BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780211|ref|YP_003064624.1| hypothetical protein
CLIBASIA_00480 [Candidatus Liberibacter asiaticus str. psy62]
         (56 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780211|ref|YP_003064624.1| hypothetical protein CLIBASIA_00480 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254039888|gb|ACT56684.1| hypothetical protein CLIBASIA_00480 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 56

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/56 (100%), Positives = 56/56 (100%)

Query: 1  MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK 56
          MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK
Sbjct: 1  MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK 56


Searching..................................................done


Results from round 2





CONVERGED!
>gi|254780211|ref|YP_003064624.1| hypothetical protein CLIBASIA_00480 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254039888|gb|ACT56684.1| hypothetical protein CLIBASIA_00480 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 56

 Score =  103 bits (256), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 56/56 (100%), Positives = 56/56 (100%)

Query: 1  MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK 56
          MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK
Sbjct: 1  MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK 56


  Database: nr
    Posted date:  May 13, 2011  4:10 AM
  Number of letters in database: 999,999,932
  Number of sequences in database:  2,987,209
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 13, 2011  4:17 AM
  Number of letters in database: 999,998,956
  Number of sequences in database:  2,896,973
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 13, 2011  4:23 AM
  Number of letters in database: 999,999,979
  Number of sequences in database:  2,907,862
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 13, 2011  4:29 AM
  Number of letters in database: 999,999,513
  Number of sequences in database:  2,932,190
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 13, 2011  4:33 AM
  Number of letters in database: 792,586,372
  Number of sequences in database:  2,260,650
  
Lambda     K      H
   0.329    0.141    0.420 

Lambda     K      H
   0.267   0.0455    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,051,790,542
Number of Sequences: 13984884
Number of extensions: 30485589
Number of successful extensions: 44937
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 44935
Number of HSP's gapped (non-prelim): 2
length of query: 56
length of database: 4,792,584,752
effective HSP length: 29
effective length of query: 27
effective length of database: 4,387,023,116
effective search space: 118449624132
effective search space used: 118449624132
T: 11
A: 40
X1: 16 ( 7.6 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 76 (33.7 bits)