>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF; InterPro: IPR014110 This entry includes TraF; a protein that is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically in the F-type system. TraF has been predicted to contain a thioredoxin fold and has been shown to be localized to the periplasm . Unlike the related protein TrbB (IPR014109 from INTERPRO), TraF does not contain a conserved pair of cysteines and has been shown not to function as a thiol disulphide isomerase by complementation of an Escherichia coli DsbA defect . The protein is believed to be involved in pilin assembly . Even more closely related than TrbB is a clade of genes (IPR014111 from INTERPRO), which do contain the CXXC motif, but it is unclear whether these are involved in type-F conjugation systems per se..

Probab=94.51 E-value=0.037 Score=34.75 Aligned_cols=92 Identities=15% Similarity=0.179 Sum_probs=53.9 Q ss_pred HHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCHHHHHHHHH Q ss_conf 8986998-599996511367663112610000000001-233332223444321--111222210000000012344589 Q gi|254780212|r 25 LLALGGS-KIVLYFYPKDDTSGCTAEAINFSSLKADFD-EESTILIGISPDSIA--SHKKFHQKHNLSITLLADESKEVL 100 (157) Q Consensus 25 l~~l~gk-~vvl~f~~~~~tp~C~~e~~~l~~~~~~~~-~~gv~vv~is~d~~~--~~~~~~~~~~~~fpil~D~~~~~~ 100 (157) T Consensus 154 I~~l~~~G~Gl~FFYrG~s-p~----s~~~a~~i~~F~~~y~~~vi~vS~DG~~~p~l~n~R---~iPl-----edsgqa 220 (270) T TIGR02739 154 IEQLSQSGYGLFFFYRGKS-PI----SQKLAPVIQAFAKEYGISVIPVSVDGTLIPELPNSR---LIPL-----EDSGQA 220 (270) T ss_pred HHHHHHCCCCEEEEECCCC-HH----HHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCC---CCCC-----CCHHHH T ss_conf 9999762762478865998-45----678999999888541966756612432054668888---3565-----451357 Q ss_pred HHCCCCCCCCCCCCCCCCCCEEEEEECCCC-EEEEEECCCCC Q ss_conf 985986666557665444210799988999-79999768885 Q gi|254780212|r 101 KSYDVWKEKSMFGKKYMGVVRTTFLIDEKG-IIAQIWKPVTL 141 (157) Q Consensus 101 ~~~gv~~~~~~~~~~~~~~~r~tfiid~~G-~I~~~~~~~~~ 141 (157) T Consensus 221 ~~l~V~~------------~PAl~LV~P~~~~~~PlAYGf~S 250 (270) T TIGR02739 221 QKLGVKY------------FPALYLVDPKSQKMSPLAYGFIS 250 (270) T ss_pred HHCCCCC------------CCEEEEEECCCCCEEEEEHHHCC T ss_conf 6613420------------34256872676722010010204

HHsearch alignment for GI: 254780212 and conserved domain: TIGR02739