HHsearch alignment for GI: 254780214 and conserved domain: TIGR02108

>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; InterPro: IPR011842 This entry describes coenzyme PQQ biosynthesis protein B, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ). PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases. Note that this gene appears to be required for PQQ in biosynthesis in Methylobacterium extorquens (under the name pqqG) and in Klebsiella pneumoniae but that the equivalent pqqV in Acinetobacter calcoaceticus is not necessary for heterologous expression of PQQ biosynthesis in Escherichia coli. Based on this latter finding, it is suggested that PqqB might be a transporter or a PQQ-dependent enzyme rather than a PQQ biosynthesis enzyme .; GO: 0006810 transport, 0018189 pyrroloquinoline quinone biosynthetic process.
Probab=100.00  E-value=5.6e-40  Score=268.11  Aligned_cols=251  Identities=22%  Similarity=0.314  Sum_probs=188.5

Q ss_pred             EEEEEEECCCCCEECCCCCCCCCCCCCCC----CCCCCCEEEEEECCCCCCCEEEEEECCCCHHHHHHH-------CC-C
Q ss_conf             99998541789651337887877778767----744430699993367789718999879841566752-------23-3
Q gi|254780214|r    6 HFTILGCGASLGVPRITGDWGACDPTNPK----NRRTRSSLKISRVSERGSNTTVIVDTGPDFYMQVLR-------EQ-V   73 (271)
Q Consensus         6 ~l~~LGtg~s~g~P~~~c~c~~C~~~~~~----~~R~~~s~~i~~~~~~~~~~~iLiD~G~d~r~ql~~-------~~-i   73 (271)
T Consensus         1 ~i~VLGSAAGGGfPQWNC~C~~C~~aR~~~~~ak~RTQsSiAvS~DG~rW----~L~NASPDiRQQi~a~paL~P~~~aL   76 (314)
T TIGR02108         1 HIVVLGSAAGGGFPQWNCNCPNCRGARAGTDGAKARTQSSIAVSADGERW----VLLNASPDIRQQIQAFPALHPQRGAL   76 (314)
T ss_pred             CEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCE----EEECCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             95886522678877525687034687730022033541168886788735----86707964888886203215777888


Q ss_pred             C--CCCEEEEECCCHHHHHHCCHHHHHHHCCC-CEEEEEECCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             4--20599997435242201110243331782-11101311202321002222101366775310012321123443334
Q gi|254780214|r   74 L--SIDAVLYTHPHADHIHGIDGLRGYFLKQK-RPIDVYAAPDCMKHLFESFRYCFKALDDRTYPPIVNPIVIENNDVPI  150 (271)
Q Consensus        74 ~--~Id~I~iTH~H~DHi~Gl~~Lr~~~~~~~-~~i~vy~~~~~~~~l~~~~~y~f~~~~~~~~~~~~~~~~~~~~~~~~  150 (271)
T Consensus        77 R~TpI~~V~Lt~g~iDH~tGLL~LR-----Egq~pf~~yat~~Vlq~L~~GNp-~F~~L~~~~G--gv~r~Pial~~~~~  148 (314)
T TIGR02108        77 RDTPIEGVVLTDGEIDHVTGLLSLR-----EGQQPFTLYATEMVLQDLSDGNP-IFNVLNHWNG--GVRRQPIALDEKFE  148 (314)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHC-----CCCCCCEEEECCHHHHHHHCCCC-CCCCCCCCCC--CCCCCCCCCCCCCC
T ss_conf             6576047882066224564123330-----37885148627157888754886-0212252237--65442311588867


Q ss_pred             C-EE-CCCCCEEEEEEEEEC---------------C---CEECCCCCC------CCEEEECCCCCCHHHHHHHHCCHHEE
Q ss_conf             2-01-158748999999507---------------7---621123346------86253032330016788862221102
Q gi|254780214|r  151 C-MK-SAGGVIEAIPILQQH---------------G---RISSLGFRF------GNVAYCTDVNAFPAESLEKLQNLDFL  204 (271)
Q Consensus       151 ~-~~-~~~~~i~i~~~~~~H---------------g---~~~~~Gyri------~~~~Y~~Dt~~~~e~~~~~l~~~D~l  204 (271)
T Consensus       149 ~~~~DG~~~gL~~t~f~vpgkaPlY~e~rs~~dl~g~~~~gdT~Gl~I~D~~~~k~~~YiPGca~vt~~L~a~~~~Ad~v  228 (314)
T TIGR02108       149 FKIKDGAAPGLEFTAFAVPGKAPLYSEHRSGEDLAGDPHPGDTLGLLIEDGKTGKRLFYIPGCAEVTDDLKARMAGADLV  228 (314)
T ss_pred             CCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCEEEEECCCCCCCHHHHHHHHCCCEE
T ss_conf             43147789886273566277777578100352136875788704899975367654787035666386889898617737


Q ss_pred             EEECCC--------------CCCCCCCCCHH---HHHHHHHHCCCCEEEEECCCCCC-----CHHHHHHHCCCCCEEEEE
Q ss_conf             530233--------------57688757999---99999997299779997688898-----888999867998199020
Q gi|254780214|r  205 IIDALK--------------NGLHSSHFSLS---ESLKKIELINPKNAILTHMHVDL-----DYDMVLKSTPSRVVPAFD  262 (271)
Q Consensus       205 I~d~l~--------------~~~~~~H~~~~---ea~~~~~~~~~k~~~LtHls~~~-----~~~~~~~~~~~~v~~A~D  262 (271)
T Consensus       229 ~fDGTlW~DDEM~~~Gvg~K~G~~MGH~~~sG~gG~~~~La~~~~~RKVLiHINNTNPiL~e~S~Era~~~a~Gw~VA~D  308 (314)
T TIGR02108       229 FFDGTLWRDDEMIRAGVGTKTGRRMGHVSISGEGGSLAVLADLEIARKVLIHINNTNPILDEDSPERAEVEAAGWEVAHD  308 (314)
T ss_pred             EECCCCCCCHHHHHCCCCCCCCCCCCCEEECCCCCHHHHHHCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHCCCEECCC
T ss_conf             75474023334641147873343125165368784556530689887789862277721244674478886468602157


Q ss_pred             CCEEEE
Q ss_conf             448996
Q gi|254780214|r  263 GMQFSS  268 (271)
Q Consensus       263 Gm~i~l  268 (271)
T Consensus       309 Gm~i~L  314 (314)
T TIGR02108       309 GMEIEL  314 (314)
T ss_pred             CCEECC
T ss_conf             756429