RPSBLAST alignment for GI: 254780206 and conserved domain: KOG0369

>gnl|CDD|35590 KOG0369, KOG0369, KOG0369, Pyruvate carboxylase [Energy production and conversion]. Length = 1176
 Score = 40.3 bits (94), Expect = 9e-04
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 8/139 (5%)

Query: 54  IIHFCQEKHIDLVVVGPELPLVNG-ISDALNAAGFKVFGPSQRAAKLESSKSFAKKFCTK 112
           II   ++ ++D V  G          + A+  AG +  GPS         K  A+    +
Sbjct: 98  IISIAKKHNVDAVHPGYGFLSERSDFAQAVQDAGIRFIGPSPEVIDSMGDKVAARAIAIE 157

Query: 113 YGIPT--ATYQHFSDPMKAKQYVQNKSMPIVVKADGLCAGKGVVVAATVDEATSAIDRCF 170
            G+P    T    +   +A ++V+   +P+++KA     G+G+ V  + ++   A  R +
Sbjct: 158 AGVPVVPGTPGPITTVEEALEFVKEYGLPVIIKAAYGGGGRGMRVVRSGEDVEEAFQRAY 217

Query: 171 QQI-----NSTVIIEEYLE 184
            +      N T+ +E++LE
Sbjct: 218 SEALAAFGNGTLFVEKFLE 236