RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780213|ref|YP_003064626.1| hypothetical protein CLIBASIA_00490 [Candidatus Liberibacter asiaticus str. psy62] (63 letters) >2qg3_A UPF0130 protein AF_2059; 2648472, uncharacterized protein AF2059, TYW3 like, structural genomics; HET: MSE; 1.95A {Archaeoglobus fulgidus dsm 4304} Length = 208 Score = 28.2 bits (63), Expect = 0.49 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 10/60 (16%) Query: 4 ITSLSKWDIEVNSILKEEIDDISVVSLPLSDDN-MTIDEEYLEKLVVESLDRSLRCNYEK 62 + SLS + +E+ S+ + E+ P+++ M +D+ YL +V + ++ L EK Sbjct: 138 VISLSNYVVEIASLERIEL--------PVAEKGLMLVDDAYLSYVVRWANEK-LLKGKEK 188 >3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE; 1.60A {Francisella tularensis subsp} Length = 663 Score = 26.1 bits (56), Expect = 1.9 Identities = 7/40 (17%), Positives = 21/40 (52%) Query: 12 IEVNSILKEEIDDISVVSLPLSDDNMTIDEEYLEKLVVES 51 ++V + +++ ++V S+P + T EY + ++ + Sbjct: 565 VKVANEFEKKGIKLNVASIPCVEVFATQAHEYKKTVIKDD 604 >3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Length = 314 Score = 25.4 bits (55), Expect = 3.7 Identities = 7/32 (21%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Query: 18 LKEEIDDISVVSL-PLSDDNMTIDEEYLEKLV 48 + IS +++ P + ID + L+ V Sbjct: 8 FSKRFSTISGINIVPFLEGTREIDWKGLDDNV 39 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 25.3 bits (55), Expect = 3.7 Identities = 6/39 (15%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Query: 6 SLSKWDIEVNSILKEEIDDISVVSLPLSDDNMTIDEEYL 44 L + ++ + + ++ ++ L + + T D++YL Sbjct: 197 ELIRTTLDAEKVFTQGLN---ILEW-LENPSNTPDKDYL 231 >2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Length = 391 Score = 24.3 bits (51), Expect = 6.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 37 MTIDEEYLEKLVVESLD 53 + I E+ L +L + SLD Sbjct: 362 IVIHEDILSELSIYSLD 378 >1ji8_A Dissimilatory siroheme-sulfite reductase; orthogonal helical bundle, structural genomics, PSI, protein structure initiative; NMR {Pyrobaculum aerophilum} SCOP: d.203.1.1 Length = 111 Score = 23.9 bits (52), Expect = 9.1 Identities = 7/38 (18%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Query: 2 GFITSLSKWDIEVNSILKEEIDDISVVSLPLSDDNMTI 39 F+ + WD +V L E++ I +++++ + Sbjct: 22 CFMQNPEDWDEKVAEWLARELEGI----QKMTEEHWKL 55 >3n4f_A Mandelate racemase/muconate lactonizing protein; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MSE; 1.88A {Geobacillus SP} Length = 392 Score = 24.0 bits (51), Expect = 9.2 Identities = 4/15 (26%), Positives = 8/15 (53%) Query: 37 MTIDEEYLEKLVVES 51 + D+E + L+ S Sbjct: 367 IVFDDELVTYLINRS 381 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.313 0.133 0.362 Gapped Lambda K H 0.267 0.0502 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 552,485 Number of extensions: 19809 Number of successful extensions: 77 Number of sequences better than 10.0: 1 Number of HSP's gapped: 77 Number of HSP's successfully gapped: 16 Length of query: 63 Length of database: 5,693,230 Length adjustment: 34 Effective length of query: 29 Effective length of database: 4,868,934 Effective search space: 141199086 Effective search space used: 141199086 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.6 bits)