP  Y  G  I  +         
Sbjct: 301 KNDIIDVMEACIDGTLDKIDLQFEDNAAVCVVLASDGYPVSYKKGYPIHGLENFDGKDDY 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
            +FHAGT    + +  NGGRVL  TA GK + E+R  AY   E I + + Y R DIG + 
Sbjct: 361 FVFHAGTKFDGDEIVTNGGRVLGVTAKGKDLFEARANAYAATEWITFDNKYMRHDIG-KA 419

Query: 414 KE 415
            +
Sbjct: 420 ID 421


>gi|154245359|ref|YP_001416317.1| phosphoribosylamine--glycine ligase [Xanthobacter autotrophicus
           Py2]
 gi|154159444|gb|ABS66660.1| phosphoribosylamine--glycine ligase [Xanthobacter autotrophicus
           Py2]
          Length = 422

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 199/422 (47%), Positives = 273/422 (64%), Gaps = 3/422 (0%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQ 59
           M +LL+GSGGREHALAWK+AQSP + + ++IPGNPGIA+HA+ +  I +  H  I+ +CQ
Sbjct: 1   MNILLLGSGGREHALAWKLAQSPSMGQFYAIPGNPGIAEHAELIEGIPLSAHDTIVKWCQ 60

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  ID VVVGPE PLV G+ D L A G   FGP+  AA+LE SK F K+ C    IPTA 
Sbjct: 61  DHGIDFVVVGPEAPLVAGLVDRLEAVGIPAFGPTAAAARLEGSKLFTKELCKANSIPTAA 120

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVII 179
           +  F+   +   YV+ +  PIVVKADGL AGKGVVVA + +EA  A+++ F    + V+I
Sbjct: 121 FGRFTSAAEGAAYVRQQGAPIVVKADGLMAGKGVVVALSEEEAVDAVEQVFAGGGTEVLI 180

Query: 180 EEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQELYST 239
           EE++EG E S FAL DG+T + F +A+DHKR  DGD+GPNTGGMGA SPA  ++ EL   
Sbjct: 181 EEFMEGEEASLFALVDGETVVLFGSAQDHKRAFDGDLGPNTGGMGAYSPAPVLTPELERR 240

Query: 240 VIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLESDI 299
            + +I++PT   M     P++GVL+AGLM+T  GP L+EYN RFGDPECQ +M R + D+
Sbjct: 241 ALDEILIPTARAMVAAGAPYRGVLYAGLMLTADGPKLVEYNCRFGDPECQVLMPRFKGDL 300

Query: 300 LEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG--TTQLFH 357
           +++L++   G L      W  + A+TVV A++GYP  +  G+ I  I          +F 
Sbjct: 301 VQVLHATATGQLAQVTPEWSQDAAMTVVYASRGYPGPHQVGSPIGGIEAAAELDGVLVFQ 360

Query: 358 AGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKKERN 417
           AGT      L +NGGRVL+ TA G T+ E+R+ AY  +  IDW  G++R DIG +   + 
Sbjct: 361 AGTRRKGVALVSNGGRVLNVTATGATLGEARDRAYAGIARIDWPDGFYRSDIGWRALGKG 420

Query: 418 VK 419
            +
Sbjct: 421 AR 422


>gi|126733163|ref|ZP_01748910.1| phosphoribosylamine--glycine ligase [Roseobacter sp. CCS2]
 gi|126716029|gb|EBA12893.1| phosphoribosylamine--glycine ligase [Roseobacter sp. CCS2]
          Length = 457

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 217/420 (51%), Positives = 276/420 (65%), Gaps = 6/420 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +L++GSGGREH+LAW + Q+P    L   PGN GIA  A+C  I+I +  A+  F +E
Sbjct: 38  MNILILGSGGREHSLAWAVKQNPKCDRLIVAPGNAGIATIAECADINILDGGAVATFAEE 97

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             ID V+VGPE PL  G++D L  AG  VFGPSQ AA+LE+SKSF K  C     PTA Y
Sbjct: 98  NAIDFVIVGPEAPLAAGVADRLRKAGLLVFGPSQAAAQLEASKSFTKSICDAANAPTAAY 157

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
            HF+D   AK Y++ +  PIVVKADGL AGKGV+VA T D A +AID      F    + 
Sbjct: 158 AHFTDADAAKSYIRAQGAPIVVKADGLAAGKGVIVAMTEDNALAAIDDMFDGSFGDAGAE 217

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V+IEE++EG E SFF LCDGKT +P  TA+DHKR +DGD GPNTGGMGA SPA  MS E+
Sbjct: 218 VVIEEFMEGEEASFFVLCDGKTILPVGTAQDHKRAYDGDTGPNTGGMGAYSPAPVMSDEI 277

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
               + +II PT++ M K   PFQGVLF GLMI    P L+EYNVRFGDPECQ +MMRL 
Sbjct: 278 TQKALDEIIKPTMDEMYKRGTPFQGVLFCGLMIQNGQPRLVEYNVRFGDPECQCLMMRLG 337

Query: 297 SDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ-- 354
             IL+++ +C    L     NW  ++ALT+V+A KGYP  Y  GT+I  +      +   
Sbjct: 338 GQILDLMQACAEERLDEVQANWADDHALTIVMAAKGYPGSYAKGTVIKGLENQPEDSFHA 397

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA V+  +TA+GGRVL+ TA G +++E+ E AY M + IDW  G++R DIG Q  
Sbjct: 398 VFHAGTAQVDGQITASGGRVLNITARGNSLSEAHEKAYAMAQGIDWDDGFYRSDIGWQAL 457


>gi|307296249|ref|ZP_07576076.1| phosphoribosylamine/glycine ligase [Sphingobium chlorophenolicum
           L-1]
 gi|306878051|gb|EFN09274.1| phosphoribosylamine/glycine ligase [Sphingobium chlorophenolicum
           L-1]
          Length = 427

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 205/427 (48%), Positives = 279/427 (65%), Gaps = 6/427 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M +LL+G GGREHALAWK+AQSP LS L++ PGNPGIAQHA  V +D  +H A++ FC  
Sbjct: 1   MNILLLGGGGREHALAWKLAQSPALSTLYAAPGNPGIAQHATLVDLDATDHRAVVDFCLR 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             I LVV+GPE PLV+G++D L   G+ VFGP ++AA+LE SK F K  C + GIPTA Y
Sbjct: 61  HSIGLVVIGPEAPLVDGLADNLRVKGYPVFGPGKKAAQLEGSKGFTKDLCKRAGIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC----FQQINST 176
           +  +    A   + + ++P+V+KADGL AGKGV++A T ++A  AI+      F    + 
Sbjct: 121 ERVTSKDGAIAALDDFALPVVIKADGLAAGKGVIIAETREQAVEAIEDMFSGAFGSAGAE 180

