RPSBLAST alignment for GI: 254780206 and conserved domain: PRK12767

>gnl|CDD|183732 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional. Length = 326
 Score = 57.6 bits (140), Expect = 6e-09
 Identities = 58/238 (24%), Positives = 92/238 (38%), Gaps = 32/238 (13%)

Query: 53  AIIHFCQEKHIDLVVVG--PELPLVNGISDALNAAGFKVFGPSQRAAKLESSKSFAKKFC 110
            ++  C+++ IDL++    PELPL+    D     G KV   S+   ++ + K    +F 
Sbjct: 60  RLLDICKKEKIDLLIPLIDPELPLLAQNRDRFEEIGVKVLVSSKEVIEICNDKWLTYEFL 119

Query: 111 TKYGIPTA-TYQHFSDPMKAKQYVQNK-SMPIVVKADGLCAGKGVVVAATVDEATSAIDR 168
            + GIPT  +Y   S         + +   P+ VK     A  GV      +E    ++ 
Sbjct: 120 KENGIPTPKSYLPESLEDFKAALAKGELQFPLFVKPRDGSASIGVFKVNDKEELEFLLEY 179

Query: 169 CFQQINSTVIIEEYLEGFEVSFFALCDGKTAIPFTTARDHKRIHDGDIGPNTGGM--GAC 226
                   +II+E++EG E +   LCD    +     R  KRI           +  G  
Sbjct: 180 -----VPNLIIQEFIEGQEYTVDVLCDLNGEVISIVPR--KRI----------EVRAGET 222

Query: 227 SPALGMSQELYSTVIQKIILPTIEGMQKEQNPFQGVLFAGLMITEQGPYLIEYNVRFG 284
           S  +        TV    +    E + +      G L     +T+  PYL E N RFG
Sbjct: 223 SKGV--------TVKDPELFKLAERLAEALGAR-GPLNIQCFVTDGEPYLFEINPRFG 271