BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780211|ref|YP_003064624.1| hypothetical protein CLIBASIA_00480 [Candidatus Liberibacter asiaticus str. psy62] (56 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780211|ref|YP_003064624.1| hypothetical protein CLIBASIA_00480 [Candidatus Liberibacter asiaticus str. psy62] Length = 56 Score = 115 bits (289), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 56/56 (100%), Positives = 56/56 (100%) Query: 1 MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK 56 MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK Sbjct: 1 MIFSQIEGELFLKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGKSKCKRGRGK 56 >gi|254780858|ref|YP_003065271.1| NADH dehydrogenase I subunit F [Candidatus Liberibacter asiaticus str. psy62] Length = 425 Score = 23.1 bits (48), Expect = 0.98, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Query: 12 LKTALVVVRERTECPIHRYFKIAVFIKQYTNTAFGK-SKCKRGRG 55 L TA V+V +R+ I ++++VF Y + + G+ + C+ G G Sbjct: 315 LGTAAVIVMDRSTDIIKAIWRLSVF---YKHESCGQCTPCREGTG 356 >gi|254780869|ref|YP_003065282.1| beta-lactamase domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 559 Score = 21.2 bits (43), Expect = 3.9, Method: Composition-based stats. Identities = 6/11 (54%), Positives = 8/11 (72%) Query: 18 VVRERTECPIH 28 V+ E ECP+H Sbjct: 356 VIAEDAECPVH 366 >gi|254780664|ref|YP_003065077.1| bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 536 Score = 20.4 bits (41), Expect = 5.5, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 8 GELFLKTALVVVRERT 23 GE+ +KTAL+ V +T Sbjct: 12 GEIAVKTALISVHNKT 27 >gi|254781011|ref|YP_003065424.1| orotate phosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 228 Score = 20.0 bits (40), Expect = 8.3, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 4 SQIEGELFLKTALVVVRE 21 SQIEG LF ++V+ + Sbjct: 117 SQIEGHLFKGARVLVIED 134 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.141 0.420 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,007 Number of Sequences: 1233 Number of extensions: 745 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 56 length of database: 328,796 effective HSP length: 28 effective length of query: 28 effective length of database: 294,272 effective search space: 8239616 effective search space used: 8239616 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 31 (16.5 bits)