>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins. In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus

Probab=91.61  E-value=0.51  Score=27.84  Aligned_cols=30  Identities=17%  Similarity=0.267  Sum_probs=26.6

Q ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHC
Q ss_conf             889816631179898889999999999817
Q gi|254780217|r   31 GRMHHALLFEGEQGIGKATLGFRYAGHVLQ   60 (347)
Q Consensus        31 ~~l~ha~Lf~Gp~GiGK~~~A~~~A~~llc   60 (347)
T Consensus        84 ~~~~QsIiisGESGAGKTes~K~il~yL~~  113 (677)
T cd01387          84 AKQNQCVIISGESGSGKTEATKLILRYLAA  113 (677)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             099925999827978898899999999876