>cd04158 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra

Probab=90.84 E-value=0.37 Score=29.01 Aligned_cols=122 Identities=17% Similarity=0.244 Sum_probs=59.1 Q ss_pred EEECCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCHHHHHHHCCCCCCEEEECCCCHHHCCCCCCCCCHHHHH Q ss_conf 63117989888999999999981779988643121012678867999967898754530010001013421232378875 Q gi|254780217|r 37 LLFEGEQGIGKATLGFRYAGHVLQNPDFSKAPVRMCNPDPCSPFVKQMASHALHDFLYLSYSLNPKTGKWRTVITVDEIR 116 (347) Q Consensus 37 ~Lf~Gp~GiGK~~~A~~~A~~llc~~~~~~~~~~~~~~~~~~~~~~~i~~~~hpd~~~i~~~~~~k~~~~~~~I~vd~IR 116 (347) T Consensus 2 IlilGl~~sGKTtil~~l~~~~~~~----~~pT~G~~~~-------~i---~~~~~~l--~iwD~gG~--------~~~r 57 (169) T cd04158 2 VVTLGLDGAGKTTILFKLKQDEFMQ----PIPTIGFNVE-------TV---EYKNLKF--TIWDVGGK--------HKLR 57 (169) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCC----CCCCCCCCEE-------EE---EECCEEE--EEEECCCC--------CCCC T ss_conf 9999989998899999995799689----7786881669-------99---9898899--99989997--------2446 Q ss_pred HHHHHCCCCCCCCCCHHHHHHHHHHCCH-HHHHHHHHHHHHCC-CCCCEEEEECCCCCCCHHHHCEEEEEECCCCCHHHH Q ss_conf 5443102221111210353220554240-00145677766303-434167650443357302520369886479998999 Q gi|254780217|r 117 RIRYFLSLTANTGYWRVIMIDPVDGMNR-NAANALLKSLEEPP-QKVLFILISHASPTILSTIRSRCLSIKFNSLSENNL 194 (347) Q Consensus 117 ~l~~~~~~~~~~~~~Ki~IId~ad~ln~-~AaNALLK~LEEPp-~~t~fiLit~~~~~il~TI~SRc~~i~f~~l~~~~~ 194 (347) T Consensus 58 ~~w~~Yy~~---~~~iIfVvDssd~~~~~ea~~~l~~ll~~~~~~~~piLIlaNK~D-l~------------~~~~~~ei 121 (169) T cd04158 58 PLWKHYYLN---TQAVVFVVDSSHRDRVSEAHSELAKLLTEKELRDALLLIFANKQD-VA------------GALSVEEM 121 (169) T ss_pred HHHHHHCCC---CCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCC-CC------------CCCCHHHH T ss_conf 367875557---627999998630677999999999997127537984999973556-77------------79899999 Q ss_pred HHHH Q ss_conf 9999 Q gi|254780217|r 195 YKAL 198 (347) Q Consensus 195 ~~~L 198 (347) T Consensus 122 ~~~l 125 (169) T cd04158 122 TELL 125 (169) T ss_pred HHHH T ss_conf 9985

HHsearch alignment for GI: 254780217 and conserved domain: cd04158