Query: 177 VIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQEL 236
           V++EEY+ G E SFFAL DG   +PF +A+DHKR+ DGD GPNTGGMGA SPA  ++ EL
Sbjct: 181 VVLEEYMTGEEASFFALTDGSAILPFGSAQDHKRVGDGDTGPNTGGMGAYSPARVLTPEL 240

Query: 237 YSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRLE 296
            + VI+KI+ PT++ +  E  P+ GVL+AGLM+T +GP LIEYN RFGDPECQ +MMR +
Sbjct: 241 EAEVIEKIVRPTVDTLAAEGTPYSGVLYAGLMLTAEGPKLIEYNARFGDPECQVLMMRFD 300

Query: 297 SDILEILNSCVHGN-LHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQ 354
            D++ +L +   G       +      ALT+V+A  GYP     G  IS I     G  +
Sbjct: 301 GDLVALLLAVAEGRLAEQGPVQLADRTALTIVMAANGYPGTPEKGGAISGIDAAEAGGAR 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  +  + ANGGRVL+ TA G+T+  ++E AY  V+ I +  G+ R DIG ++ 
Sbjct: 361 VFHAGTADKDGAIVANGGRVLNVTATGETVKAAQEAAYRAVDAIGFPTGFCRRDIGWREV 420

Query: 415 ERNVKYR 421
            R    R
Sbjct: 421 AREEAAR 427


>gi|291523225|emb|CBK81518.1| phosphoribosylamine--glycine ligase [Coprococcus catus GD/7]
          Length = 423

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 181/422 (42%), Positives = 263/422 (62%), Gaps = 8/422 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHA+AWK+A+SPL+ +++  PGN GI + A+CV I       ++ F +E
Sbjct: 1   MKVLIVGGGGREHAIAWKVAESPLVDKVYCAPGNAGIEEVAECVPIGAMEFDKLVAFAKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           K IDL V+G + PLV GI DA  A G +VFGP + AA +E SK+F+K    KYGIPTATY
Sbjct: 61  KAIDLTVIGMDDPLVGGIVDAFEAEGLRVFGPRKNAAIIEGSKAFSKDLMKKYGIPTATY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           ++F+DP  A  Y++   MPIV+KADGL  GKGV++   ++EA + +             +
Sbjct: 121 ENFTDPQAALDYLETAKMPIVLKADGLALGKGVLICQNLEEARAGVKEIMEDKKFGSAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE++ G EVS    CDG   +P T+A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 181 QMVVEEFMTGREVSALCFCDGTNIVPMTSAQDHKRAKDGDQGLNTGGMGTFSPSPFYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + +  ++ I  PT+  M+ E   F G+LF GLM+TE GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 VNAFCMEHIFKPTMAAMKAEGRDFVGILFVGLMLTEDGPKVLEYNARFGDPETQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQ--NTGTT 353
           ++D++E+  +C+ G L   H+ ++   A+ VV+A+ GYP  Y  G  I+   +       
Sbjct: 301 KTDLVEMFEACIDGKLAEKHLEFEDNAAVCVVLASDGYPVSYEKGYPITGFEKFHADEGY 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
             FHAGT      +  NGGRVL  TA G T+ E+R  AY   E I++ + Y R DIG + 
Sbjct: 361 YCFHAGTKRNEKGIVTNGGRVLGVTAKGTTLKEARANAYKATEWIEFDNKYMRHDIG-KA 419

Query: 414 KE 415
            +
Sbjct: 420 ID 421


>gi|161524159|ref|YP_001579171.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans ATCC
           17616]
 gi|189351084|ref|YP_001946712.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans ATCC
           17616]
 gi|160341588|gb|ABX14674.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans ATCC
           17616]
 gi|189335106|dbj|BAG44176.1| phosphoribosylamine-glycine ligase [Burkholderia multivorans ATCC
           17616]
          Length = 425

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 185/423 (43%), Positives = 264/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI +  A+  F + 
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQMVYVAPGNGGTAQDERLKNVDITSLDALADFAES 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   +VGPE PL  GI +   A G K+FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVAFTLVGPEAPLAAGIVNLFRARGLKIFGPTREAAQLESSKDFAKAFMKRHGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + FSD   A  Y+  K  PIVVKADGL AGKGVVVA T++EA  A+D            +
Sbjct: 121 ETFSDAAAAHAYIDAKGAPIVVKADGLAAGKGVVVAMTLEEAHEAVDMMLSGNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF  + DGK A+   +++DHKR+ D D GPNTGGMGA SP   ++ +
Sbjct: 181 RVVIEEFLDGEEASFIVMVDGKHALALASSQDHKRLLDEDRGPNTGGMGAYSPTPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II+PT+ GM+K+   F G L+AGLMI  E  P  +E+N R GDPE Q +M R
Sbjct: 241 MHARVMREIIMPTVRGMEKDGIRFTGFLYAGLMIDKEGNPRTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD  +++   + G L    ++W    AL VV+A  GYP+    G  I+ IP  T    
Sbjct: 301 LKSDFSKVVEQAIAGTLDTVELDWDRRTALGVVLAAHGYPDAPRKGDRINGIPAETEQAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT +  + L  +GGRVL    L  ++ E+++ AY  +  I+++   +R DIG +  
Sbjct: 361 TFHAGTTLDGDKLVTSGGRVLCVVGLADSVREAQQHAYDTINQINFEGMQYRRDIGYRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 SRK 423


>gi|254480895|ref|ZP_05094141.1| phosphoribosylamine--glycine ligase [marine gamma proteobacterium
           HTCC2148]
 gi|214038690|gb|EEB79351.1| phosphoribosylamine--glycine ligase [marine gamma proteobacterium
           HTCC2148]
          Length = 429

 Score =  337 bits (863), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 182/425 (42%), Positives = 254/425 (59%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK AQS     ++  PGN G A     + +A+D+ +  A+  F 
Sbjct: 1   MNVLIIGSGGREHALAWKAAQSDKAETIYVAPGNAGTANEHGIENIALDVMDFPALADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           +   + L +VGPE PLV GI D       + FGPS  AA+LE SK+F K F  ++ IPT 
Sbjct: 61  EHNQVGLTIVGPEAPLVEGIVDYFAQRNLRCFGPSADAAQLEGSKAFTKDFLARHQIPTG 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y +F++   A  Y++ +  PIVVKADGL AGKGV+VA T+++A  A+        F   
Sbjct: 121 AYANFTEVEPALAYLREQGAPIVVKADGLAAGKGVIVAETLEQAEEAVTDMLSGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              V+IEE+LEG E SF  + DG   +P  T++DHKRI +GDIGPNTGGMGA SPA  ++
Sbjct: 181 GCRVVIEEFLEGEEASFIVMVDGANVLPMATSQDHKRIGEGDIGPNTGGMGAYSPAPVVN 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
             ++  ++ ++I+PT+ GM  E N + G L+AGLMI+ E  P +IEYN RFGDPE Q +M
Sbjct: 241 DVIHQRIMDEVIMPTVRGMATEGNDYTGFLYAGLMISPEGEPKVIEYNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN-TG 351
           +RL+SD++ +  S +   L     +W    A+ VV+A  GYP  Y  G +I  +      
Sbjct: 301 VRLQSDLVALCESALDKKLDTISAHWDQRCAIGVVLAAGGYPASYGKGAVIQGLAAPQAD 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT    + +  +GGRVL  TALG  I  +++  Y  V+ I W+    R DIG 
Sbjct: 361 NIKVFHAGTKQDGDKIVTSGGRVLCVTALGDDIAAAQKDCYLGVDKISWEGVTLRRDIGW 420

