>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properti

Probab=99.71 E-value=1.8e-17 Score=128.78 Aligned_cols=129 Identities=19% Similarity=0.305 Sum_probs=101.9 Q ss_pred CCCCEEEECCCCCEEEHHHHCCCEEEEEEEECCCCCC-CCCCCCCCCCCCCCCCCC---CCCCCCCCCC----CCCCCCC Q ss_conf 5373078869997882898699859999651136766-311261000000000123---3332223444----3211112 Q gi|254780212|r 9 KAPHFVLPSNDEQEISLLALGGSKIVLYFYPKDDTSG-CTAEAINFSSLKADFDEE---STILIGISPD----SIASHKK 80 (157) Q Consensus 9 ~aP~f~l~~~~g~~~~l~~l~gk~vvl~f~~~~~tp~-C~~e~~~l~~~~~~~~~~---gv~vv~is~d----~~~~~~~ 80 (157) T Consensus 1 ~~p~f~L~d~~G~~~~~~~~~gk~~lv~F~-yt~Cp~~Cp~~~~~l~~~~~~l~~~~~~~v~~v~ISvDP~rDtpe~L~~ 79 (142) T cd02968 1 IGPDFTLTDQDGRPVTLSDLKGKPVLVYFG-YTHCPDVCPTTLANLAQALKQLGADGGDDVQVVFISVDPERDTPEVLKA 79 (142) T ss_pred CCCCEEEECCCCCEEEHHHHCCCEEEEEEE-CCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHHH T ss_conf 979869991998998279979988999987-4679993489999999999986443258579999990888899999999 Q ss_pred CCCCCCCCCCCHHHHH---HHHHHHCCCCCCCCCCCCCCCCC-C-EEEEEECCCCEEEEEECC Q ss_conf 2221000000001234---45899859866665576654442-1-079998899979999768 Q gi|254780212|r 81 FHQKHNLSITLLADES---KEVLKSYDVWKEKSMFGKKYMGV-V-RTTFLIDEKGIIAQIWKP 138 (157) Q Consensus 81 ~~~~~~~~fpil~D~~---~~~~~~~gv~~~~~~~~~~~~~~-~-r~tfiid~~G~I~~~~~~ 138 (157) T Consensus 80 y~~~~~~~w~~Ltg~~~~i~~l~~~~gv~~~~~~~~~~~~~~~Hs~~~~lid~~G~i~~~~~g 142 (142) T cd02968 80 YAKAFGPGWIGLTGTPEEIEALAKAFGVYYEKVPEDDGDYLVDHSAAIYLVDPDGKLVRYYGG 142 (142) T ss_pred HHHHHCCCCEEEECCHHHHHHHHHHCCEEEEECCCCCCCCEEECCCEEEEECCCCCEEEEECC T ss_conf 999736584699899999999999769589976788888788730389999799859999479

HHsearch alignment for GI: 254780212 and conserved domain: cd02968