RPSBLAST alignment for GI: 254780206 and conserved domain: TIGR01142

>gnl|CDD|130212 TIGR01142, purT, phosphoribosylglycinamide formyltransferase 2. This enzyme is an alternative to PurN (TIGR00639). Length = 380
 Score = 47.8 bits (114), Expect = 6e-06
 Identities = 58/228 (25%), Positives = 104/228 (45%), Gaps = 25/228 (10%)

Query: 2   RVLLIGSG--GREHALAWKIAQSPLLSELWSI---PGNPGIAQHAQCVAIDIQNHSAIIH 56
           RVLL+GSG  G+E A    I    L  E+ ++      P +    +   I++ +  A+  
Sbjct: 1   RVLLLGSGELGKEVA----IEAQRLGVEVIAVDRYANAPAMQVAHRSYVINMLDGDALRA 56

Query: 57  FCQEKHIDLVVVGPELPLVNGIS-DALNAAGFKVFGPSQRAAKLESSKSFAKKFCTK-YG 114
             + +  D +V  PE+  +   +   L   G+ V  P+ RA KL  ++   ++   +  G
Sbjct: 57  VIEREKPDYIV--PEIEAIATDALFELEKEGYFVV-PNARATKLTMNREGIRRLAAEELG 113

Query: 115 IPTATYQHFSDPMKA-KQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCFQQ- 172
           +PT+ Y  F+D +   ++ V+    P VVK     +GKG  V    ++   A +   +  
Sbjct: 114 LPTSRY-MFADSLDELREAVEKIGYPCVVKPVMSSSGKGQSVVRGPEDIEKAWEYAQEGA 172

Query: 173 --INSTVIIEEYLE-GFEVSFFALC--DGKTAIPFTTARDHKRIHDGD 215
                 VI+EE+++  +E++   +   DG T   F     H++I DGD
Sbjct: 173 RGGAGRVIVEEFIDFDYEITLLTVRHVDGNTT--FCAPIGHRQI-DGD 217