Query: 412 QKKER 416
           +   R
Sbjct: 421 RAIAR 425


>gi|300813543|ref|ZP_07093874.1| phosphoribosylamine--glycine ligase [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|300512291|gb|EFK39460.1| phosphoribosylamine--glycine ligase [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 416

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 172/415 (41%), Positives = 242/415 (58%), Gaps = 6/415 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL+IG+GGRE+ALAWKI++S  + +++   GN G    A  V I   +   ++ F ++
Sbjct: 1   MKVLIIGTGGRENALAWKISKSKNIDKIYMAKGNGGSQDFATNVDISPTDIDGLLDFAKK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + IDL VVGPE PL  GI D       K+FGP +  A+ E SK F KKF  KY IPTA Y
Sbjct: 61  EKIDLTVVGPEDPLCAGIVDKFKENNLKIFGPDKACARFEGSKEFTKKFLEKYNIPTAKY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F D   AK  +   S P+V+KADGLC GKGV +     EA        ID+ F+    
Sbjct: 121 KSFIDYDGAKNSLGEFSYPLVIKADGLCLGKGVFICQDKKEALESLEKIFIDKIFKDQGK 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEEYL+GFE S   +       P  T +DHK+I DG++GPNTGG+G  SP    SQ+
Sbjct: 181 KVVIEEYLKGFEASLLCIVSNNKLFPLQTCKDHKQIFDGNVGPNTGGVGTYSPGDKFSQK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
               + +KI+     G  KE+  + G+LF G MI    P ++E+NVRFGDPE + +M RL
Sbjct: 241 TEEEI-RKILKGIEIGFNKEKISYYGILFIGFMIENDIPKVLEFNVRFGDPETEVLMPRL 299

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           + D+LEI+   +   L    I WK E +LT ++ + GYP  Y  G  I+ + +  G   +
Sbjct: 300 KGDLLEIMMKTLDNTLSEDDIKWKDEVSLTTILCSGGYPSSYQKGKEITGLDKVDGDVII 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIG 410
           FH GT   +     +GGRVLS T+LGK + E+R+  Y  +E I+++  Y+R+DIG
Sbjct: 360 FHNGTVKKDGKYYTDGGRVLSVTSLGKDLIEARKKVYKNIEKINFQDMYYRKDIG 414


>gi|221199606|ref|ZP_03572650.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans
           CGD2M]
 gi|221205494|ref|ZP_03578509.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans CGD2]
 gi|221174332|gb|EEE06764.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans CGD2]
 gi|221180891|gb|EEE13294.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans
           CGD2M]
          Length = 425

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 186/423 (43%), Positives = 265/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI +  A+  F + 
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQMVYVAPGNGGTAQDERLKNVDITSLDALADFAER 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   +VGPE PL  GI +   A G K+FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVAFTLVGPEAPLAAGIVNLFRARGLKIFGPTREAAQLESSKDFAKAFMKRHGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + FSD   A  Y+  K  PIVVKADGL AGKGVVVA T++EA  A+D            +
Sbjct: 121 ETFSDAAAAHAYIDAKGAPIVVKADGLAAGKGVVVAMTLEEAHEAVDMMLSGNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF  + DGK A+   +++DHKR+ D D GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLDGEEASFIVMVDGKHALALASSQDHKRLLDEDRGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II+PT+ GM+K+   F G L+AGLMI  E  P  +E+N R GDPE Q +M R
Sbjct: 241 MHARVMREIIMPTVRGMEKDGIRFTGFLYAGLMIDKEGNPRTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD  +++   + G L    ++W    AL VV+A  GYP+    G  I+ IP  T    
Sbjct: 301 LKSDFSKVVEQAIAGTLDTVELDWDRRTALGVVLAAHGYPDAPRKGDRINGIPAETEQAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT +  + L  +GGRVL    L  ++ E+++ AY  +  I+++   +R DIG +  
Sbjct: 361 TFHAGTTLDGDKLVTSGGRVLCVVGLADSVREAQQHAYDTINQINFEGMQYRRDIGHRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 SRK 423


>gi|326204448|ref|ZP_08194306.1| phosphoribosylamine/glycine ligase [Clostridium papyrosolvens DSM
           2782]
 gi|325985480|gb|EGD46318.1| phosphoribosylamine/glycine ligase [Clostridium papyrosolvens DSM
           2782]
          Length = 419

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 177/419 (42%), Positives = 259/419 (61%), Gaps = 7/419 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREH + WK++QSP +++L+  PGN GI+  A+CV I   +   I+ F +E
Sbjct: 1   MKVLVVGGGGREHTIVWKLSQSPKITKLYCAPGNGGISGIAECVPIKAMDLDGILTFSKE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             +D+VVV P+ PL  G+ D L  AG + FGP   AA +E SK+F+K    KY IPTA Y
Sbjct: 61  NKVDMVVVAPDDPLAAGLVDKLTEAGIRAFGPVMAAAIIEGSKAFSKDLMKKYNIPTAGY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
             F +  +A QY+   S PIVVKADGL  GKGV++A T+ +A         D+ F    S
Sbjct: 121 MVFDNCSEALQYLDTSSAPIVVKADGLALGKGVIIAQTIQDAKDAVNGMMKDKVFGDAGS 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+++G EVS  A  DG T +P  +++DHKR  D D GPNTGGMG  SP+    ++
Sbjct: 181 RVVIEEFIQGPEVSILAFTDGNTIVPMVSSQDHKRAFDNDQGPNTGGMGTFSPSPLYDKK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L    ++++ +PT+E M KE   F+GVL+ GLMIT+ GP ++EYN RFGDPE Q ++ RL
Sbjct: 241 LADYCMKEVFMPTVEAMNKEGRKFKGVLYFGLMITKDGPKVLEYNARFGDPETQVVLPRL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT--T 353
           ++D+LEI  + +   L   +I W    A+ V+ A+ GYP +Y  G  I+ I +      T
Sbjct: 301 KTDLLEIFEAIIDEKLSEINIEWDDNSAVCVIAASGGYPGKYATGIEINGIDKAEENNET 360

