>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=96.20 E-value=0.0068 Score=42.97 Aligned_cols=52 Identities=15% Similarity=0.204 Sum_probs=36.5 Q ss_pred CCHHHHHHHHH-HCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHCEEEEEEC Q ss_conf 21035322055-4240001456777663034341676504433573025203698864 Q gi|254780217|r 130 YWRVIMIDPVD-GMNRNAANALLKSLEEPPQKVLFILISHASPTILSTIRSRCLSIKF 186 (347) Q Consensus 130 ~~Ki~IId~ad-~ln~~AaNALLK~LEEPp~~t~fiLit~~~~~il~TI~SRc~~i~f 186 (347) T Consensus 156 ~~~iliLDEpts~LD~~~e~~i~~~l~~~~~~~TvI~itH~l~~----l-~~~D~Iiv 208 (234) T cd03251 156 DPPILILDEATSALDTESERLVQAALERLMKNRTTFVIAHRLST----I-ENADRIVV 208 (234) T ss_pred CCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHH----H-HHCCEEEE T ss_conf 99989996876689989999999999998199989999278889----9-85999999

HHsearch alignment for GI: 254780217 and conserved domain: cd03251