RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780213|ref|YP_003064626.1| hypothetical protein CLIBASIA_00490 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >gnl|CDD|161779 TIGR00232, tktlase_bact, transketolase, bacterial and yeast. This model is designed to capture orthologs of bacterial transketolases. The group includes two from the yeast Saccharomyces cerevisiae but excludes dihydroxyactetone synthases (formaldehyde transketolases) from various yeasts and the even more distant mammalian transketolases. Among the family of thiamine diphosphate-dependent enzymes that includes transketolases, dihydroxyacetone synthases, pyruvate dehydrogenase E1-beta subunits, and deoxyxylulose-5-phosphate synthases, mammalian and bacterial transketolases seem not to be orthologous. Length = 653 Score = 26.2 bits (58), Expect = 2.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Query: 12 IEVNSILKEEIDDISVVSLPLSDDNMTIDEEYLEKL 47 +E L E + VVS+P D DEEY E + Sbjct: 556 VEAAKKLAAENIKVRVVSMPSFDLFDKQDEEYRESV 591 >gnl|CDD|178099 PLN02481, PLN02481, Omega-hydroxypalmitate O-feruloyl transferase. Length = 436 Score = 25.4 bits (56), Expect = 3.4 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Query: 20 EEIDDISVVSLPLSDDNMT-----IDEEYLEKL 47 EI+D+S S D+ + D E LEKL Sbjct: 217 AEIEDVSGTSKLYDDEELVYKSFCFDPEKLEKL 249 >gnl|CDD|153055 pfam12621, DUF3779, Phosphate metabolism protein. This domain family is found in eukaryotes, and is approximately 100 amino acids in length. The family is found in association with pfam02714. There are two completely conserved residues (W and D) that may be functionally important. This family is likely to be involved in phosphate metabolism however there is little accompanying literature to confirm this. Length = 95 Score = 25.3 bits (56), Expect = 4.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Query: 19 KEEIDDISVVSLPLSDDNMTIDEE 42 ++EI+ S V +P+SD+ T DE+ Sbjct: 59 RQEIEHTSDVGVPISDEGATFDEK 82 >gnl|CDD|178792 PRK00011, glyA, serine hydroxymethyltransferase; Reviewed. Length = 416 Score = 24.7 bits (55), Expect = 5.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Query: 27 VVSLPLSDDNMTIDEEYLEKLVVE 50 VVS + ++ ID + +EKL +E Sbjct: 140 VVSYGVDEETGLIDYDEVEKLALE 163 >gnl|CDD|181692 PRK09197, PRK09197, fructose-bisphosphate aldolase; Provisional. Length = 350 Score = 24.8 bits (55), Expect = 5.5 Identities = 8/23 (34%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Query: 24 DISVVSLPLSDDNMTIDEEYLEK 46 D+S L ++N+ I +YLE+ Sbjct: 135 DLSEEPL---EENIEICSKYLER 154 >gnl|CDD|178730 PLN03188, PLN03188, kinesin-12 family protein; Provisional. Length = 1320 Score = 23.7 bits (51), Expect = 9.6 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 4/26 (15%) Query: 29 SLPLSDDN----MTIDEEYLEKLVVE 50 SLP D++ M IDEE +E+L V+ Sbjct: 502 SLPHVDEDGDEEMEIDEEAVERLCVQ 527 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.313 0.133 0.362 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,008,536 Number of extensions: 48469 Number of successful extensions: 89 Number of sequences better than 10.0: 1 Number of HSP's gapped: 89 Number of HSP's successfully gapped: 17 Length of query: 63 Length of database: 5,994,473 Length adjustment: 35 Effective length of query: 28 Effective length of database: 5,238,193 Effective search space: 146669404 Effective search space used: 146669404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.1 bits)