Query gi|254780209|ref|YP_003064622.1| hypothetical protein CLIBASIA_00470 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 51 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 23 16:49:08 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780209.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam11712 Vma12 Endoplasmic re 71.5 3.9 0.0001 22.3 2.8 25 27-51 16-41 (137) 2 TIGR02434 CobF precorrin-6A sy 64.2 6.5 0.00017 21.2 2.7 22 28-49 227-248 (259) 3 PRK08284 precorrin 6A synthase 36.9 30 0.00077 17.7 2.5 22 28-49 218-239 (253) 4 PRK09755 putative binding prot 31.7 42 0.0011 17.0 2.6 24 1-24 1-24 (535) 5 PTZ00079 NADP-specific glutama 29.3 46 0.0012 16.8 2.4 23 19-42 148-170 (469) 6 PRK09414 glutamate dehydrogena 25.4 55 0.0014 16.4 2.3 22 19-41 125-146 (446) 7 PRK03001 heat shock protein Ht 24.1 67 0.0017 16.0 2.5 20 30-51 265-284 (284) 8 pfam09193 CholecysA-Rec_N Chol 23.4 57 0.0014 16.4 2.0 17 21-38 27-43 (47) 9 pfam11240 DUF3042 Protein of u 23.2 68 0.0017 15.9 2.4 23 28-50 31-53 (54) 10 pfam02951 GSH-S_N Prokaryotic 23.2 73 0.0019 15.8 2.5 26 4-29 92-117 (119) 11 COG3977 Alanine-alpha-ketoisov 21.9 79 0.002 15.6 2.5 27 17-43 178-209 (417) 12 TIGR02109 PQQ_syn_pqqE coenzym 21.8 87 0.0022 15.4 2.9 21 29-49 196-216 (363) 13 PRK12361 hypothetical protein; 21.8 86 0.0022 15.4 2.7 34 6-49 190-223 (546) No 1 >pfam11712 Vma12 Endoplasmic reticulum-based factor for assembly of V-ATPase. The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterized member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localized to the endoplasmic reticulum. Probab=71.53 E-value=3.9 Score=22.28 Aligned_cols=25 Identities=56% Similarity=0.810 Sum_probs=21.3 Q ss_pred CCC-CCHHHHHHHHHHHHHHHHHHCC Q ss_conf 899-9878998999999999863049 Q gi|254780209|r 27 PKG-PSKEEQARIEQIRAEARERRYQ 51 (51) Q Consensus 27 pkg-pskeeqarieqiraearerryq 51 (51) ||. ||.|-.||.|.+|+++.|+.|| T Consensus 16 ~kp~~spE~~A~~erLr~~~ee~eY~ 41 (137) T pfam11712 16 PKPEPSPEFLARLERLRAAQEEREYQ 41 (137) T ss_pred CCCCCCHHHHHHHHHHHHHHHHHHHH T ss_conf 99999989999999999999899999 No 2 >TIGR02434 CobF precorrin-6A synthase (deacetylating); InterPro: IPR012797 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase . There are at least two distinct cobalamin biosynthetic pathways in bacteria : Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii. Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans. This entry represents CobF precorrin-6A synthase (2.1.1.152 from EC), a pathway-specific enzyme in the aerobic pathway. After precorrin-4 is methylated at C-11 by CobM to produce precorrin-5, the extruded acyl group is then removed in the subsequent step, which also sees a methyl group added at C-1 in a reaction catalysed by CobF. The product of this reaction is precorrin-6A, which is subsequently reduced by an NADH-dependent reductase to precorrin-6B . This entry identifies CobF in high GC Gram-positive, alphaproteobacteria and pseudomonas-related species.. Probab=64.21 E-value=6.5 Score=21.16 Aligned_cols=22 Identities=45% Similarity=0.747 Sum_probs=19.8 Q ss_pred CCCCHHHHHHHHHHHHHHHHHH Q ss_conf 9998789989999999998630 Q gi|254780209|r 28 KGPSKEEQARIEQIRAEARERR 49 (51) Q Consensus 28 kgpskeeqarieqiraearerr 49 (51) +|+-.|-.+||..