RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780208|ref|YP_003064621.1| hypothetical protein CLIBASIA_00465 [Candidatus Liberibacter asiaticus str. psy62] (66 letters) >gnl|CDD|146042 pfam03214, RGP, Reversibly glycosylated polypeptide. Length = 349 Score = 25.2 bits (55), Expect = 3.9 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 11/43 (25%) Query: 33 MSIKILKNTLT----------TAFISSFKSFISRFLHMIANKD 65 MS++IL + + T F+ ++ F SRF H+I KD Sbjct: 1 MSLEILDDEVDIVIGALRANLTDFLEEWRPFFSRF-HLIIVKD 42 >gnl|CDD|147372 pfam05158, RNA_pol_Rpc34, RNA polymerase Rpc34 subunit. Subunit specific to RNA Pol III, the tRNA specific polymerase. The C34 subunit of yeast RNA Pol III is part of a subcomplex of three subunits which have no counterpart in the other two nuclear RNA polymerases. This subunit interacts with TFIIIB70 and is therefore participates in Pol III recruitment. Length = 313 Score = 25.0 bits (55), Expect = 5.1 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 7/43 (16%) Query: 28 LRNR---HMSI--KILKNTLTTAFISSFKS--FISRFLHMIAN 63 ++NR H S+ K LK+ + +I S KS +R ++M+ N Sbjct: 105 IKNRTNLHQSVLKKCLKSLESKKYIKSVKSVKAPTRKMYMLYN 147 >gnl|CDD|36238 KOG1020, KOG1020, KOG1020, Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics, Cell cycle control, cell division, chromosome partitioning, Replication, recombination and repair]. Length = 1692 Score = 24.6 bits (53), Expect = 6.6 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Query: 10 IMHLFLDQI-GNFLMFFPMLRNRHMSIKILKNTL 42 IM LFLD I + L L+ R ++IK+LK L Sbjct: 1336 IMQLFLDNILESCLDR--DLQVRLVAIKVLKLIL 1367 >gnl|CDD|31000 COG0655, WrbA, Multimeric flavodoxin WrbA [General function prediction only]. Length = 207 Score = 23.9 bits (51), Expect = 9.3 Identities = 11/57 (19%), Positives = 22/57 (38%) Query: 4 WGMMIRIMHLFLDQIGNFLMFFPMLRNRHMSIKILKNTLTTAFISSFKSFISRFLHM 60 +G + M F+D+ L LR + + + + ++ S + FLH Sbjct: 87 FGNVSAQMKAFIDRSTGPLWAPGALRGKVGAAFVSGGSRGGGQEATLLSLLLFFLHH 143 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.342 0.145 0.458 Gapped Lambda K H 0.267 0.0715 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 804,816 Number of extensions: 34102 Number of successful extensions: 244 Number of sequences better than 10.0: 1 Number of HSP's gapped: 244 Number of HSP's successfully gapped: 21 Length of query: 66 Length of database: 6,263,737 Length adjustment: 37 Effective length of query: 29 Effective length of database: 5,464,204 Effective search space: 158461916 Effective search space used: 158461916 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.5 bits) S2: 51 (23.5 bits)