RPSBLAST alignment for GI: 254780206 and conserved domain: COG0045

>gnl|CDD|30394 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [Energy production and conversion]. Length = 387
 Score = 39.8 bits (93), Expect = 0.001
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 106 AKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSM-PIVVKADGLCAGKG----VVVAATVD 160
           AK+   KYGIP       + P +A++  +     P+VVKA     G+G    V +A + +
Sbjct: 8   AKELFAKYGIPVPPGYVATSPEEAEEAAKELGGGPVVVKAQVHAGGRGKAGGVKLAKSPE 67

Query: 161 EATSAIDRCFQQINSTVIIEEYLEGFEV 188
           EA  A +    +   T I  E +    V
Sbjct: 68  EAKEAAEEILGKNYQTDIKGEPVNKVLV 95