+|+++|+|. T Consensus 227 sG~l~Ev~~rI~~~R~~aR~r~ 248 (259) T TIGR02434 227 SGPLAEVGPRIAELRAQARARK 248 (259) T ss_pred ECCCHHHHHHHHHHHHHHHHHC T ss_conf 2785657899999999999867 No 3 >PRK08284 precorrin 6A synthase; Provisional Probab=36.87 E-value=30 Score=17.75 Aligned_cols=22 Identities=45% Similarity=0.522 Sum_probs=17.4 Q ss_pred CCCCHHHHHHHHHHHHHHHHHH Q ss_conf 9998789989999999998630 Q gi|254780209|r 28 KGPSKEEQARIEQIRAEARERR 49 (51) Q Consensus 28 kgpskeeqarieqiraearerr 49 (51) .||-.|-..+|...|++||+|. T Consensus 218 ~G~l~~v~~~I~~~ra~ar~~~ 239 (253) T PRK08284 218 AGRLGEVGERILALRAEARARH 239 (253) T ss_pred CCCHHHHHHHHHHHHHHHHHHC T ss_conf 0548888999999999999854 No 4 >PRK09755 putative binding protein; Provisional Probab=31.71 E-value=42 Score=17.00 Aligned_cols=24 Identities=29% Similarity=0.401 Sum_probs=18.4 Q ss_pred CCHHHHHHHHHHHHHHHHCCCEEC Q ss_conf 924789999999866553042012 Q gi|254780209|r 1 MYTKSLLMVAYLLSSVAISGGLCF 24 (51) Q Consensus 1 mytksllmvayllssvaisgglcf 24 (51) ||+|++|+++-|+|...+-...|. T Consensus 1 ~~~~~~~~~~~l~~~~~~~a~~~~ 24 (535) T PRK09755 1 MYTRNLLWLVSLVSAAPLYAADVP 24 (535) T ss_pred CCHHHHHHHHHHHHHHHHHHCCCC T ss_conf 915799999999999999863689 No 5 >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Probab=29.33 E-value=46 Score=16.81 Aligned_cols=23 Identities=39% Similarity=0.530 Sum_probs=18.1 Q ss_pred CCCEECCCCCCCCHHHHHHHHHHH Q ss_conf 042012588999878998999999 Q gi|254780209|r 19 SGGLCFNRPKGPSKEEQARIEQIR 42 (51) Q Consensus 19 sgglcfnrpkgpskeeqarieqir 42 (51) .||..|| ||+-|+.|--|+-|-- T Consensus 148 KGG~~~d-Pk~~S~~EieR~~r~f 170 (469) T PTZ00079 148 KGGSDFD-PKGKSDNEILKFCQSF 170 (469) T ss_pred CCCEECC-CCCCCHHHHHHHHHHH T ss_conf 7731328-9899989999999999 No 6 >PRK09414 glutamate dehydrogenase; Provisional Probab=25.43 E-value=55 Score=16.41 Aligned_cols=22 Identities=45% Similarity=0.626 Sum_probs=17.2 Q ss_pred CCCEECCCCCCCCHHHHHHHHHH Q ss_conf 04201258899987899899999 Q gi|254780209|r 19 SGGLCFNRPKGPSKEEQARIEQI 41 (51) Q Consensus 19 sgglcfnrpkgpskeeqarieqi 41 (51) .||..|| ||+.|..|--|+-|- T Consensus 125 KGGi~~D-Pk~~S~~El~R~~r~ 146 (446) T PRK09414 125 KGGSDFD-PKGKSDAEIMRFCQS 146 (446) T ss_pred CCCCCCC-CCCCCHHHHHHHHHH T ss_conf 6651328-877999999999999 No 7 >PRK03001 heat shock protein HtpX; Provisional Probab=24.09 E-value=67 Score=15.96 Aligned_cols=20 Identities=45% Similarity=0.699 Sum_probs=15.7 Q ss_pred CCHHHHHHHHHHHHHHHHHHCC Q ss_conf 9878998999999999863049 Q gi|254780209|r 30 PSKEEQARIEQIRAEARERRYQ 51 (51) Q Consensus 30 pskeeqarieqiraearerryq 51 (51) |+-| .||+++++-||+.||. T Consensus 265 Pp~e--~RI~rL~~~ar~~~~~ 284 (284) T PRK03001 265 PSTE--ERIARLMAMARTGRFD 284 (284) T ss_pred CCHH--HHHHHHHHHHHHCCCC T ss_conf 8989--9999999987646899 No 8 >pfam09193 CholecysA-Rec_N Cholecystokinin A receptor, N-terminal. Members of this family are found in the extracellular region of the cholecystokinin A receptor, where they adopt a tertiary structure consisting of a few helical turns and a disulphide-crosslinked loop. They are required for interaction of the cholecystokinin A receptor with it's corresponding hormonal ligand. Probab=23.36 E-value=57 Score=16.35 Aligned_cols=17 Identities=41% Similarity=0.841 Sum_probs=13.3 Q ss_pred CEECCCCCCCCHHHHHHH Q ss_conf 201258899987899899 Q gi|254780209|r 21 GLCFNRPKGPSKEEQARI 38 (51) Q Consensus 21 glcfnrpkgpskeeqari 38 (51) -.|.+.|. ||||-|.