RPSBLAST alignment for GI: 254780206 and conserved domain: pfam02655

>gnl|CDD|145680 pfam02655, ATP-grasp_3, ATP-grasp domain. No functional information or experimental verification of function is known in this family. This family appears to be an ATP-grasp domain (Pers. obs. A Bateman). Length = 160
 Score = 51.2 bits (123), Expect = 6e-07
 Identities = 41/149 (27%), Positives = 64/149 (42%), Gaps = 26/149 (17%)

Query: 139 PIVVK-ADGLCAGKGVVVAATVDEATSAIDRCFQQINSTVIIEEYLEGFEVSFFALCDGK 197
             +VK  DG C G+GV       E    I+          II+E++EG  +S   L DG+
Sbjct: 33  KYIVKPRDG-CGGEGVRFVENGREDEEFIENV--------IIQEFIEGEPLSVSLLSDGE 83

Query: 198 TAIPFTTARDHKRIHDGDIGPNTGGMGACSPALG-MSQELYSTVIQKI-ILPTIEGMQKE 255
            A+P +  R     + G      G +   +P+   + +EL     + +  LP + G    
Sbjct: 84  KALPLSVNRQLI-DNAGSGFVYAGNL---TPSRTELKEELEELAEEVVEALPGLRGY--- 136

Query: 256 QNPFQGVLFAGLMITEQGPYLIEYNVRFG 284
                GV    L++T+ GPY+IE N R  
Sbjct: 137 ----VGV---DLVLTDNGPYVIEVNPRIT 158