Query: 354 QLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAGT+  +      GGRVL  TA+  T+ ++ + AY  +  I ++  ++R+DIG +
Sbjct: 361 IVFHAGTSCKDGKYYTAGGRVLGVTAVESTMDKAIQKAYAGIAKIQFEGMHYRKDIGRK 419


>gi|161871014|ref|YP_001600194.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis 053442]
 gi|161596567|gb|ABX74227.1| phosphoribosylamine--glycine ligase [Neisseria meningitidis 053442]
          Length = 423

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 191/423 (45%), Positives = 263/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I F ++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFSRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  G+ D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGVVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLSDLVEAAIDGRLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDVISGLDAANQVGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|296086828|emb|CBI32977.3| unnamed protein product [Vitis vinifera]
          Length = 527

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 224/429 (52%), Positives = 286/429 (66%), Gaps = 14/429 (3%)

Query: 3   VLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQ--HAQCV-AIDIQNHSAIIHFCQ 59
           VL+IGSGGREHAL + + +SP    ++  PGN GI+    A C+  +DI + SA+I FC 
Sbjct: 93  VLVIGSGGREHALCYALKRSPSCDAVFCAPGNAGISNSGDATCISDLDISDSSAVISFCH 152

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
           +  + LVVVGPE PLV G+S+ L  AG   FGPS  AA LE SK+F K  C KYGIPTA 
Sbjct: 153 KWGVGLVVVGPEAPLVAGLSNDLVKAGIPSFGPSSEAAALEGSKNFMKNLCDKYGIPTAK 212

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQIN 174
           YQ F+DP  AKQY+Q +  PIV+KADGL AGKGV+VA T+DEA  A+D       F    
Sbjct: 213 YQTFTDPAAAKQYIQEQGAPIVIKADGLAAGKGVIVAMTLDEAYEAVDLMLVKGAFGSAG 272

Query: 175 STVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQ 234
           S VI+EE+LEG E SFFAL DG+ AIP  +A+DHKR+ DGD GPNTGGMGA SPA  +++
Sbjct: 273 SQVIVEEFLEGEEASFFALVDGENAIPLESAQDHKRVGDGDTGPNTGGMGAYSPAPIITE 332

Query: 235 ELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI--TEQGPYLIEYNVRFGDPECQAMM 292
           EL S V++ II+PT++GM  E   F GVL+AGLMI      P LIEYNVRFGDPECQ +M
Sbjct: 333 ELQSLVMKSIIIPTVKGMAAEGCRFVGVLYAGLMIEKKSGLPKLIEYNVRFGDPECQVLM 392

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-- 350
           +RLESD+ ++L +   G L    +NW    A+ VV+A+KGYP  Y  GT+IS + +    
Sbjct: 393 IRLESDLAQVLLAACKGELSGVSLNWSPGSAMVVVMASKGYPGSYEKGTVISNLDEAELV 452

Query: 351 -GTTQLFHAGTAIV-NNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWRED 408
             + ++FHAGT +  + N  A GGRVL  TA GK + E+RE AY  VE I+W  G++R D
Sbjct: 453 APSVKVFHAGTNLDSDGNFIAVGGRVLGVTAKGKNLEEARERAYRAVEEINWPGGFYRRD 512

Query: 409 IGLQKKERN 417
           IG +   R 
Sbjct: 513 IGWRALPRG 521


>gi|294634211|ref|ZP_06712757.1| phosphoribosylamine--glycine ligase [Edwardsiella tarda ATCC 23685]
 gi|291092356|gb|EFE24917.1| phosphoribosylamine--glycine ligase [Edwardsiella tarda ATCC 23685]
          Length = 427

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 194/425 (45%), Positives = 274/425 (64%), Gaps = 9/425 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHA--QCVAIDIQNHSAIIHFC 58
           M +L+IG+GGREHALAWK AQSPL   ++  PGN G AQ    + +AI   +  A++ F 
Sbjct: 1   MNILIIGNGGREHALAWKAAQSPLAERVFVAPGNAGTAQEPALENIAIAATDIPALVDFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           + + IDL +VGPE PLV G+ DA  AAG  +FGPSQ AA+LE SK+F+K F  ++ IPTA
Sbjct: 61  RRQQIDLTIVGPEAPLVLGVVDAFRAAGLTIFGPSQSAARLEGSKAFSKDFLARHHIPTA 120

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            Y++F++   A  YV+ +  PIV+KADGL AGKGV+VA T++EA +AI        F   
Sbjct: 121 AYRNFTEVEPALAYVREQGAPIVIKADGLAAGKGVIVAMTLEEAEAAIHDMLAGNAFGDA 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
              ++IEE+L G E SF  + DG+  +P  T++DHKR+ DGD GPNTGGMGA SPA  +S
Sbjct: 181 GHRIVIEEFLTGEEASFIVMVDGEHVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMIT-EQGPYLIEYNVRFGDPECQAMM 292
           + ++  V++++I PT+ GM +E +P+ G L+AGLMI+ +  P +IE+N RFGDPE Q +M
Sbjct: 241 EAVHQRVMEQVIWPTVRGMAEEGSPYTGFLYAGLMISADGEPKVIEFNCRFGDPETQPIM 300

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGT 352
           MR++SD++ +  +   G L      W    AL VV+A  GYP +Y  G II  +   T  
Sbjct: 301 MRMQSDLVALCLAGAQGTLDQQTSAWDPRAALGVVLAAAGYPGDYRQGDIIHGLTHGTAD 360

Query: 353 TQLFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
            ++FHAGT +     +   GGRVL ATALG  I +++  AY +V+ + W  G+ R DIG 
Sbjct: 361 AKVFHAGTRLNPLGEVETCGGRVLCATALGDDIAQAQRNAYQLVDTLSWPGGFCRRDIGY 420

Query: 412 QKKER 416
           +  +R
Sbjct: 421 RALQR 425


>gi|261378565|ref|ZP_05983138.1| phosphoribosylamine--glycine ligase [Neisseria cinerea ATCC 14685]
 gi|269145119|gb|EEZ71537.1| phosphoribosylamine--glycine ligase [Neisseria cinerea ATCC 14685]
          Length = 423

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 196/423 (46%), Positives = 263/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   I +  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNTGTAIEPKLQNIALTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENITFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMVKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA  AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHVAIDDMLLGNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNHVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPTI GM+ E N F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTIAGMKAEGNEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G +IS +       +
Sbjct: 301 LNSDLADLVEAAIDGKLDSITAEWNPQTAVGVVLAAQNYPETPKKGDVISGLDAANQIGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    N+  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGNVLTNGGRVLCVVGLGDDVAQAKAKAYSALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|304388787|ref|ZP_07370843.1| phosphoribosylamine-glycine ligase [Neisseria meningitidis ATCC
           13091]
 gi|304337239|gb|EFM03417.1| phosphoribosylamine-glycine ligase [Neisseria meningitidis ATCC
           13091]
          Length = 423