-+ T Consensus 27 ~~Cld~P~-psK~wqpav 43 (47) T pfam09193 27 LFCLDQPR-PSKEWQPAV 43 (47) T ss_pred EEECCCCC-CCHHHHHHH T ss_conf 78737999-816786889 No 9 >pfam11240 DUF3042 Protein of unknown function (DUF3042). This family of proteins with unknown function appears to be restricted to Firmicutes. Probab=23.22 E-value=68 Score=15.94 Aligned_cols=23 Identities=30% Similarity=0.406 Sum_probs=18.1 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHC Q ss_conf 99987899899999999986304 Q gi|254780209|r 28 KGPSKEEQARIEQIRAEARERRY 50 (51) Q Consensus 28 kgpskeeqarieqiraearerry 50 (51) --|..|+.++||+-|-.|--+|. T Consensus 31 i~Pieeke~~ieenRk~A~RK~~ 53 (54) T pfam11240 31 IEPIEEKEEFIEENRKKAARKRV 53 (54) T ss_pred CCCHHHHHHHHHHHHHHHHHHCC T ss_conf 59277899999988999875026 No 10 >pfam02951 GSH-S_N Prokaryotic glutathione synthetase, N-terminal domain. Probab=23.15 E-value=73 Score=15.78 Aligned_cols=26 Identities=27% Similarity=0.505 Sum_probs=21.4 Q ss_pred HHHHHHHHHHHHHHHCCCEECCCCCC Q ss_conf 78999999986655304201258899 Q gi|254780209|r 4 KSLLMVAYLLSSVAISGGLCFNRPKG 29 (51) Q Consensus 4 ksllmvayllssvaisgglcfnrpkg 29 (51) ...+...|||....-.|-+++|.|.+ T Consensus 92 ~~Yi~~T~lLe~~~~~g~~ViN~P~~ 117 (119) T pfam02951 92 MEYIYATYLLERAERAGTLVVNDPQS 117 (119) T ss_pred HHHHHHHHHHHHHHHCCCEEECCCHH T ss_conf 89999999998775579889828243 No 11 >COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Probab=21.94 E-value=79 Score=15.61 Aligned_cols=27 Identities=30% Similarity=0.767 Sum_probs=19.4 Q ss_pred HHCCCEECCCCCCCC-----HHHHHHHHHHHH Q ss_conf 530420125889998-----789989999999 Q gi|254780209|r 17 AISGGLCFNRPKGPS-----KEEQARIEQIRA 43 (51) Q Consensus 17 aisgglcfnrpkgps-----keeqarieqira 43 (51) .-.|-.||.||..|. .||-+|+.++-+ T Consensus 178 e~~g~ic~SRPtNPTGNVlTdeE~~kldalA~ 209 (417) T COG3977 178 ESTGAICVSRPTNPTGNVLTDEELAKLDALAR 209 (417) T ss_pred CCEEEEEECCCCCCCCCCCCHHHHHHHHHHHH T ss_conf 76026996478898877364889998998742 No 12 >TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E; InterPro: IPR011843 This entry describes coenzyme PQQ biosynthesis protein E, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ). PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases.; GO: 0051539 4 iron 4 sulfur cluster binding, 0018189 pyrroloquinoline quinone biosynthetic process. Probab=21.82 E-value=87 Score=15.40 Aligned_cols=21 Identities=38% Similarity=0.491 Sum_probs=18.2 Q ss_pred CCCHHHHHHHHHHHHHHHHHH Q ss_conf 998789989999999998630 Q gi|254780209|r 29 GPSKEEQARIEQIRAEARERR 49 (51) Q Consensus 29 gpskeeqarieqiraearerr 49 (51) =|+++.-++-++|-+|||||- T Consensus 196 lPt~~Ql~~a~r~V~~aRer~ 216 (363) T TIGR02109 196 LPTREQLEEATRIVEEARERL 216 (363) T ss_pred CCCHHHHHHHHHHHHHHHHHH T ss_conf 898899999999999999998 No 13 >PRK12361 hypothetical protein; Provisional Probab=21.80 E-value=86 Score=15.43 Aligned_cols=34 Identities=35% Similarity=0.478 Sum_probs=20.8 Q ss_pred HHHHHHHHHHHHHCCCEECCCCCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 99999998665530420125889998789989999999998630 Q gi|254780209|r 6 LLMVAYLLSSVAISGGLCFNRPKGPSKEEQARIEQIRAEARERR 49 (51) Q Consensus 6 llmvayllssvaisgglcfnrpkgpskeeqarieqiraearerr 49 (51) +.|.||||+. .|...-.|--.+|.+||..||-.. T Consensus 190 ~v~aAyll~~----------~~~~~~~~~~~~i~~~r~ta~ln~ 223 (546) T PRK12361 190 LVLAAYLLCK----------DKQLSVEEVLQQIKQIRKTARLNK 223 (546) T ss_pred HHHHHHHHHC----------CCCCCHHHHHHHHHHHHHHCCCCH T ss_conf 9999999733----------888999999999999987524789 Done!