BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780207|ref|YP_003064620.1| hypothetical protein CLIBASIA_00460 [Candidatus Liberibacter asiaticus str. psy62] (98 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780207|ref|YP_003064620.1| hypothetical protein CLIBASIA_00460 [Candidatus Liberibacter asiaticus str. psy62] Length = 98 Score = 201 bits (511), Expect = 2e-54, Method: Compositional matrix adjust. Identities = 98/98 (100%), Positives = 98/98 (100%) Query: 1 MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAV 60 MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAV Sbjct: 1 MRHLILIMLLSILTTNIARAQVYHIHSPRIATKSSIHIKCHSCTLNKHHINKTPSSSSAV 60 Query: 61 YTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK 98 YTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK Sbjct: 61 YTKKEELIDGKKAMITTDNFMGGEPITFIKYLFEEDKK 98 >gi|254780326|ref|YP_003064739.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 416 Score = 20.8 bits (42), Expect = 5.0, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 10/13 (76%) Query: 68 IDGKKAMITTDNF 80 +D KAM+TTD + Sbjct: 153 LDSAKAMMTTDRY 165 >gi|254780153|ref|YP_003064566.1| phosphoserine aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 391 Score = 20.8 bits (42), Expect = 5.7, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 8/14 (57%) Query: 39 KCHSCTLNKHHINK 52 + H C L K INK Sbjct: 39 RSHRCVLGKERINK 52 >gi|254780742|ref|YP_003065155.1| hypothetical protein CLIBASIA_03145 [Candidatus Liberibacter asiaticus str. psy62] Length = 419 Score = 20.8 bits (42), Expect = 5.8, Method: Compositional matrix adjust. Identities = 15/59 (25%), Positives = 21/59 (35%), Gaps = 10/59 (16%) Query: 30 IATKSSIHIKCHSCTLNKHHINKTPSSS----------SAVYTKKEELIDGKKAMITTD 78 I H+ H C N + +S ++Y KK IDGK A+ D Sbjct: 8 IGAGGVAHVVAHKCAQNNDILGDINIASRTLQKCSKIIDSIYKKKSLKIDGKLAIHQVD 66 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.132 0.381 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,140 Number of Sequences: 1233 Number of extensions: 1976 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 98 length of database: 328,796 effective HSP length: 61 effective length of query: 37 effective length of database: 253,583 effective search space: 9382571 effective search space used: 9382571 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)