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 193/423 (45%), Positives = 264/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   ID+  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNIDLTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  G+ D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENIVFTVVGPEAPLAAGVVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K  PIV+KADGL AGKGV+VA T+DEA +AID            +
Sbjct: 121 QTFENADAAHDYVNQKGAPIVIKADGLAAGKGVIVAMTLDEAHAAIDDMLLDNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD G NTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNNVLPMATSQDHKRLLDGDKGLNTGGMGAYSPAPVVTPV 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E + F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGHEFTGFLYAGLMIDQSGAPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G IIS +       +
Sbjct: 301 LNSDLSDLVEAAIDGKLDSVTAEWSPQTAVGVVLAAQNYPETPKKGDIISGLDAANQVGK 360

Query: 355 LFHAG-TAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAG TA    ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANEKGDVLTNGGRVLCVVGLGDNVVQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|77456840|ref|YP_346345.1| phosphoribosylamine--glycine ligase [Pseudomonas fluorescens Pf0-1]
 gi|77380843|gb|ABA72356.1| phosphoribosylamine--glycine ligase [Pseudomonas fluorescens Pf0-1]
          Length = 430

 Score =  337 bits (863), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 185/426 (43%), Positives = 269/426 (63%), Gaps = 10/426 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQC--VAIDIQNHSAIIHFC 58
           M VL+IGSGGREHALAWK+AQ P + +++  PGN G A  A+C  VAID+     +  F 
Sbjct: 1   MNVLIIGSGGREHALAWKVAQDPRVQKVFVAPGNAGSAIEAKCENVAIDVLALEQLADFA 60

Query: 59  QEKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTA 118
           ++  + L +VGPE+PLV G+ D   + G   FGP+  AA+LE SK+F K F  ++ IPTA
Sbjct: 61  EKN-VSLTIVGPEVPLVAGVVDLFRSRGLDCFGPTAGAAQLEGSKAFTKDFLARHKIPTA 119

Query: 119 TYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQI 173
            YQ+F++   A  Y++ K  PIV+KADGL AGKGV+VA T+ EA  A+        F   
Sbjct: 120 DYQNFTEIEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLAEAEDAVRDMLAGNAFGDA 179

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            S V+IEE+L+G E SF  + DGK  +P  T++DHKR+ DGD GPNTGGMGA SPA  ++
Sbjct: 180 GSRVVIEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDGDSGPNTGGMGAYSPAPVVT 239

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMM 292
            +++  V+ ++I PT+ GM  E N + G L+AGLMI +   P +IE+N RFGDPE Q +M
Sbjct: 240 ADVHQRVMDQVIWPTVRGMADEGNVYTGFLYAGLMIDKAGNPKVIEFNCRFGDPETQPVM 299

Query: 293 MRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTG- 351
           +RL+S ++ ++ + +   L      W    ++ +V+A  GYP +Y  G  I+ +      
Sbjct: 300 LRLQSSLVLLVEAALAQALDKVEAQWDPRPSVGIVLAAGGYPGDYAKGAPINGLDAAAAL 359

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGTA+ + N+   GGRVL ATA+G ++  ++E AY + + IDW+  ++R DIG 
Sbjct: 360 EGKVFHAGTALKDGNVVTAGGRVLCATAMGASVGAAQEQAYKLAKAIDWEGCFYRTDIGY 419

Query: 412 QKKERN 417
           +   R 
Sbjct: 420 RAIARE 425


>gi|221211684|ref|ZP_03584663.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans CGD1]
 gi|221169045|gb|EEE01513.1| phosphoribosylamine--glycine ligase [Burkholderia multivorans CGD1]
          Length = 425

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 186/423 (43%), Positives = 265/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI +  A+  F + 
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQMVYVAPGNGGTAQDERLKNVDITSLDALADFAES 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   +VGPE PL  GI +   A G K+FGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVAFTLVGPEAPLAAGIVNLFRARGLKIFGPTREAAQLESSKDFAKAFMKRHGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + FSD   A  Y+  K  PIVVKADGL AGKGVVVA T++EA  A+D            +
Sbjct: 121 ETFSDAAAAHAYIDAKGAPIVVKADGLAAGKGVVVAMTLEEAHEAVDMMLSGNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF  + DGK A+   +++DHKR+ D D GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLDGEEASFIVMVDGKHALALASSQDHKRLLDEDRGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II+PT+ GM+K+   F G L+AGLMI  E  P  +E+N R GDPE Q +M R
Sbjct: 241 MHARVMREIIMPTVRGMEKDGIRFTGFLYAGLMIDKEGNPRTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD  +++   + G L    ++W    AL VV+A  GYP+    G  I+ IP  T    
Sbjct: 301 LKSDFSKVVEQAIAGTLDTVELDWDRRTALGVVLAAHGYPDAPRKGDRINGIPAETEQAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT +  + L  +GGRVL    L  ++ E+++ AY  +  I+++   +R DIG +  
Sbjct: 361 TFHAGTTLDGDKLVTSGGRVLCVVGLADSVREAQQHAYDTINQINFEGMQYRRDIGHRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 SRK 423


>gi|171319554|ref|ZP_02908653.1| phosphoribosylamine/glycine ligase [Burkholderia ambifaria MEX-5]
 gi|171095235|gb|EDT40228.1| phosphoribosylamine/glycine ligase [Burkholderia ambifaria MEX-5]
          Length = 425

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 187/423 (44%), Positives = 267/423 (63%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   +DI +  A+  F + 
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQMVYVAPGNGGTAQDERLKNVDITSLDALADFAES 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +   +VGPE PL  GI +   A G KVFGP++ AA+LESSK FAK F  ++GIPTA Y
Sbjct: 61  EGVAFTLVGPEAPLAAGIVNLFRARGLKVFGPTREAAQLESSKDFAKAFMKRHGIPTADY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + FSD   A  Y+  K  PIVVKADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFSDAAAAHAYIDAKGAPIVVKADGLAAGKGVVVAMTLEEAHAAVDMMLSGNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L+G E SF  + DGK A+   +++DHKR+ D D GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLDGEEASFIVMVDGKHALALASSQDHKRLLDEDRGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMI-TEQGPYLIEYNVRFGDPECQAMMMR 294
           +++ V+++II+PT+ GM+K+   F G L+AGLMI  E  P  +E+N R GDPE Q +M R
Sbjct: 241 MHARVMREIIMPTVRGMEKDGIRFTGFLYAGLMIDKEGNPRTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+SD  +++   + G L +  ++W    AL VV+A  GYP+    G  I+ IP  T    
Sbjct: 301 LKSDFSKVVEQAIAGTLDSVELDWDRRTALGVVLAAHGYPDAPRKGDRINGIPAETAQAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT +  + L  +GGRVL    L  ++ E+++ AY  +  I+++   +R DIG +  
Sbjct: 361 TFHAGTTLEGDKLVTSGGRVLCVVGLADSVREAQQHAYDTINQINFEGMQYRRDIGFRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|323706013|ref|ZP_08117583.1| phosphoribosylamine/glycine ligase [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534627|gb|EGB24408.1| phosphoribosylamine/glycine ligase [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 416

