BLAST/BLAST alignment of GI: 254780206 and GI: 254780268
>gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443
 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 8/113 (7%)

Query: 87  FKVFGPSQRAAKLESSKSFAKKFCTKYGIPTATYQHFSDPMKAKQYVQNKSMPIVVKADG 146
            K  GPS    K+   K  AKK   + GIP         P  A    +    P++VKA  
Sbjct: 100 IKFIGPSSEHIKIMGDKITAKKTAQQLGIPVVPGSGEVYPHTAMPIAKEIGFPVLVKASA 159

Query: 147 LCAGKGVVVAATVDEATSAIDRCFQQI-----NSTVIIEEYLEG---FEVSFF 191
              G+G+ +A + ++ + AID+   +      N  V IE+YLE     EV  F
Sbjct: 160 GGGGRGMRIAYSENDLSEAIDQARSEALAAFGNDAVYIEKYLENPRHIEVQIF 212