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 170/416 (40%), Positives = 257/416 (61%), Gaps = 6/416 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M VL+IG GGREHA+  KI++S  + +++  PGN GI+  A+C+ I++ +   +  F  +
Sbjct: 1   MNVLVIGGGGREHAIVKKISESKRVDKIYCAPGNGGISDIAECIDINVSDVEKLKKFAID 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
            ++DL +VGPE+PL+ GI D    +G ++FGP + AA +E SK F K    KY IPTA +
Sbjct: 61  NNVDLTIVGPEVPLMKGIVDEFENSGLRIFGPRRDAAAIEGSKYFTKLLLHKYNIPTARF 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F     A  ++++   P+V+KADGL  GKGV +  +   A         ++ F     
Sbjct: 121 KAFDRYDAALNFLKDVWYPVVIKADGLAQGKGVFLVYSYKGAKEALDILMKEKRFGTSGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
           TVIIEE L G EVS  A  DGKT +P  +A D+KRI+DGD GPNTGGMG  +P      +
Sbjct: 181 TVIIEEMLFGREVSVLAFTDGKTIVPMVSAMDYKRIYDGDKGPNTGGMGNIAPNPYFDDK 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           L S V+  I+ P I  ++KE   ++GVL+AGL++TE GP ++E+N RFGDPE Q ++  L
Sbjct: 241 LLSVVVDTILKPVITSLKKEGIVYKGVLYAGLILTEDGPKVLEFNARFGDPETQVVLPLL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQL 355
           ++D+++I+ + +   L +  I W+ + A+ VV A++GYP E+  G  I+ + +NT    +
Sbjct: 301 KTDLVDIVEAIIDEKLSDVKIEWEDKKAVCVVAASEGYPGEFNTGYDITGV-ENTDGVFV 359

Query: 356 FHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
           +HAGT I +     +GGRVL  TALG T  E+R+ AY  ++ I ++  Y+R DIG 
Sbjct: 360 YHAGTTIKDGKYKTSGGRVLEVTALGNTYQEARKKAYDELKKIHFEGMYYRNDIGT 415


>gi|298293865|ref|YP_003695804.1| phosphoribosylamine/glycine ligase [Starkeya novella DSM 506]
 gi|296930376|gb|ADH91185.1| phosphoribosylamine/glycine ligase [Starkeya novella DSM 506]
          Length = 425

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 216/423 (51%), Positives = 284/423 (67%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVA-IDIQNHSAIIHFCQ 59
           M VLL+GSGGREHALAWK+AQSPL+   +++PGNPGIA+HA C   I + +H AI+  C 
Sbjct: 1   MNVLLLGSGGREHALAWKLAQSPLMGRFFALPGNPGIAEHATCFETIPLTDHDAIVAVCA 60

Query: 60  EKHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTAT 119
            + IDLVVVGPE PLV+GI+D L A GF VFGP + AA+LE SK F K+ C  + IPTA 
Sbjct: 61  AEKIDLVVVGPEAPLVDGIADRLIAEGFPVFGPRRVAAQLEGSKLFTKELCKAHDIPTAA 120

Query: 120 YQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF------QQI 173
           +  F+   +A+ +V+    PIV+KADGL AGKGV+VA T++EA + +D  F         
Sbjct: 121 FGRFTQAEEARAFVRKHGAPIVLKADGLMAGKGVIVAMTLEEALAGVDEVFAMSGEDGGF 180

Query: 174 NSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMS 233
            + ++IEE+L+G EVSFF L DG+T +PF +A+DHKR +DGD GPNTGGMGA SPA   S
Sbjct: 181 RTEILIEEFLDGEEVSFFCLVDGETVLPFGSAQDHKRAYDGDKGPNTGGMGAYSPAPIFS 240

Query: 234 QELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMM 293
            E+    + +II PT   +    +P++GVLFAGLMIT QGP LIEYNVRFGDPECQ + M
Sbjct: 241 AEMERRTLHEIIRPTARALADAASPYRGVLFAGLMITAQGPKLIEYNVRFGDPECQVLTM 300

Query: 294 RLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--G 351
           RLE D+L +L++   G L +  I  K E A+TVV+A  GYP  Y  G+ I  + +     
Sbjct: 301 RLEGDLLPLLHAVATGRLEDHDIGMKPEAAITVVMAANGYPGPYEKGSRIGGLVEAETVP 360

Query: 352 TTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGL 411
             ++FHAGT  V  ++ ANGGRVL+ TA+G  + E+RE AY  +  IDW  G+ R DI  
Sbjct: 361 GVKVFHAGTRRVGEDIVANGGRVLAVTAIGANVAEARERAYDAIGRIDWPEGFHRTDIAW 420

Query: 412 QKK 414
           +  
Sbjct: 421 RAL 423


>gi|91782568|ref|YP_557774.1| phosphoribosylamine--glycine ligase [Burkholderia xenovorans LB400]
 gi|91686522|gb|ABE29722.1| phosphoribosylamine--glycine ligase [Burkholderia xenovorans LB400]
          Length = 432

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 183/423 (43%), Positives = 263/423 (62%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQSP +  ++  PGN G AQ  +   I I + +A+  F ++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSPRVQLVYVAPGNGGTAQDERLRNIGITDPAALADFVEQ 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI +   + G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIAFTLVGPEAPLAAGIVNLFRSRGLKIFGPTKEAAQLESSKDFAKAFMKRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           + F++   A  Y+  +  PIV+KADGL AGKGVVVA T++EA +A+D            +
Sbjct: 121 ETFAEVAAAHAYLDARGAPIVIKADGLAAGKGVVVAQTLEEAHAAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +P  +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLAGEEASFIVMVDGKHVLPLASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPT+ GM+KE   + G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIILPTVRGMEKEGIRYTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D  +++   + G L    + W    AL VV+A   YP+   +G  IS IP  T  + 
Sbjct: 301 LKGDYSKVVEQAIAGTLDTVELEWDRRTALGVVLAAYNYPDTPRNGDRISDIPAETADSV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT +GGRVL    L  ++  ++ +AY  +  I +    +R DIG +  
Sbjct: 361 TFHAGTTLTDGKLTTSGGRVLCVVGLADSVRSAQSVAYETINQISFDGMQYRRDIGYRAL 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|239627143|ref|ZP_04670174.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239517289|gb|EEQ57155.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 428

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 183/423 (43%), Positives = 266/423 (62%), Gaps = 9/423 (2%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M+VL++G GGREHA+AWK AQSP + +++  PGN GIA  A+CV I + +  A   F +E
Sbjct: 1   MKVLIVGGGGREHAIAWKAAQSPKVEKIYCAPGNAGIAGLAECVDIGVMDFDAQAAFARE 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
             IDLV+VGP+ PL  G  DA  AAG +VFGP + AA LE SK+F+K    KY IPTA Y
Sbjct: 61  HGIDLVIVGPDDPLAAGAVDAFEAAGLRVFGPRKDAAILEGSKAFSKDLMKKYNIPTAAY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATS-----AIDRCFQQINS 175
           + F  P +A  Y+++  +PIV+KADGL  GKGV++  T +EA        +D+ F     
Sbjct: 121 ETFDSPEEALAYLEDAPIPIVLKADGLALGKGVLICNTREEAKEGVRTLMLDKQFGSAGD 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            +++EE++ G EVS  +  DGKT    T+A+DHKR  DGD G NTGGMG  SP+   ++E
Sbjct: 181 RIVVEEFMTGREVSVLSFVDGKTIKIMTSAQDHKRAGDGDQGLNTGGMGTFSPSPFYTEE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           + +   + I  PT++ M+ E   F+G++F GLM+TE+GP ++EYN RFGDPE Q ++ R+
Sbjct: 241 VDAFCKEHIYQPTVDAMKAEGREFKGIIFFGLMLTEKGPKVLEYNARFGDPETQVVLPRM 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT--GTT 353
           ++DI+++  +CV G L    + ++   A+ VV+A+ GYPE Y  G  ++           
Sbjct: 301 KNDIIDVFEACVDGTLDQIELEFEDNAAVCVVLASAGYPEHYEKGYKMTGFENFEGRDGY 360

Query: 354 QLFHAGTAI-VNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQ 412
            +FHAG+    + N+  NGGRVL  TA G+T+ E+RE AY   E I++ + Y R DIG +
Sbjct: 361 YVFHAGSKFDKDGNIVTNGGRVLGVTAKGRTLKEARENAYRATEWIEFGNKYMRHDIG-K 419

Query: 413 KKE 415
             +
Sbjct: 420 AID 422


>gi|313669307|ref|YP_004049591.1| phosphoribosylamine--glycine ligase [Neisseria lactamica ST-640]
 gi|313006769|emb|CBN88239.1| phosphoribosylamine--glycine ligase [Neisseria lactamica 020-06]
          Length = 423

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 191/423 (45%), Positives = 263/423 (62%), Gaps = 7/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L+IG+GGREHALAWK+AQSP +  ++  PGN G A   +   + +  H  +I FC++
Sbjct: 1   MKLLVIGNGGREHALAWKLAQSPKVETVFVAPGNAGTAIEPKLQNVALTAHQDLIEFCRK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           ++I   VVGPE PL  GI D   AAG K+FGP+Q AA+LESSK FAK F  KY IPTA Y
Sbjct: 61  ENITFTVVGPEAPLAAGIVDDFRAAGLKIFGPTQYAAQLESSKDFAKAFMAKYNIPTAQY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRC-----FQQINS 175
           Q F +   A  YV  K +PIV+KADGL AGKGV+VA T+D+A +AID            +
Sbjct: 121 QTFENADAAHGYVNQKGVPIVIKADGLTAGKGVIVAMTLDKAHTAIDDMLLGNKMGNAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IE++L+G E SF  + DG   +P  T++DHKR+ DGD GPNTGGMGA SPA  ++  
Sbjct: 181 RVVIEDFLQGEEASFIVMVDGNHVLPMATSQDHKRLLDGDKGPNTGGMGAYSPAPVVTPA 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           +Y   + +IILPT+ GM+ E   F G L+AGLMI +   PY IE+N RFGDPE Q +M R
Sbjct: 241 VYERAMNEIILPTVAGMKAEGYEFTGFLYAGLMIDQSGSPYTIEFNCRFGDPETQPIMSR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L SD+ +++ + + G L +    W  + A+ VV+A + YPE    G IIS +       +
Sbjct: 301 LSSDLADLVGAAIDGRLDSVKAEWNPQTAVGVVLAAQNYPETPKKGDIISGLDAANQIGK 360

Query: 355 LFHAGTAIVN-NNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQK 413
           +FHAGT      ++  NGGRVL    LG  + +++  AY  +E I +    +R+DI  + 
Sbjct: 361 VFHAGTTANGKGDVLTNGGRVLCVVGLGDDVAQAKAKAYGALEKISFDGMQYRKDIADKA 420

Query: 414 KER 416
             R
Sbjct: 421 INR 423


>gi|169831780|ref|YP_001717762.1| phosphoribosylamine--glycine ligase [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638624|gb|ACA60130.1| phosphoribosylamine--glycine ligase [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 425

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 180/425 (42%), Positives = 274/425 (64%), Gaps = 6/425 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           MR+L+IG GGREHAL WK+++SP + E+ + PGNPG+A+ A+CV +   +   ++   ++
Sbjct: 1   MRILVIGGGGREHALVWKLSKSPRVGEIIAAPGNPGMARLAECVPVSAGDIPGLLDLARK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + +DL   GPE PLV+G++D    AG +VFGP ++ A LE SK+FAK     YGIPTA +
Sbjct: 61  RGVDLTFAGPEAPLVDGLADVFEEAGLRVFGPRRQGAALEGSKAFAKDLMAAYGIPTAAH 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + F+DP  A++YV++   P VVKADGL AGKGV+V   V+EA +A+D            +
Sbjct: 121 RTFADPAAAREYVRHLDGPCVVKADGLAAGKGVIVCDGVEEALAAVDEVMVARAFGAAGN 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V++EE L G EVS  A  DG+T  P   A+DHK + +GD+GPNTGGMGA +PA   + E
Sbjct: 181 RVVVEERLSGEEVSILAFTDGRTIRPMLPAQDHKPVFEGDLGPNTGGMGAYAPAPVCTPE 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQAMMMRL 295
           +Y+ + ++I+ PT+  +++   P++GVL+AGLM+T +GP ++E+NVRFGDPE Q ++  L
Sbjct: 241 IYTRIAEEILAPTVRALRESGTPYRGVLYAGLMLTAEGPKVLEFNVRFGDPEAQPLLALL 300

Query: 296 ESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNT-GTTQ 354
           E+D+++I  + + G LH   ++W+   A+ VV+A+ GYP +Y  G +I  +         
Sbjct: 301 ETDLVDIAEAVIEGRLHEVDLSWRPGAAVCVVLASGGYPGDYRKGCVIGGLEAAELTGAL 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
           +FHAGTA  +  L   GGRVL  TA+   + E+  LAY   E I ++  Y+R DIG +  
Sbjct: 361 VFHAGTAERDGRLVTAGGRVLGVTAVAGELPEAIRLAYAAAELISFEGMYFRRDIGRKAL 420

Query: 415 ERNVK 419
            ++ +
Sbjct: 421 PKSQR 425


>gi|186476819|ref|YP_001858289.1| phosphoribosylamine--glycine ligase [Burkholderia phymatum STM815]
 gi|184193278|gb|ACC71243.1| phosphoribosylamine--glycine ligase [Burkholderia phymatum STM815]
          Length = 425

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 189/423 (44%), Positives = 260/423 (61%), Gaps = 6/423 (1%)

Query: 1   MRVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQE 60
           M++L++GSGGREHALAWK+AQS  +  ++  PGN G AQ  +   IDI + +A+  F ++
Sbjct: 1   MKLLVVGSGGREHALAWKLAQSQRVQLVYVAPGNGGTAQDDRLRNIDITDPNALADFVEK 60

Query: 61  KHIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATY 120
           + I   +VGPE PL  GI +   A G K+FGP++ AA+LESSK FAK F  ++ IPTA Y
Sbjct: 61  EQIAFTLVGPEQPLAAGIVNIFRARGLKIFGPTREAAQLESSKDFAKAFMKRHAIPTAEY 120

Query: 121 QHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF-----QQINS 175
           + FSD   A  Y+  K  PIV+KADGL AGKGVVVA T+DEA  A+D            +
Sbjct: 121 ETFSDVAAAHAYIDAKGAPIVIKADGLAAGKGVVVALTLDEAHHAVDMMLSDNKLGDAGA 180

Query: 176 TVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPALGMSQE 235
            V+IEE+L G E SF  + DGK  +   +++DHKR+ DGD GPNTGGMGA SPA  ++ +
Sbjct: 181 RVVIEEFLTGEEASFIVMVDGKNVLALASSQDHKRLLDGDQGPNTGGMGAYSPAPIVTPQ 240

Query: 236 LYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQ-GPYLIEYNVRFGDPECQAMMMR 294
           L++ V+++IILPT+ GM+KE   F G L+AGLMI  Q  P  +E+N R GDPE Q +M R
Sbjct: 241 LHARVMREIILPTVRGMEKEGIRFTGFLYAGLMIDAQGNPKTLEFNCRMGDPETQPIMAR 300

Query: 295 LESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQNTGTTQ 354
           L+ D  +++   + G L    + W    AL VV+A   YPE    G  IS IP  T    
Sbjct: 301 LKGDFSKVVEQAIAGTLDTVELEWDRRTALGVVLAAHDYPEAPRKGDFISGIPAETADAV 360

Query: 355 LFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDIGLQKK 414
            FHAGT + +  LT +GGRVL    L  ++  ++ +AY  + +I +    +R DIG +  
Sbjct: 361 TFHAGTTLKDGKLTTSGGRVLCVVGLADSVRSAQSVAYEAINHISFDGMQYRRDIGYRAA 420

Query: 415 ERN 417
            R 
Sbjct: 421 NRK 423


>gi|27262160|gb|AAN87361.1| Phosphoribosylamine--glycine ligase [Heliobacillus mobilis]
          Length = 438

 Score =  336 bits (862), Expect = 3e-90,   Method: Composition-based stats.
 Identities = 196/427 (45%), Positives = 270/427 (63%), Gaps = 12/427 (2%)

Query: 2   RVLLIGSGGREHALAWKIAQSPLLSELWSIPGNPGIAQHAQCVAIDIQNHSAIIHFCQEK 61
           +VL++G GGREHAL WK+ QSP +SE++  PGN GI + A+CV I   + + ++ F  EK
Sbjct: 10  KVLVVGGGGREHALVWKLRQSPRVSEVYCAPGNAGIEKIAKCVNIKADDVTGLLTFAWEK 69

Query: 62  HIDLVVVGPELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQ 121
            IDL VVGPE PL  GI D  N     +FGP+Q+AA++E SK+F+K    KYGIPTA+Y 
Sbjct: 70  RIDLTVVGPEAPLSAGIVDVFNDHEMPIFGPTQKAAEIEGSKAFSKDLMQKYGIPTASYG 129

Query: 122 HFSDPMKAKQYVQNKS-------MPIVVKADGLCAGKGVVVAATVDEATSAIDRC----- 169
            F++   A  +V   +        P VVKADGL AGKGV+VA  V EA  A+        
Sbjct: 130 VFTEVEPALAFVDELAARKTIAGSPCVVKADGLAAGKGVIVAKDVTEAKEAVRSMLEGNA 189

Query: 170 FQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGMGACSPA 229
           F    S V+IEE++EG EVS  A  DG   IP  +A+DHKRI D D GPNTGGMGA SPA
Sbjct: 190 FGSAGSRVVIEEFMEGEEVSILAFTDGDHVIPMVSAQDHKRIFDNDEGPNTGGMGAYSPA 249

Query: 230 LGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFGDPECQ 289
              ++EL   V + I+ PT+E M+ E  P+ GVL+AGLMIT +GP ++EYN RFGDPE Q
Sbjct: 250 PVYTEELAQQVQESILKPTVEAMKAEGRPYSGVLYAGLMITAEGPKVLEYNARFGDPETQ 309

Query: 290 AMMMRLESDILEILNSCVHGNLHNTHINWKAEYALTVVVATKGYPEEYPHGTIISKIPQN 349
            ++MRL++D+++I+ + +   L    I+W  + A+ VV++ KGYP +Y  G  I+ +   
Sbjct: 310 PVLMRLDTDLVDIIEAILEKRLDQQAISWSTDAAVCVVMSAKGYPGDYEKGNFITGLDNP 369

Query: 350 TGTTQLFHAGTAIVNNNLTANGGRVLSATALGKTITESRELAYHMVENIDWKHGYWREDI 409
               ++FHAGTA   +++   GGRVL  TA  + I E+ ELAY  V N+ +   ++R+DI
Sbjct: 370 IAGVEVFHAGTAQKGDHVVTTGGRVLGVTAKAQGIREAIELAYRQVGNVCFDGAHYRKDI 429

Query: 410 GLQKKER 416
           G +  ER
Sbjct: 430 GRRALER 436


>gi|312884770|ref|ZP_07744471.1| phosphoribosylamine--glycine ligase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309367683|gb|EFP95234.1| phosphoribosylamine--glycine ligase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 427

 Score =  336 bits (862), Expect = 4e-90,   Method: Composition-based stats.
 Identities = 199/426 (46%), Positives = 275/426 (64%), Gaps = 9/426 (2%